spacer

EBI Dbfetch

ID   FP929036; SV 1; linear; genomic DNA; STD; PRO; 3164379 BP.
XX
AC   FP929036;
XX
PR   Project:PRJNA39147;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
XX
DE   Butyrivibrio fibrisolvens 16/4 draft genome.
XX
KW   .
XX
OS   Butyrivibrio fibrisolvens 16/4
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae;
OC   Butyrivibrio.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Butyrivibrio fibrisolvens 16/4";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; 4cedeae784b52e3a5a965dff784215fd.
DR   BioSample; SAMEA3138350.
DR   EnsemblGenomes-Gn; CIY_T_34810.
DR   EnsemblGenomes-Gn; CIY_T_34820.
DR   EnsemblGenomes-Gn; CIY_T_34830.
DR   EnsemblGenomes-Gn; CIY_T_34840.
DR   EnsemblGenomes-Gn; CIY_T_34850.
DR   EnsemblGenomes-Gn; CIY_T_34860.
DR   EnsemblGenomes-Gn; CIY_T_34870.
DR   EnsemblGenomes-Gn; CIY_T_34880.
DR   EnsemblGenomes-Gn; CIY_T_34890.
DR   EnsemblGenomes-Gn; CIY_T_34900.
DR   EnsemblGenomes-Gn; CIY_T_34910.
DR   EnsemblGenomes-Gn; CIY_T_34920.
DR   EnsemblGenomes-Gn; CIY_T_34930.
DR   EnsemblGenomes-Gn; CIY_T_34940.
DR   EnsemblGenomes-Gn; CIY_T_34950.
DR   EnsemblGenomes-Gn; CIY_T_34960.
DR   EnsemblGenomes-Gn; CIY_T_34970.
DR   EnsemblGenomes-Gn; CIY_T_34980.
DR   EnsemblGenomes-Gn; CIY_T_34990.
DR   EnsemblGenomes-Gn; CIY_T_35000.
DR   EnsemblGenomes-Gn; CIY_T_35010.
DR   EnsemblGenomes-Gn; CIY_T_35020.
DR   EnsemblGenomes-Gn; CIY_T_35030.
DR   EnsemblGenomes-Gn; CIY_T_35040.
DR   EnsemblGenomes-Gn; CIY_T_35050.
DR   EnsemblGenomes-Gn; CIY_T_35060.
DR   EnsemblGenomes-Gn; CIY_T_35070.
DR   EnsemblGenomes-Gn; CIY_T_35080.
DR   EnsemblGenomes-Gn; CIY_T_35090.
DR   EnsemblGenomes-Gn; CIY_T_35100.
DR   EnsemblGenomes-Gn; CIY_T_35110.
DR   EnsemblGenomes-Gn; CIY_T_35120.
DR   EnsemblGenomes-Gn; CIY_T_35130.
DR   EnsemblGenomes-Gn; CIY_T_35140.
DR   EnsemblGenomes-Gn; CIY_T_35150.
DR   EnsemblGenomes-Gn; CIY_T_35160.
DR   EnsemblGenomes-Gn; CIY_T_35170.
DR   EnsemblGenomes-Gn; CIY_T_35180.
DR   EnsemblGenomes-Gn; CIY_T_35190.
DR   EnsemblGenomes-Gn; CIY_T_35200.
DR   EnsemblGenomes-Gn; CIY_T_35210.
DR   EnsemblGenomes-Gn; CIY_T_35220.
DR   EnsemblGenomes-Gn; CIY_T_35230.
DR   EnsemblGenomes-Gn; CIY_T_35240.
DR   EnsemblGenomes-Gn; CIY_T_35250.
DR   EnsemblGenomes-Gn; CIY_T_35260.
DR   EnsemblGenomes-Gn; CIY_T_35270.
DR   EnsemblGenomes-Gn; CIY_T_35280.
DR   EnsemblGenomes-Gn; CIY_T_35290.
DR   EnsemblGenomes-Gn; CIY_T_35300.
DR   EnsemblGenomes-Gn; CIY_T_35310.
DR   EnsemblGenomes-Gn; CIY_T_35320.
DR   EnsemblGenomes-Gn; CIY_T_35330.
DR   EnsemblGenomes-Gn; CIY_T_35340.
DR   EnsemblGenomes-Gn; CIY_T_35350.
DR   EnsemblGenomes-Gn; CIY_T_35360.
DR   EnsemblGenomes-Gn; CIY_T_35370.
DR   EnsemblGenomes-Gn; CIY_T_35380.
DR   EnsemblGenomes-Gn; CIY_T_35390.
DR   EnsemblGenomes-Gn; CIY_T_35400.
DR   EnsemblGenomes-Tr; CIY_T_34810.
DR   EnsemblGenomes-Tr; CIY_T_34820.
DR   EnsemblGenomes-Tr; CIY_T_34830.
DR   EnsemblGenomes-Tr; CIY_T_34840.
DR   EnsemblGenomes-Tr; CIY_T_34850.
DR   EnsemblGenomes-Tr; CIY_T_34860.
DR   EnsemblGenomes-Tr; CIY_T_34870.
DR   EnsemblGenomes-Tr; CIY_T_34880.
DR   EnsemblGenomes-Tr; CIY_T_34890.
DR   EnsemblGenomes-Tr; CIY_T_34900.
DR   EnsemblGenomes-Tr; CIY_T_34910.
DR   EnsemblGenomes-Tr; CIY_T_34920.
DR   EnsemblGenomes-Tr; CIY_T_34930.
DR   EnsemblGenomes-Tr; CIY_T_34940.
DR   EnsemblGenomes-Tr; CIY_T_34950.
DR   EnsemblGenomes-Tr; CIY_T_34960.
DR   EnsemblGenomes-Tr; CIY_T_34970.
DR   EnsemblGenomes-Tr; CIY_T_34980.
DR   EnsemblGenomes-Tr; CIY_T_34990.
DR   EnsemblGenomes-Tr; CIY_T_35000.
DR   EnsemblGenomes-Tr; CIY_T_35010.
DR   EnsemblGenomes-Tr; CIY_T_35020.
DR   EnsemblGenomes-Tr; CIY_T_35030.
DR   EnsemblGenomes-Tr; CIY_T_35040.
DR   EnsemblGenomes-Tr; CIY_T_35050.
DR   EnsemblGenomes-Tr; CIY_T_35060.
DR   EnsemblGenomes-Tr; CIY_T_35070.
DR   EnsemblGenomes-Tr; CIY_T_35080.
DR   EnsemblGenomes-Tr; CIY_T_35090.
DR   EnsemblGenomes-Tr; CIY_T_35100.
DR   EnsemblGenomes-Tr; CIY_T_35110.
DR   EnsemblGenomes-Tr; CIY_T_35120.
DR   EnsemblGenomes-Tr; CIY_T_35130.
DR   EnsemblGenomes-Tr; CIY_T_35140.
DR   EnsemblGenomes-Tr; CIY_T_35150.
DR   EnsemblGenomes-Tr; CIY_T_35160.
DR   EnsemblGenomes-Tr; CIY_T_35170.
DR   EnsemblGenomes-Tr; CIY_T_35180.
DR   EnsemblGenomes-Tr; CIY_T_35190.
DR   EnsemblGenomes-Tr; CIY_T_35200.
DR   EnsemblGenomes-Tr; CIY_T_35210.
DR   EnsemblGenomes-Tr; CIY_T_35220.
DR   EnsemblGenomes-Tr; CIY_T_35230.
DR   EnsemblGenomes-Tr; CIY_T_35240.
DR   EnsemblGenomes-Tr; CIY_T_35250.
DR   EnsemblGenomes-Tr; CIY_T_35260.
DR   EnsemblGenomes-Tr; CIY_T_35270.
DR   EnsemblGenomes-Tr; CIY_T_35280.
DR   EnsemblGenomes-Tr; CIY_T_35290.
DR   EnsemblGenomes-Tr; CIY_T_35300.
DR   EnsemblGenomes-Tr; CIY_T_35310.
DR   EnsemblGenomes-Tr; CIY_T_35320.
DR   EnsemblGenomes-Tr; CIY_T_35330.
DR   EnsemblGenomes-Tr; CIY_T_35340.
DR   EnsemblGenomes-Tr; CIY_T_35350.
DR   EnsemblGenomes-Tr; CIY_T_35360.
DR   EnsemblGenomes-Tr; CIY_T_35370.
DR   EnsemblGenomes-Tr; CIY_T_35380.
DR   EnsemblGenomes-Tr; CIY_T_35390.
DR   EnsemblGenomes-Tr; CIY_T_35400.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF02004; group-II-D1D4-5.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen -- http://www.rowett.ac.uk/divisions/ghp/
CC   Sequencing technology: 454
CC   Genome coverage: 63x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3164379
FT                   /organism="Butyrivibrio fibrisolvens 16/4"
FT                   /strain="16/4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:657324"
FT   CDS             2217..2594
FT                   /transl_table=11
FT                   /locus_tag="CIY_00120"
FT                   /product="FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYS5"
FT                   /protein_id="CBK73014.1"
FT                   /translation="MADLNYLKRINDTYGHEKGNEYIFGACHEMCLIFNHSPIFRIGGD
FT                   EFVILLERLDYLNRNSLLTNLELIFDKSANDKTKEPWQQYSVALGMASFDPATDLSIED
FT                   VFKRADKRMYENKQKMKAARE"
FT   CDS             complement(2851..3309)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73015"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYS6"
FT                   /protein_id="CBK73015.1"
FT                   /translation="MNRGLGATAKRNRIANYMDAIPEEFEVLEDNLGEAEPSIKLQTKK
FT                   RVISLSCDSTGKVIEDFSMREGAGSKEEFLEKQEAYNAINTYYNDYYTGAKIVKNSFDE
FT                   GELKLELDDRTVTLTYLPLLKTVEEKDRAKRKAKPKVDSVEVDIEKKK"
FT   CDS             complement(3806..4114)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73016"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYS7"
FT                   /protein_id="CBK73016.1"
FT                   /translation="MRISELTSGNKPYIRIIRGKKKVDIPITPKFVMLPATKMLYKDYG
FT                   YVGCEAIRINFKGKTVKLNWTFNHNKMTLFCSSGRKAYSWKNVKVTTVTTANGKKSI"
FT   CDS             complement(4166..4471)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73017"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYS8"
FT                   /protein_id="CBK73017.1"
FT                   /translation="MISSDEIEKMANDEEYSNKVLTDMESAIDMSKKVSEEYGYIKKMT
FT                   IELLGDGNINFLAELVGGKKLEATSEENLRSQLNEIDWDKIAAEAGNSGTKIDFSV"
FT   CDS             complement(4618..4740)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73018"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYS9"
FT                   /protein_id="CBK73018.1"
FT                   /translation="MVGVNGLGNMLNRYGTTVQKLKRRRRLQIQRRLQRLLKRR"
FT   CDS             complement(4871..6106)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00180"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73019"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT0"
FT                   /protein_id="CBK73019.1"
FT                   /translation="MHGVVEILYSGYTAAFQILLLNAIFGRPRTTGGVVGQGVYGVLWA
FT                   AALYFCGVLFFGPSGFIPYLAVFLLFEIIFGFFGCKGSLLCRLVTMMASWTTFLLCKTL
FT                   ISYVGVTGYYTYLFSIILELILAYYIYDLRFNDVCGLDVKSSGDLSITCALMFFVTVSE
FT                   VAVIMQDFRANFSMGDIGWKIITLFIMIEIVIYTMISFLSKEYSRKIYDTMVEEKKYHS
FT                   SELKELHKLNHEIRNKVFYMKELIDAKNYSKLEEYFKDNFELKFYSEEDYTGNKVIDDC
FT                   IRIKMDRARHNKIDFQIETGTLPEGMVDEGDLTELLFNLLDNAMDAEDDVKEKWVKLKM
FT                   RFVKGYIYIDVLNATNYDVLKENPGFLTSKEDMDRHGFGMEIIREIVDKNNGMIKFCSN
FT                   TNYFGVNIMLML"
FT   CDS             complement(6108..6827)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00190"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73020"
FT                   /db_xref="GOA:D4IYT1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT1"
FT                   /protein_id="CBK73020.1"
FT                   /translation="MYNIAFCDDERISLDIVSEKVSGEFSRLKYPIKEHRYEKARSLQK
FT                   DITDGKKFDAIFLDIAMPDFDGLNLGMWLSEKCSDTYIVYVSSRSELVYRTFRTRPFSF
FT                   LRKNHLDRELSDIIGDLCKQLQQDSSDDYFEIQLDNNEMFKFHGSNIIYIELKGKNCKV
FT                   VSTKGDFTTKCSLSSYVDKLENQGFIQIGKSYLVNYKYIFQIRSNEVVLDDGKILPLSR
FT                   YKAKEVKEKFIELVGKD"
FT   CDS             complement(8240..9367)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00220"
FT                   /product="multiple monosaccharide ABC transporter membrane
FT                   protein"
FT                   /function="multiple monosaccharide ABC transporter membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73021"
FT                   /db_xref="GOA:D4IYT2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT2"
FT                   /protein_id="CBK73021.1"
FT                   /translation="MVIALVIIIGIFYVGTNGTILLPQNINNLLSQNAYVFVLGTGMLM
FT                   CILTGGNIDLSVGSVVCFVGGIGAVLMSKDVNVWVAVLVMLLVGIAVGAWQAFWVAYVN
FT                   VPPFIATLAGMYAFRGLSNVVLNGYAVSISNTTYLNVFGGGADCYIPDFFHGTGLNITC
FT                   LLAGFIIVAIYVLLSVKNRFSAIRKGYSTTGAVGFYAKLVIISLVIIYLFYKLAGYKGI
FT                   PSALVWIFVVVLSYHYFTTKTTMGRYLYAVGGNEKATQLSGINTKKVYFFAYTNMGFLT
FT                   AIAGILTVARAASAQPTYGQFYEMDAIGACFIGGASAYGGTGSVFGAIIGALLMGVINQ
FT                   GMSIMGVDANYQKVVKGLVLLAAVIFDVMSKREKK"
FT   CDS             complement(9361..9408)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73022"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT3"
FT                   /protein_id="CBK73022.1"
FT                   /translation="MVSNNIGNALKNTPW"
FT   CDS             complement(11121..12242)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00250"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73023"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT4"
FT                   /protein_id="CBK73023.1"
FT                   /translation="MKKKLLSVLLTGAMAASMFVGCGTSTETTDNAAPAAEGEATESTT
FT                   TAGGTKVGVAMPTKDLQRWNQDGANMQKELEAAGYEVDLQYASNDTQTQVSQIENMINS
FT                   GCNVLVVAAIEASSLGEAMDMAASANIPVIAYDRLIMNTDAVSYYATFDNYKVGTVQGQ
FT                   YIIDQLDLENTDKTFTMEITAGDPGDNNAGFFYNGAMDLLKPYIEKGTIVVKSGQTEFQ
FT                   DVATAAWATETAQSRMENILSSYYADGTDLDICLCSNDSTALGVENALAANYNGKYPIV
FT                   TGQDCDIENTKNMIAGKQSMSVFKDTRTLASQVVKMVGQILNGEEVDVNDTTTYDNNNG
FT                   VVPSFLCDPVFADVNNYKEILIDSGYYTEDQLQ"
FT   CDS             complement(12440..13483)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00260"
FT                   /product="xylose-binding protein"
FT                   /function="xylose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73024"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT5"
FT                   /protein_id="CBK73024.1"
FT                   /translation="MKGFLRKVMTFALMGCLLCGCSSSVAKDASQQPEEDELEIGMCFD
FT                   SFVIERWEKDRDVFVSTASSLGATVNVQNANGDSSKQVEQIQYLIDKKVDCIVIIAIDA
FT                   DALKDVLKDAKKAGIPVVCYDRLIPNVNTDLYISFDNEKVGEMLGEAIASQNVEDVIMI
FT                   CGPLTDNNVPMVNQGFLSVMEENNIKVLDSYNCEGWKAEMGSAYVYDNMENIREADAIM
FT                   CGNDDVATSVIKALAVGQLAGKIPVVGQDADLPACQHIVQGTQLMTVYKPVGKLAEEAA
FT                   KLSVQLAKGQSLDVENVINDGTYKIPYVAIEPIAVNKDNIDEVIIDGGFHSREDVYLNT
FT                   LDTTGEN"
FT   CDS             complement(13502..15091)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00270"
FT                   /product="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73025"
FT                   /db_xref="GOA:D4IYT6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT6"
FT                   /protein_id="CBK73025.1"
FT                   /translation="MYKVMLADDEGIVIDSLKFIIEKEFGSQCEIRVAKTGRQVIELAE
FT                   EFQPDIAFMDIQMPGINGIEAMREIRRTNKHVVFIVMTAYDKFDYAKEAISLGVLDYLN
FT                   KPVSREAIIDILKKAMGQIDGERTKRSNDLKVREKLEIVVPIIENGLIQDLLFKEYFKE
FT                   DIDNYKTLLGISSDYGYMACMVFGRELVGNYMTSAVAASIQAQKSYREIHTITEDYIRG
FT                   IMGNVMSNKIPILIPCDSDTLSYNERNAIVESARALCRKLADRFDMDFRIGFGSVKPLE
FT                   RMSESYEEANSVLISNTSHVAHVDDMPVACQYESNYPMELEKRLFDEITLGNVSESVSV
FT                   AQSFFDWMDSTYANDNDSVRLKCLEFVLWAEHLAYEKTGRMYEFKSRANYLSELMSLPG
FT                   LADVRIWFIEKIKDAAFWVSNKHEQQSMSAVNQAKQYIDENYMKELTLDDVSRVVNISS
FT                   YYFSKVFKEETGENFIDYLTKLRIEAAKKLLKTTNKSMKEISTEVGYSDPNYFSRNFKK
FT                   YTGKTPTEYAKG"
FT   CDS             complement(15079..16515)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00280"
FT                   /product="Putative regulator of cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73026"
FT                   /db_xref="GOA:D4IYT7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT7"
FT                   /protein_id="CBK73026.1"
FT                   /translation="MIIVFCLPIILLFMVNIVLYLGTDRMLKSLDEVYASNNSLNELTV
FT                   ALDGLQTATMVYLGTKTSNALEQYYIAEQNYSDLLASLDDNQDVNESRVLERNILKMSS
FT                   NYLELTNHAVESKRGGNVEKYKSYYEEASRTYSYIDANITSLNNQQFINNSKSYSTMMS
FT                   ALQTLEQLNIFTLVIIGVANLSFVVLIASTITSPLVKLAQAANAVSNGDFDVALPAVRN
FT                   NDEVGVVTRAFSKMVVSIKAYITKLTESMETERKLKENELIMANHVKDAELKYLQSQIN
FT                   PHFLFNTLNAGAQLAMMEGADRTSEYMHNVANFFRYNIKKNKDVVSLKEEIELVDIYIY
FT                   IINVRFAGEIQFVKNIDESLLDVKIPSMILQPIVENSINYGIRNIEWAKKISLSVYELG
FT                   DYICVSIKDNGIGMSNETITKILEGSYEENPQKTDSNGVGLANCIERLNIFYERDDVLD
FT                   IISEGENKGTETILYLPCIK"
FT   CDS             complement(16537..17589)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00290"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73027"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT8"
FT                   /protein_id="CBK73027.1"
FT                   /translation="MKFNGRKFKFKSSSALVVAAGCTVAFMFLTTIISFILFQQRMNEA
FT                   NVLLKDAQYNSYDSYVVLITSNDKNDFWQNVYNSASEYGRANGVYVDMISDNVDVNFSK
FT                   LELLEMAIESGCDGIMIEGDNNPETIELLNKARSAHIPVITLEEDIASDSRVSYVGVNN
FT                   YTIANLYANSIKKNLVKQKHVMVIANNNYDDTSLNTFVNNIQEAFSTEELPNGPLEFDV
FT                   RKIESDSAFATEEYIQNLFQKNEIKPVVICLDELSTESFYQAMIDYNKVGQILLFGNYE
FT                   SQSIYTGIKQGVIKGTVTMNAASMGEAATKAFIEYRQTGHVSDYINVEPQIIDNSNIDT
FT                   YIEEVERGKH"
FT   CDS             complement(17645..18571)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73028"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYT9"
FT                   /protein_id="CBK73028.1"
FT                   /translation="MISPILGDNLQTEETEKEADVNAVSKNVTPGSGSGHQVRMRTMEY
FT                   LIRMLLLGRYFDEDSEFGRMLREIYGGDNEMSDMGMSETQPLFVQNTTVSFERWESQSV
FT                   SYSSTGTAITADGRKLSFNYSFAMSDSFTEKYQMVDVAIRNCVDPLVINLDDCPTSISD
FT                   QTFFFDLDGDGEDDELHNIGKGAGFLALDKNDDGFINNGLELFGARTGDGFNELAAYDE
FT                   DGNGWIDENDPVFTKLRIMTITENGDQELYGLKESDVGAIYLGRLDTEFVHRDDENTSQ
FT                   AVTRKSGIFLHESDGRAGGVQHLDFIM"
FT   CDS             complement(18546..18863)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73029"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU0"
FT                   /protein_id="CBK73029.1"
FT                   /translation="MMIFLPIYNYTDDNHRDQEGHRFSWFSFVCKLWHQFTKKNFYDDR
FT                   KRTFFFLTLFGFYKGGKRMVIQNSEVSMTSTASYTSGMRLAVQSETKPIFNLDDITYFR
FT                   G"
FT   CDS             complement(18838..19722)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00320"
FT                   /product="CAAX amino terminal protease family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73030"
FT                   /db_xref="GOA:D4IYU1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU1"
FT                   /protein_id="CBK73030.1"
FT                   /translation="MNQNQDDRRRYISWIFLPTILAIVIQTAMAIMALEFYVVAGMSTY
FT                   KDGDYTSFVVKVINNYTNGDGAALSSVAYAIVTTVVAFYIFKKIFREGRISGLANKSQS
FT                   LPLTVAGVIMFSCGMNYVTLYLLNSLASAFPTWLEEYNNLLDAAGVGSTMTIPMTAYAI
FT                   ILGPICEELLFRGITFFAAKKVMPVHFAILVQAIMFGAFHMNKLQGIYAFVLGLGLGYI
FT                   MHLYDSLFMTILIHIIFNFIGTIGSEYLPTGGDSLISFFLCMLSSLVVTYLSIICLRKG
FT                   AANLNNDDIFTDI"
FT   CDS             complement(19740..22196)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00330"
FT                   /product="glycogen/starch/alpha-glucan phosphorylases"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73031"
FT                   /db_xref="GOA:D4IYU2"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU2"
FT                   /protein_id="CBK73031.1"
FT                   /translation="MKRQMPSTKDLEREIKDRVKSMFRKDFEEATKEEIYRACAEVVND
FT                   VVIDNWLTTQKEFTKQDPKCVYYMSMEFLIGRLLGNNMINMRGYTEVMDALANLGVDIN
FT                   LIEDQEPDPALGNGGLGRLAACFLDSLATLQYPAYGCGIRYHYGMFKQKINDGFQEEVP
FT                   DDWLQTRYPFELERPEYEFEVKFGGWVRYENQPDGTTKYIHEGYNSVLATPYDMPITGF
FT                   DNGMVNTLMIWDAKPKEVFRLASFERGDYNKAVEDMNLARNLTEVLYPNDNHIQGKELR
FT                   LKQQYFFVSASLQRALHKYLRYHSDITRLPEKVVFQMNDTHPTLTVAELMRLLMDEHGL
FT                   GWDEAWEVTTHCVAYTNHTIMAEALEKWPEDIFKGLLPRIFMIVEEINRRFCEDIRAKF
FT                   PGDEERVHRMAILADGQVKMAHMAICAGYSVNGVAALHTEILKNVSLHDFYEMYPEKFN
FT                   NKTNGITQRRFLMHGNYKLSDWVIKKIGRGWITDLSQMERLTMVLDDPKSLKQFMDIKL
FT                   ENKKRLAKYIWDHNHINVDPNSIFDVQVKRLHEYKRQLLNILHVMYLYNQIKENPEMDF
FT                   YPTTFIFGAKASAGYENAKLIIKLINNVGAVINNDKSIDNKLKVVFIEDYRVSNAEWIF
FT                   AAADVSEQISTASKEASGTGNMKFMLNGAVTIGTMDGANVEMYQELGGENIFIFGMSSD
FT                   EVIAHEKNNDYNPVDEMNKNHHIQKVLSQLVNGYYSIENPELFRPIYNSLLNTECTERA
FT                   DTYFVLKDFASYCEAHEKIQEAYKDQNKWARMALSNVAHVGKFSSDRTIQEYVDDIWHL
FT                   DKLELK"
FT   CDS             complement(22213..23811)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00340"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73032"
FT                   /db_xref="GOA:D4IYU3"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU3"
FT                   /protein_id="CBK73032.1"
FT                   /translation="MKRVPEVIDCWFDSGAMPFAQHHYPFENKEVFEQQFPAKFISEAV
FT                   DQTRGWFYSLMAESTLLFNKAPYENVIVLGHVQDENGQKMSKSKGNAVDPFDALEKMGA
FT                   DAIRWYFYTSSAPWIPKRFGENAVMEGQRKFLGTLWNTYAFYILYANIDEFDPTKYELD
FT                   FSKLAVMDKWILSRLNSAIKAVDENLASYKIPEAARALDEFVDDMSNWYVRRCRDRFWA
FT                   KGMEQDKINAYMTLYTCLKDISLAAAPMIPFMTEEIYQNMVRSVDKTAPESIHLCDFPV
FT                   VNEAFIDKKLEEDMDELLKIVVHGRACRNTANIKNRQPIGQMYIKAAHELDEMYVSIIE
FT                   DELNVKKATFTDDVSSFTSYSFKPQLRTVGPKYGKFLGGIQKALSSLDGNAAYAELKAN
FT                   GVLRLPEVDASIELAEEDLLISMAQTEGFVADGDNYVTVVLDTNLTEELLEEGFVREIV
FT                   SKIQTMRKEADFEVMDRITVSYESSDKIKGVFENNKDFIANEVLADAINVGATGSHVKE
FT                   WNINGEKVTLGVSKN"
FT   CDS             complement(23808..25370)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00350"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73033"
FT                   /db_xref="GOA:D4IYU4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU4"
FT                   /protein_id="CBK73033.1"
FT                   /translation="MYNKVDASLNFVEREKQVLKFWEENDIFQKSMDSRKEGETYTFYD
FT                   GPPTANGKPHIGHVETRAIKDMIPRYQTMKGKFVPRKAGWDTHGLPVELEVEKLLGLNG
FT                   KEQIEEYGMEPFIKQCKESVWKYKGMWEDFSGTVGFWADMDNPYITYDDNFIESEWWAL
FT                   KTIWDKKLLYKGFKIVPYCPRCGTPLSAQEVAQGYKTVKERSAIARFKIKGEDAYFLAW
FT                   TTTPWTLPSNLALCVNPVETYIRVKAADGYTYILAEALADKVLGKLAKEEGEKAYEVLE
FT                   SYKGTDLEYKEYEPLFECAGVAAEKQHKKAHFVTCDDYVTMSDGTGIVHIAPAFGEDDA
FT                   KVGRKYDLPFVQFVNGKGELTEETPYAGQFVKDADPNVLKDLDAKGQLFEAPKFEHEYP
FT                   HCWRCDTPLIYYARESWFIKMTEVKDDLIKNNNTVNWIPDSIGKGRFGDWLENVQDWGI
FT                   SRNRYWGTPLNIWECPDCGKQISIGSRKELAELSGRPEAEKSSFTVHTSTRLHVHVLIV
FT                   RAQ"
FT   CDS             complement(25479..26000)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73034"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU5"
FT                   /protein_id="CBK73034.1"
FT                   /translation="MSYDYYYTDDVEREIKNLHNGTKGQANYGLAVASMVVGIVSLVFF
FT                   LFFINIILAIAAIIMAIVFLSSSAKGERGRGFATAGIITAILSIVFCIGSYVIIFSNAD
FT                   NISRMMQNEIDNNPQYHLYEDNGNGVDPFSTDPFEDFDDFYEFYNNYNGIDGLENPDDL
FT                   NSLPGQDDTL"
FT   CDS             complement(26209..27012)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00370"
FT                   /product="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73035"
FT                   /db_xref="GOA:D4IYU6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU6"
FT                   /protein_id="CBK73035.1"
FT                   /translation="MSEFNNLKLEVADEIAVLTISRPAALNALNSETLDELNVALTEIE
FT                   ARDDVKVLILTGGPDKKDNAFKSFVAGADISEMVNFTAAEARAFGMRASVPFFKLMNMR
FT                   QVTICAVNGFALGGGCEISMACDIRIASENATFGQPECGLGIIPGFGGTQRLARLIGMG
FT                   RAKELIFTCDSIDANEAYRIGLVNKVVPCEELMDTAKAMAKKIASKGSYAVSIAKAAIN
FT                   NGYDMDIKNAVEMEANLFGITCSTHDKAEGMGAFLERRAANLTDF"
FT   CDS             complement(27109..27186)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73036"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU7"
FT                   /protein_id="CBK73036.1"
FT                   /translation="MLMGEIFDEADAKMYLNKKHMKAAK"
FT   CDS             complement(27216..29228)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00390"
FT                   /product="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73037"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU8"
FT                   /protein_id="CBK73037.1"
FT                   /translation="MVLSKLEQFHQLGFKIWMDNYGGGDLAPIMLQQVHFDLVKIDMGL
FT                   VQRLRENKAARVVATELSKLAMGLGINVAAEGVEDSDTVMFLNEIGCSNLQGFYFCKPI
FT                   SLAELLTRYENGTQIGFENPDEMEYYDTIGKTSLYDLSFANNNEGEVTDYFDTLPMAIF
FT                   QVDEEEIRLIRCNGNFSKFFYANYTGISGSVSFKFKDAENHVGFSALKAMKRCAKDGKR
FT                   AIIDERTMAGRSIQLFLQKLTDNPVTKTSAVAAVVLSVKDRPNTGDDLTYNYIANALAE
FT                   DYIRLFFVDLESNEYVEYAADGKNRDLKVAKSGPDFFEAALKRNLEFVYKEDKKRFKND
FT                   FSKEKVIKDINKYGKYNITYRAMLNGVPTYVNLKAIRVRTDNYHILVGVTDVDVQMRQQ
FT                   EAYERIKEEHLAYNRITALAGNFISIYTVNPENNHYSLFKTTERFQKIDLESEGDDFFE
FT                   ETRKNCLQVVYKEDLEYFLDVFTKENIMDTIEKNGFFSITYRLCLEPEVPTYISLRGTI
FT                   IEELDGPVLLMGLLNVDDEIKREIKLELSLSAAEEKAKRDALTGVKNKNAYTATEEEYN
FT                   KHISDGSAGDFAIVVCDLNGLKEVNDTQGHQMGDLYIQEGCKIICNIFSHSPVFRVGGD
FT                   EFAVLVRGLDYENIDKLMKSMDDINAKNKKKARLL"
FT   CDS             complement(29300..29671)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00400"
FT                   /product="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73038"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYU9"
FT                   /protein_id="CBK73038.1"
FT                   /translation="MNTEERIPDKRKYLLENFGRAIQEGWIEVYYQPIIRSSSGRVCGE
FT                   EALVRWDDPILGILNPAEFIPILESVNLIDRLDLYVLEQVIKKLELLKERGIYTVIHSV
FT                   NFSQIDFFSVDIVDEVKKE"
FT   CDS             complement(29769..30392)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73039"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV0"
FT                   /protein_id="CBK73039.1"
FT                   /translation="MKNCPYCKINVGGNLKKCPFCQSRLVGEDDEKYFPTQLKLKFQSL
FT                   FYKMQLFFVWILIISALGVDFMFHLPLGPYKGFHWSLLVLMWLLAFEYSIIHIFKKGMD
FT                   ASRILSITVVIVAIMVCITAYYFGFLRFVLQWVMPIVVMCTIIANFILSLVDKSGNAMV
FT                   YLLTDLLIGIVPYLVCFALKKNCPIEWMICLLVSFVIFVGAIIF"
FT   CDS             complement(30392..31639)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV1"
FT                   /protein_id="CBK73040.1"
FT                   /translation="MSRENWYKVDNVAKVFLATAAKRDTRTLRVSCTLWEDIEPELLQE
FT                   AVESAIQLRPQFHVRVRRGIFWHYMEDTDLQPIVEKEHGRVCPSLYHPGRMMLHYKVTY
FT                   YHNRINLDLFHAISDGTGALEFLNIIVFDYLKLKYPQKLEELNVHSGASEDDLNQDSYK
FT                   QFFGNLSLKSSQLKVAYHPGGLKLPYYQLQFFEIQIPTEDILPKAKAMGVGMTSYIGSK
FT                   LMMAIKDDMPSRKRHMPINVSMPVNLRNYYPSQTSRNFFNNVNVSHVFDQEISLEDLAR
FT                   EFDVKLKESLTEENIKKQMDNFETMEYFIPVRAVPLFIKQMVVRYGSKITDKKVSVVLS
FT                   NLGIQRPPEELVPMIKNYNGFCSSSNLFVVMSSYNGVMTLGISSPYSNTKVVKNFVRGL
FT                   SEDGMKITAYATEVIR"
FT   CDS             complement(31636..32457)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00430"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73041"
FT                   /db_xref="GOA:D4IYV2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV2"
FT                   /protein_id="CBK73041.1"
FT                   /translation="MELAGKLAAPTGGVTLEAFKVKKIPCEWVKPELAHNPQYVILYAH
FT                   GGGYTCGGLGYARILAAKLAVSTGFSVVSFEYRLAPEHKFPAALDDGHEVLKYLIDKGY
FT                   SLDKIILAGDSAGGNLMVCLTQRLLQQGNNPPRMLILFSPWTDMTAKSKSYQQYDGKDP
FT                   ILTKHYVESVRDAVIGTDAEPSDPIYSPLFGDFHHFPATLVQVGKTEILYDDSANLVKN
FT                   INKAGGNAKLDVEKSGWHVYQQMPLPVASRAMRRLSEYVSEEIYKIKVSFI"
FT   CDS             32791..32988
FT                   /transl_table=11
FT                   /locus_tag="CIY_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73042"
FT                   /db_xref="InterPro:IPR025906"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV3"
FT                   /protein_id="CBK73042.1"
FT                   /translation="MDITELSMSLSQNKLLSAVGTTMLGKTLDVMEGQAQLFAEGIDMN
FT                   APSLESLVYPTSGTMIDMRL"
FT   gap             33318..33605
FT                   /estimated_length=288
FT   CDS             complement(33629..34327)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00460"
FT                   /product="Negative regulator of genetic competence,
FT                   sporulation and motility"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73043"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV4"
FT                   /protein_id="CBK73043.1"
FT                   /translation="MKFKKIGEDKIRCVITKEEMEQNGMELGDFVSDQEKTQSFIRDIL
FT                   AEACETLGIETHAKAYSVQMTVMPQGDVALLISPDSSSGLATAIEELKKHLTGLQETLS
FT                   TTKKEQAISGSTADVPVQPVQTLRNDKDEVTSQYLDTPLWAILPSLDASIDLCKHIPKF
FT                   EGIQSVLYRYGDDYYVKLNFELTRRQISAVILVIAEYASQMFTESFDGAFLLEHGDVIC
FT                   EDCVNVLSQI"
FT   CDS             complement(34539..35447)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00470"
FT                   /product="dihydroorotate dehydrogenase (subfamily 1) family
FT                   protein"
FT                   /EC_number="1.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73044"
FT                   /db_xref="GOA:D4IYV5"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV5"
FT                   /protein_id="CBK73044.1"
FT                   /translation="MKTSVNIAGVEFQNPVMEASGTFGSGMEYSEFVDLNKLGAVVTKG
FT                   VANVPWPGNPTPRITEVRSGMLNAIGLQNPGVEVFCERDLKFLEQYKNTKVIVNVCGHS
FT                   AEEYIEVVERLANESRVDMLEINISCPNVKEGGIAFGQAPKAVEEITRLVKSHAKQPIV
FT                   MKLSPNVTDIKVMAKAAEAGGADAISLINTLTGMKIDVERQNFVLANKTGGMSGPAVHP
FT                   IAVRMVYECANSVSIPIIGMGGITTWEDAIEMMLAGATAVSVGTANFFNPTATMDILSG
FT                   IEDYMVRKKIEDINSIVGIVK"
FT   CDS             complement(35448..36212)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00480"
FT                   /product="2-polyprenylphenol hydroxylase and related
FT                   flavodoxin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73045"
FT                   /db_xref="GOA:D4IYV6"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR023455"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV6"
FT                   /protein_id="CBK73045.1"
FT                   /translation="MKIKETAKVLNQSKLAEGIFSLTIATTASEYAIPGQFINIFSKDA
FT                   SNLLPRPISICEIDKAAGTLRMVYRVVGKGTTEFSSLKAGDTAEIMGPLGNGFPLEGEK
FT                   AIVVGGGIGVPPMLELAKQLPGSVTAVMGYRNDDLFLSEEFTDVASDLIIATDDGSVGV
FT                   HGTVVDAMVENELEADVIYACGPKPMLRAVAQYAAEHNIKCYVSMEERMACGVGACLGC
FT                   VCQSKDVDDHSHVHNKRVCKDGPVFLSTEVVL"
FT   CDS             complement(36212..37132)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00490"
FT                   /product="orotidine 5'-phosphate decarboxylase, subfamily
FT                   2"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73046"
FT                   /db_xref="GOA:D4IYV7"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV7"
FT                   /protein_id="CBK73046.1"
FT                   /translation="MIQKLINQIKEKNAPIVVGLDPTMKLMPKSLVDKYINEYGQTLEA
FT                   VGEAMFDYNRQIMDACADLIPAVKPQIAMYESFGIPGMIAYKKTVDYAKELGLIVIADI
FT                   KRGDIGSTSTAYALGHLGSVQVGDYKYQGFDADMATVNPYLGSDGVKPFVDVCKEEDKG
FT                   IFVLCKTSNPSSGEFQDRLIDGRPLYEHMAEKIEEWGMETREGYYSNVGAVVGATYPEM
FT                   GAKLRKLMPHTYILVPGYGAQGGKGKDLVNFFNEDGLGAIVNSSRGIIAAYQQEKYAKY
FT                   GEENFAGASRAAVEDMLDDIRGALK"
FT   CDS             complement(37113..38399)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00500"
FT                   /product="dihydroorotase"
FT                   /function="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73047"
FT                   /db_xref="GOA:D4IYV8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV8"
FT                   /protein_id="CBK73047.1"
FT                   /translation="MSLIIKNGRVLNPPTNTDEILDIKIDGNIISAVEAEIVPVSFDEV
FT                   IDAKGCYVMPGLIDMHVHFRDPGQTAKEDIETGSRAAARGGVTTVLAMPNTKPVVDNPE
FT                   LVKYVHEKGEKAGLTRVLQVGSVTKGMEGKELSDLQGMIDAGIPAISEDGKSVMDSGLY
FT                   REAMKIVAKAGVPVLAHCEDINLVQGGVMNMGSRSENLGEKGISNAVENIIEVRDIMLS
FT                   EETGATLHLCHCSTKESYDIIKEAKARGVKVSGEVCPHHFTLTEDDIIPGDGNYKMNPP
FT                   VRTKEDREALRRGLAEGVFEVISTDHAPHTAEEKSKGFASPFGIVGLETSASLTYTELV
FT                   LSGLITPLTMAAYMSSNPARILGRSDLGNIAPGKAADITIFDPTISYEIHAADFVGKSK
FT                   NMPYEGRKVQGKVLKTIYGGNVVYDSEAN"
FT   CDS             complement(38475..39797)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00510"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73048"
FT                   /db_xref="GOA:D4IYV9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYV9"
FT                   /protein_id="CBK73048.1"
FT                   /translation="MKKVVKFGGSSLADAGQFKKVGDIIRADENRVFVVPSAPGKRHGK
FT                   DTKVTDMLIGTYEDAKAGKDVKKNLADIKARYDEIIEGLELKGFSLDKDFEEIAAQIKE
FT                   DLSLDYLASRGEYLNGKIMAEYLGYDFIDAKEVIFFNEEGMLNSYKTEKTMAKALEEHP
FT                   RAVIPGFYGCGKDGKVKTFSRGGSDVTGSIVAGAAKVDVYENWTDVSGFLICDPRIVKN
FT                   PVGMQTITYRELRELSYMGAGVLHEDAIFPVRSAGIPINIKNTNKPEDDGTWIVESTAQ
FT                   KNEYVITGIAGKKGFCTVLITKSLMNSEVGFCRKALQAFEDNGISIEHMPSGIDTMTVV
FT                   VHEDEFINKEQAVVSAIHRNCAPDSIEIESDLALIAVVGRGMKSTRGTAGRIFSALSHA
FT                   RVNVRMIDQGSSELNIIIGVQNEDFEAAVKAIYDIFVMTKL"
FT   CDS             complement(39898..40410)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00520"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73049"
FT                   /db_xref="GOA:D4IYW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW0"
FT                   /protein_id="CBK73049.1"
FT                   /translation="MTIEENMALAYLRASHSSSQLFSRISGKDKARFREQLSLLGMGLE
FT                   DRMKQPVGLLSGGQRQALTLLMATFVTPKLLLLDEHTAALDPATAEKVLEITKNIVAER
FT                   GITCLMVTHNMHQALDVGNRTLMMNAGQIVFDTSGEERAGLTVNDLLEKFKVGAGEELD
FT                   NDRVLLS"
FT   CDS             complement(40407..40697)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73050"
FT                   /db_xref="GOA:D4IYW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW1"
FT                   /protein_id="CBK73050.1"
FT                   /translation="MLKIDNISKTFNPGTVNEKAALTNLSLDLKDGDFATIVGSNGAGK
FT                   STMFNAIAGTFIVDEGNIYLDGEDITFKKSTSAARLSDIFFRILLRAQLLI"
FT   CDS             complement(40690..41643)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00540"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73051"
FT                   /db_xref="GOA:D4IYW2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW2"
FT                   /protein_id="CBK73051.1"
FT                   /translation="MTGIFTVSIFQSALELGCIYALVALALFISFTILNIADLTTDGCF
FT                   TLGCAVGAMVTLSGHPFLALIAAMVSGAVAGFVTAFLQTRLGVESILAGIIVNTGLYTI
FT                   NIAVMEFSSLVNLFGCDTIFSLGKEGFVYTIFGDWYKVIFVALILVLIALALWWFLGTT
FT                   LGMSIRATGDNAEMVKSSSINPTFTITVGLCIANSLTGLSGCLIAQYQKSADINIGTGM
FT                   VTIALASLIIGQSLIGNKGSTIRRIIGTILGSVLYRFIVAIALRLSVPAEALKLVSAII
FT                   VAVAIATPYVRRKAALKKREFANYRGNTKGEVKGNA"
FT   CDS             complement(41661..42719)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00550"
FT                   /product="ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73052"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW3"
FT                   /protein_id="CBK73052.1"
FT                   /translation="MKKKLLSLLMIMSMATTCFAGCGSKTANNSGEDVPAQTKNGTVYK
FT                   VGIIQYVDDASLNQIVDNLEKQLDALAEEKGVTFDYKDYYYNGQADSTTINQIVTELIN
FT                   DEVDVLVPIATPTAMICQSATEDNQIPVVFAAVSDPEAAGLVASNDAPGANVTGTSDAL
FT                   NTDAIFDLMFAQDRDIQKVGLLYDKGQDSSAGPIEAAKKYLEAADVEYVEKTGNKNDEV
FT                   MLAADALCAEGVDAVFTPTDNTIMTAELGIYEKFIEAGIPHYCGADSFALNGAYLGYGV
FT                   NYATLGVETANMVAEVLVDGKSPATLPVKTLDNGIATVNTETAAGLGLDYEKLRDMCKG
FT                   GFVEIQTSKEFK"
FT   CDS             45308..46171
FT                   /transl_table=11
FT                   /locus_tag="CIY_00570"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73053"
FT                   /db_xref="GOA:D4IYW4"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW4"
FT                   /protein_id="CBK73053.1"
FT                   /translation="MSAFIDRIDEMATLENEYARDGASFVVIYGRRRVGKTTLINHFCE
FT                   SKDSIYFLATEENEYQNRNAFKQLVSEKFDNELLASASLTSWDPIFKVITEEAKNKKIV
FT                   LVIDEFQYLGKANKAFPSIMQKIWDEILLKSNVMLIICGSLINMMTSQVLNYDSPLYGR
FT                   RTAQIKLKQIDFSFYHEFDESLSFDELLEQYAVTGGVPKYIELFDKKKSIYASIKDNIL
FT                   STGSFLYAEPEFLLQKEVSEVGSYFSILKTIAAGNHKLSKIATALGVSQSNLTNYLKNL
FT                   IDFRYY"
FT   CDS             46215..46682
FT                   /transl_table=11
FT                   /locus_tag="CIY_00580"
FT                   /product="Archaea bacterial proteins of unknown function."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73054"
FT                   /db_xref="GOA:D4IYW5"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW5"
FT                   /protein_id="CBK73054.1"
FT                   /translation="MGLYRIKDNFISFWFKFVYANKSMIESGHMEYVEDKIKKNFIDNH
FT                   VSYVYEDVCRGDVWNILSEGVSFNRVGRWWGSKDVEIDILAYDSLGKDIIFGECKYSKQ
FT                   KKGMAVLIDLQNKARVVNWKKINEMNIMYYIRKVAILMSFSNMRRNTLTFS"
FT   CDS             complement(46796..46942)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73055"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW6"
FT                   /protein_id="CBK73055.1"
FT                   /translation="MNDRVYSKKKTKDFIEEHPKIFLCVYTSFFIALSIFIDVHFLNMI
FT                   EIR"
FT   CDS             complement(47009..47350)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73056"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW7"
FT                   /protein_id="CBK73056.1"
FT                   /translation="MSNIKRIDGFDYPMGYETIVDLNLVDFEYWYFIPDIQLENRYKGL
FT                   NERYPNRKYIPFARRDDSDDIACFEEGKGETVFIVHDFADEGYEQRKTYDNIWLWMKAA
FT                   IDELIEENQ"
FT   CDS             complement(48142..48351)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73057"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW8"
FT                   /protein_id="CBK73057.1"
FT                   /translation="MNENDLFVLDDINGNPMFYVDEECTKTYTGRTEDYFQGVLCREAE
FT                   VVDGYYDGVCKDYYQLSDKLEMIL"
FT   CDS             complement(48442..48876)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73058"
FT                   /db_xref="InterPro:IPR025674"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYW9"
FT                   /protein_id="CBK73058.1"
FT                   /translation="MDILKLNKNNIYKFAIAIAEKASSYIDDSETVEIINESLEVCKKW
FT                   TQEGGNVGESLYDYLDNEENGFTIFQEMEESERVINAWDCIIDAIAYISKAAYEKEGVE
FT                   YLPEPIELVDDSILSHMIQALILCDDKEQEYIEKLYSELS"
FT   gap             49559..50210
FT                   /estimated_length=652
FT   CDS             complement(50551..50703)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73059"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX0"
FT                   /protein_id="CBK73059.1"
FT                   /translation="MLTLERNIDIAAKEQAYRKSINAIRRDENYYIDGLESILKYIEIH
FT                   PKNMQ"
FT   CDS             complement(50730..51038)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73060"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX1"
FT                   /protein_id="CBK73060.1"
FT                   /translation="MVQKIYMTRRKKSFVSEHIHLFCACVVFAMVAMMFLLVYYTRANL
FT                   LLIFVLPTLLITWFVIFINKRYNWSASTCLLQRNDKLYVVRLFGTTEIINEKAINFI"
FT   CDS             complement(52040..52492)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX2"
FT                   /protein_id="CBK73061.1"
FT                   /translation="MKKTALLLAIILILLVGCGKQSVFSLHDVRNSDWNDSVEDVRKAE
FT                   DIEPKIDGDNRITYEDKFLGYDSEFTYIFGEDKLGQVSFTIRCESNDAAQSAFEDISSQ
FT                   LTSAYGQKAEDKSSDTSYMYESKDALVWLHAKDTVVMVDFAIPQEK"
FT   gap             52602..54305
FT                   /estimated_length=1704
FT   CDS             complement(54435..54902)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73062"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX3"
FT                   /protein_id="CBK73062.1"
FT                   /translation="MDNQLLARKYIENRRRVLEYTYRDMNLALENNEQVYLAVFDIPTD
FT                   SILTSGRTKTLALIFGLNTHIYFGNGDSIINLEKNSDIMKAMQSLFISVPQVLRITKLV
FT                   DDCSFYESKNIRAYLKTKEGIRFCELEGKTREERFLLMLMNNVLKLIAQQL"
FT   CDS             complement(54933..55316)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73063"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX4"
FT                   /protein_id="CBK73063.1"
FT                   /translation="MQLDEKFFDKMVNCFIECMMHEFGSEISLIEKECRYTQMGYFRLL
FT                   FSHQPTHYKIIIENELRTFSIQIIDGENASTFLNRISSYNKQLGEENIENAITILKEVL
FT                   DKNNFDLYYQKNEKIYKKVMMGK"
FT   gap             55950..56721
FT                   /estimated_length=772
FT   CDS             complement(56975..57184)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73064"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX5"
FT                   /protein_id="CBK73064.1"
FT                   /translation="MGQLSAGDAASYREKLANYLKKCKSQVRENFNEMDFENADKRTQM
FT                   ETHIVSMENKYDSIINELNNMSFE"
FT   CDS             complement(57190..57492)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73065"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX6"
FT                   /protein_id="CBK73065.1"
FT                   /translation="MAATKIKVNYDDVNDAVTNMNNAIKTYNSLAENGFDSAISALEGM
FT                   NSDYVDKLQRVLECLNPKVKEKINEEMTNYTKKTSDTAGAIKDADEGLAGKNEGE"
FT   CDS             complement(57496..58119)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73066"
FT                   /db_xref="InterPro:IPR025233"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX7"
FT                   /protein_id="CBK73066.1"
FT                   /translation="MKENDKLKLYENLVDSYGFSEERSVLLKSIYSDLTADVKNLYVLY
FT                   SIIKNDREIAWYGGDVVINPAKDSLEISYHSSQAEFAKEEVKGLVAHTITIIEGILPQG
FT                   TLVELDLEKIKVPNPTSTQLYVVITKRFIGEETGPFYQYGGDLYPTGNFGTGKTLFFTP
FT                   AAIKRVVHMGYESEIENQFVYEMLDGLVVDEHRLSMGFVPQKGA"
FT   CDS             complement(58180..58692)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73067"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX8"
FT                   /protein_id="CBK73067.1"
FT                   /translation="MEIIYLENGIKWKNGDCEVTYEADNIEFAADSLEFIYAEIINDDG
FT                   NSEYRFLDLTGNEICKYDETNVLQIKVGTTWSNKEYEEIMDVYIIGGKIYAMISPTDID
FT                   VYDLSSHYVGTIKAPFGYTYYRFVDGEKLSAICQGSEENADMFGRIDCRFEYDNLTNNW
FT                   VKAGVTY"
FT   CDS             complement(58704..59384)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73068"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYX9"
FT                   /protein_id="CBK73068.1"
FT                   /translation="MADTADEEGLAFTTGYAVEKVAEIVLAKKLAEKMAGPKVDGKKTF
FT                   GDYMSPEDAARYDDYWRKSNIGSNKTYDEFLKYNPEKGIDDYFKLVKEQSPWPDGYNPN
FT                   ANKVTLKSGDTFNMVLDSRQKTSNPGGFGIKEDVPSVEFARNDMAIKYGWKDDCGKVAT
FT                   YRVKDGVELTCSSGPIGPQIDLTANKYLPGNMGLTQYDLFSGLGKINRNAYIELVPGSV
FT                   RRLR"
FT   gap             59398..59738
FT                   /estimated_length=341
FT   CDS             complement(60415..61071)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73069"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY0"
FT                   /protein_id="CBK73069.1"
FT                   /translation="MNKGKTNYTFQFNANPSEVDSLVKAWLQANKFSWTNKYGEDFYYF
FT                   NDPVLYGKRGFQYKIEGQQISVDAWTIGIGKKFFMLDSGAVNNMAGNSYKDILQNLFNS
FT                   ISQLEENGGASESSVSDSVSQTASEQSQVSGFAQEFEAQDMAKKEKFCVVGFILSIMGL
FT                   LISLIGLRLGVIIYILDFYFASMGLKTKKKGMAIATIVLSILSILITIFWLWISM"
FT   CDS             complement(61254..61385)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73070"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY1"
FT                   /protein_id="CBK73070.1"
FT                   /translation="MNNENMNTNEKTTAQDIVKAMDKDGNAAMEKNMKLAFIFLLLL"
FT   CDS             complement(61648..61935)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73071"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY2"
FT                   /protein_id="CBK73071.1"
FT                   /translation="MSQTRVQREGIESCVSKINTEIENLISAANNIDSTMNSIGEYWEG
FT                   FAYDNAMDTYHTDYEKLLKETIPNSVTEFKEYINKCMETIIDIDNQLAGH"
FT   CDS             complement(61993..62259)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73072"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY3"
FT                   /protein_id="CBK73072.1"
FT                   /translation="MREEVEKASNTLSTSKKRALELIAGLEQDWNTDAGKKAMENVNTD
FT                   WTSDVDKYIVTLDKLAEILSTAETEYTKIENEANNISFPDYDV"
FT   CDS             complement(62306..63598)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00840"
FT                   /product="ChAPs (Chs5p-Arf1p-binding
FT                   proteins)./Tetratricopeptide repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73073"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY4"
FT                   /protein_id="CBK73073.1"
FT                   /translation="MEEMEFKDRLSQCIALMTEEKYEEARNRLKEIVIDNPKELILYTH
FT                   LGNACANMGLHDEAIENFKKILILEPQNGEALFSIGSIYVLKEDKVKAIEYFNKAEACG
FT                   YRTPDMYFLMATIFLGEYDEIQAIRNINKAIDIAPLDGELRLFKVRIYLANNKYDLALV
FT                   SLDEMERLLPDAFEVYSLKAQIYIGQGRNREAREIIEKGCKRFPLDSNLASLKLRVLVE
FT                   LDLYKEAEDQIKYMKMQGLFDKSLKESAMQEATLFLRNMKVDEAITVLKETNEKLGNDK
FT                   DVLFVLTDVLAKRERYEELLDYSGTLMKMECINLYKASSLFFHATALSKLNRNDEAHKE
FT                   FENIIVSTRRMTIDDPSFYEGYIFRLLAHVELKQFDKALEMANYLENLNPEKADSHAFK
FT                   YHIYKEMGDEISAEQEKKKLRVWIRILQSRR"
FT   CDS             complement(64023..64367)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73074"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY5"
FT                   /protein_id="CBK73074.1"
FT                   /translation="MSQVVYSKRKKYDFIEQHIKIFWIALFLLSIIISILIDVIIYKYF
FT                   SITNIKAIVCFDFLIYFITQIYFLHLNADHNMSKSTAFVARDGKLYAIQLLYTKRDIGA
FT                   GEEETFFMLQ"
FT   CDS             complement(65553..65750)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73075"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY6"
FT                   /protein_id="CBK73075.1"
FT                   /translation="MSQITITYNVLEDVISSAKRTATDIQDYIDAIGNNITIPSGKVPA
FT                   PNDNTYVSTAGNLAKIKFKV"
FT   CDS             complement(65767..66195)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73076"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY7"
FT                   /protein_id="CBK73076.1"
FT                   /translation="MGSAELKRQKASKEELRNKYSNRKNAVDNIMRNIDGIVYSFPGTI
FT                   NREIVYLYDSFKSGLKGQTTSLISDIEGTMQDSTDTDSRISNANSNLNSESLHCQSRID
FT                   TLNSEIESLNSQIAAAEAAEAEEARRAAEAAAAANRRV"
FT   CDS             complement(66211..66363)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73077"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY8"
FT                   /protein_id="CBK73077.1"
FT                   /translation="MKKYRVIVQRLKDINDDMEKIADTILEAEAQYISADMELAKALEG
FT                   DQNRY"
FT   CDS             complement(66546..69797)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00910"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73078"
FT                   /db_xref="GOA:D4IYY9"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYY9"
FT                   /protein_id="CBK73078.1"
FT                   /translation="MIPDCPITVDLKECSAVGILGTKVTNNDFLKVLMVDTISRHYFGE
FT                   VKVYLLVDEIKKYIWAKKIPHISEPNGMRNIVYNTESRNNVFESLYRELTDRSARKTCE
FT                   DLPYLVIYVMDDWGIRNHPVSQFIENAKNLKVCFIFFGEKRKEIPLYCDTVIELTDANN
FT                   GIYVDAHNGENTTKFTHTNISDEVMLHVCSMLEPVYCEEISLESSLRKSISLFELLNIY
FT                   SVDDIDLLNNWNNSRVWETMAAPIGVNSKNDLIDLNLHEKFHGPHGLVAGTTGSGKSEI
FT                   LQTYILSAAILFHPYEVSFVIIDFKGGGMVDQFQDLPHLIGAITNIDGREIDRSLKSIK
FT                   AELLKRQTLFREAKVNHIDKYIKLYKSGQVTTPLPHLIIIVDEFAELKADQPEFMKELI
FT                   SAARIGRSLGVHLILATQKPAGQVNEQIWSNSKFKLCLKVQTKEDSNEVLKSPLAAEIK
FT                   EPGRAYLQVGNNEMFELLQSGFSGASEKDSTTGEHTYSIAEVDYSGRRKIVFEKKKKKN
FT                   TDGSRTQLEAIVDYVNTYCKNANIQRLPNICLPPLSDNIFIEDDMKGDKESGVSIGIYD
FT                   DPDSQFQGKARINLANENYMIIGSSSTGKTNLLQVLIRQIASIYTPKEANIYIMDFGAM
FT                   YLKNFDSLCYVGGVVTASEEEKLKNLFKLLIEQIAYRKEEFLKLGISSYSAYEEGGFTD
FT                   IPRIFVFLDNFAAFKELYMDSFEEEFLFLIREGISCGINMILANSATSGLGYKYMSNFA
FT                   GKIALQCNDTSEYSTLFERCRMQPKEVAGRALFVKDKAYYEVQTYLAFEGEKEIDRSNA
FT                   VKEFIAEINAQYPGVQARRIPEIPETLTIDYIQNNYTIKRSHYSYPVALDYANVDVVNL
FT                   DFALFNELCIIGNENAKRINVVKSILAVMESYIFDDNFNLYVIDNINRELKYLSDKVYV
FT                   EKYTPDYNSLDEIITKLEAICQARYDALMQEEQITGSSPLQVVVINNRDAIDYICSNKP
FT                   ILESYNKITKQFKNMGVCFLFTDLEDASVPYGAPEIMKRLKENKKALITTTKLKEVKFC
FT                   DVPSGSIRSMKPLEVTDAYLLNGSDIQRIKMTEGE"
FT   CDS             complement(70090..71061)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73079"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ0"
FT                   /protein_id="CBK73079.1"
FT                   /translation="MKNNKYKIIISNKNLYREVELPSDAISFKVGTTQDCDVRLDKDLF
FT                   FDDVRLDFVNSNDDWTVMCSDKVFLTTGDTRRLITAALNHGDTFFVKYQESSNDVFALE
FT                   YMVDFDSTSRSFEREISIAGANVIKIGSAADNNIVVNSEYVTGDAIELVKQSDGYAVRV
FT                   KSSTYGFYKNGVKTSGAEVLKNRDFFSISDFLFYLKDESIWTEASNRVKVNNLKFVDQR
FT                   TKNNYPLFTRNTRVKYEVPTDSIGLLVPPQKPTEPTQNLAMTLMPALGMLALTVVVRGF
FT                   MSNSSNKSFILFSVCSMSMGIITSVVTYFSSKKNTRLIVKTE"
FT   CDS             complement(71331..72389)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00950"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73080"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ1"
FT                   /protein_id="CBK73080.1"
FT                   /translation="MANPKVIIADTDINYIAPLQYKFINDYFNNIDIEVITDKLYFEEY
FT                   FAVPRNAEVLIVSEDLYDSSLKRHDIKNIFLMSEQLDDGSTGDLSINKIYKYTSIVEIF
FT                   REITAKCAKELAEGAVEQKETQIIVVTSASGGVGKTTVAMGLAASLADGYQRVLYINAA
FT                   MMQNFQYLMDNKEPISTYDIYAKALNPTENIYIDLKSEIRHQGFAYLPAFKAALISMGI
FT                   QYSIYHKIILSAKKSGDFDFIIVDTDSCFDEEKMNLIDISDKVIVVTDQSYSSVHATNN
FT                   FVSNVNGISQDKYVFICNRFNTAEYNELVTPNGTLKFNISEYIANVVNRTDLEANIFSK
FT                   NRDIKKISFLVM"
FT   CDS             complement(72399..73337)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00960"
FT                   /product="Uncharacterized conserved protein, contains FHA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73081"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ2"
FT                   /protein_id="CBK73081.1"
FT                   /translation="MNTLIEQGIVREIESGNNFEYIVSASASFIDTDYKVLQSQSNDVF
FT                   VKCMKITRNGLVDLCYLGNDYRTVESLMAGLTADTAIAIVAGILSCITKVKANGFLSCQ
FT                   SIVLDKNRIFVDANTKQVRLVYVPITEKLFAMPVDFEEEVRNIICEILNGVSRGLTEQL
FT                   QNLVGDVEDRNIPLDLIYQKSRAIVPELAAAGMESTPVHQVNSKAATSAGAGSIRLVAC
FT                   DAPYPFEISISENDVLIGKKADLVDKAIEYNGAISRRHCRIVKQNGNFFIMDEGSANGT
FT                   FVNGNRVDMGQQIPIKSGDTIHLANSEFKVY"
FT   CDS             complement(73353..73886)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ3"
FT                   /protein_id="CBK73082.1"
FT                   /translation="MDLQNVEIITEQTQLYQNIAIVLLVVAILLFITSVVLFIVLKIPH
FT                   SFRVLTGMGINKELSKESAGRDKKKATLTWGASGTLTKKIENDATTLLDDDATTLLGDT
FT                   DATTVLGGGEETTLLSGSDETTLLSGNDETTLLSPSDETTLLTPSDETTLLSDVSDIFQ
FT                   MEDDIKITGSNQQI"
FT   CDS             complement(73896..75575)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00980"
FT                   /product="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73083"
FT                   /db_xref="GOA:D4IYZ4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ4"
FT                   /protein_id="CBK73083.1"
FT                   /translation="MLEIGSVIDNKYKILNKIGQGGMSIVYLAMNERANKQWAIKEIRK
FT                   DAAAASEINMASIKTETEMLKNLSHPNLPSIVDIIDYEDSILIVMDYVEGNTLSKAVNE
FT                   YGPQPQEYVIEWAKQLCDVLGYLHSQNPPIIYRDLKPGNIMLKPDGTIVLIDFGTARQY
FT                   KEENLEDTTCLGTRGYAAPEQFGGHGQTDARTDIYCLGTTMYHLVTGKNPSEPPYEIRN
FT                   IRYWNQALSKGLEQIISKCTQLDPEKRYQSCKEVLFALEHYDELDETYRRKQKLKLGVF
FT                   FTTAFLTVASGIGSFASYNYAKYVQQVNHDKLLEDASRGVTEADSKEALISSIAVYPSQ
FT                   VDSYINLIDNVYLADENFSEDEAAELREILIRTSGKNTYEQILAQNQDSYSLFAYRLGL
FT                   AYYYSYEGEGNKQQSAYWFKKAAEGNLNDNQMERAKRLGAIADYYVNLGAVDKTGDSQV
FT                   TYKNYWDDLVTLCKGNITESDNANTALAIYKEMASQICMSANQFKKAGVSTSDMQLQLM
FT                   NIEKHVKEDIDSAPDKSERVIELEKELATNIEKAKQAISMLE"
FT   CDS             complement(75588..76379)
FT                   /transl_table=11
FT                   /locus_tag="CIY_00990"
FT                   /product="Serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73084"
FT                   /db_xref="GOA:D4IYZ5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ5"
FT                   /protein_id="CBK73084.1"
FT                   /translation="MSFKVDAYSDKGVRKNVNQDALVIKQAKVNGVGNICMGILCDGMG
FT                   GLSCGEVASSAFVNRMDSWFRQELPYLFSDPNATEPLNGKQNEHPAVLLLSRVEGQWKK
FT                   LVQEMNDRIKDYGVSKGMRLGTTVVAIIIIGDKYLTMNVGDSRAYKFTKRQMEQISHDH
FT                   SYVQQQLELGRMSAQEANASDKKSMLLQCIGASETVIPEFFTGTIEKNQHFLLCSDGLW
FT                   RKLEAKEIMDIAPQRNGINKLAELVIRRGETDNISGLIVSV"
FT   CDS             complement(76390..77991)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01000"
FT                   /product="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73085"
FT                   /db_xref="GOA:D4IYZ6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ6"
FT                   /protein_id="CBK73085.1"
FT                   /translation="MKALKKVCSFAIALGIVLTPVASVEAADTNGSGADVAKQGVVQVN
FT                   TVIVDDNSEKSVVIGGTGFLIGDPEGTEYVITSKHIVEPSKETLSDACEYYGVTADGED
FT                   STINLTIATEVVIESDVVLNASVLTSSSELDMVVLQLPQPIYTRTPLKLLTNKQYDVNN
FT                   LPYAAGDSVYALGYPELVYYNSDTKYYSDQQIQSAAGQIKSLTTVDGVQVVESDAATDY
FT                   NNYGGPLVDENGYVIGMNLPKQDGENSLALDSTKIAKILDGLGVSYSQANSSPKSQEAV
FT                   EEDATEETEAEPTVPEPVAKPKKGISETMIIVLSLVAVFVVVCSVAGLILYFVNKDRSD
FT                   APKADKPKAVKQEKKIKQSKTYNGPVFDFDDIPNNPVQVTRSATPQRSNVMSMAQPQRV
FT                   QPMQQTSFSDETTILSAAPASEDGETTLLSGELNAPQNLGTLVRKRTSERISLNKSDFI
FT                   IGKDALHSDYCIEKNSSISRKHAKITSGRNGTYIQDCNSTNGTFINGTKIESERSVLLN
FT                   DGDCIKFSNEEFEFQA"
FT   CDS             complement(78133..82431)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73086"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ7"
FT                   /protein_id="CBK73086.1"
FT                   /translation="MLCALLFTNTSVYADTTKAEEPADTTATETAKSSADETVSTATTG
FT                   AAEESTEASDADAAKRTVKLTLDTTEDTDVESEELDMASILTESKIETPTPTVTPTPTP
FT                   SGEPPCKHENLGTRKIYRADSAESNKHVLYHKCRDCGELVPAGDPEECTSDGVKHVEQI
FT                   ADNKHVTYNECKVCKRRLNEVSKDCSFETERYESISTTKHRVYEKCSECERERQHEEDC
FT                   VWKSEEGNPNYYHCSKATSGEIKNGCTNIKDERSHDVVISNVTVTPEAKAENVKENYTY
FT                   FDEKIVIEFDVACEVLNKVSEDDFKHYVNAYAAYTDYYSNKVKTINCRLISYDKGVARY
FT                   QLRSEDVNTDNEPFYISYIAAESKFDKNVKPATHKLDYFLDYCDPAKQVSKLSKSIVSG
FT                   DGSTYKEGTWYSKHLHNEKNLFVSYKGVTTEKISNPVLWELDEAGNTATKVKVVKSECV
FT                   DKSIRIPTIFFGDIVFPYYENNYEYELELSDTDESEHRYEFRFEVKGKEFKQPVVTTKI
FT                   DNVAPKLKLTFDNNKFENEKYYKKDRKATFVLVDKNIDSSIKNNVVINSCEGSATINEM
FT                   TGSNGSYTGSIDFNEDGIYSIGDICYTDYAGNAFVFTDDTDKDYCKEFVIDKIAPKLEI
FT                   TFNDVKPKNEKYYKEDRIATFVLKDRNIDTNEAKMDYIKVHTKEGKVTKVNEMTGSNGK
FT                   YVGSVVFADDGIYSIGEIKDLKLKDKAGNEIEFADGQDMNYSSEFVIDKTAPKLDKITY
FT                   SKPTSKTGRYYKNNVDISVLVSDRNLSTDTYIGTKLDGKSLEKQVNLSKVEDNSATINY
FT                   VAEAEGKHVLTGKIYDMAGNCTDINDTDKEFIIDKTAPTVEKITYSDPTGRTGRFYKND
FT                   VQVSVKINDLYLSADSYITTVLGKTSDAESGEKANLAKDTNGAGTIDLTVKKESEHKLV
FT                   GEIFDMAGNCTKINDTENAFEIDKTIPVIDVKFDNNSALNGNYFKAARKAEITFTEKNF
FT                   SSEAEYVKVAKNSSEQNLVPNLQSYSKSGNKNVTHITFDTDGRYGFNIVVEDKAGNLSE
FT                   KYVSEDFVIDLTAPELEINGVTDMSANNGKVAPVIVSKDTNLTDASTEISLVGSNRGKV
FT                   TPSITKTNGTEVFTYAIADMAREKDNDDLYTLSVKLTDLAGNVVEKTVKYSLNRFGSVF
FT                   VLSEGTKAMVDGYYVTKPHDVVITEINVDSLTKKEVSVAHDGDVKELREGASFTTNDKT
FT                   TSNGWHSISYNVDKSNFNKDGIYSVTVYSEDKATNKQSNQSKDTEVEFLLDQTAPSVIV
FT                   SGLEDGGIYEEESHDFSINAADTIGVTDMKVYLNDEKLASYTADELNANGGTVVLTVPS
FT                   KDDYQKVTIECSDVVGNVTKLAYNNLLVSVKAEELLLEDDLTPTSKLDENTPVGAAMKN
FT                   ASKTFGIIGILVAIAVVAGLGAFALKKKQK"
FT   CDS             complement(86030..86347)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73087"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ8"
FT                   /protein_id="CBK73087.1"
FT                   /translation="MKKRLLILALIVSAAASFTACSKYNQKEIELRDQGIAAMDEGRYE
FT                   DAIGLFDDALGCSIGKVTDLELDIDYYKGAAQFKNGQFEDAANTYTYLIKYDEKTTSHI
FT                   S"
FT   CDS             complement(86412..86747)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01050"
FT                   /product="Uncharacterized protein encoded in hypervariable
FT                   junctions of pilus gene clusters"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73088"
FT                   /db_xref="GOA:D4IYZ9"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D4IYZ9"
FT                   /protein_id="CBK73088.1"
FT                   /translation="MMNYKGYIGKVEFDDEQHIFTGEVINTRAVITFQGSSVSELEEEF
FT                   RLSVDDYIEWCEQDGVELERPYSGKFNVRIYPQLHQRAVVGAKVLGISLNAFLIKCLED
FT                   ELNLMHI"
FT   CDS             87283..88374
FT                   /transl_table=11
FT                   /locus_tag="CIY_01080"
FT                   /product="Hemolysins and related proteins containing CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73089"
FT                   /db_xref="GOA:D4IZ00"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ00"
FT                   /protein_id="CBK73089.1"
FT                   /translation="MLSAILIGNNIVNLSASSLATTLAIDIFGSYGAGIATGILTLLIL
FT                   IFGEITPKSLATLNSTKLSLRYAPMIDALMWVLTPVIAIINFLAGLFIRMFGIDPDFKD
FT                   ETITEEEIRTMVDVSHESGAIEQDERTMIHKVFDFSDACAKEVMIPRIDMTMIDADISY
FT                   DELIAVFKEDMYTRIPVCEPDTDKVLGIVNMKDFLGIIPTENFSVRDYLRDTYFTYEMK
FT                   NVSDLFDEMREESASLSIVLDEYGELSGMITLEDLLEEIVGEIRDEYDEDEEDPLVRLS
FT                   DREYQVLGSMNLEDLCQLIPLGFTSDDYDTIGGYIVGAFDHFPNVGETYVSEDGTIIRV
FT                   LAVEKKRITKLRIKLPAPTTQTQ"
FT   CDS             complement(88340..89110)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73090"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ01"
FT                   /protein_id="CBK73090.1"
FT                   /translation="MKFNTIILCLVLWGTVCFIAIISGLFKSIKANKLYSIQMKYLRQF
FT                   IFLAGRGVNSGNIIRELHCTFIRERRLRKTLIRAMRMPSSQGLELIYQEIGCEPMNVIH
FT                   KFVLERERRRGKNQLCEIPEDIIKYFNNLVEEWDEKVIHNRKVQNRSNIKAFLEVIVFI
FT                   LLDLVLYSYVQTDLSLVIFAIANTVGVIMFIILTNEGYVVDKKKRDRKLARVNGQEKKT
FT                   RPVKWIHNLYQLVGGLGLIINIFIIVSEWLGPVA"
FT   CDS             complement(89228..89749)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01100"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73091"
FT                   /db_xref="GOA:D4IZ02"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ02"
FT                   /protein_id="CBK73091.1"
FT                   /translation="MAQNPVVTIEMENGDIMKAELYPEIAPNTVNNFISLINHNFYDGV
FT                   IFHRVINGFMLQGGDPDGTGMGGPGYSIKGEFTSNGFKNDLKHEPGVLSMARTMFPDSA
FT                   GSQFFIMHKNSPHLDGDYAAFGKIIEGMDIVNKIAEVPTDWSDRPTKEQKMKKVTVDTF
FT                   GVDYPEPKTL"
FT   CDS             complement(89749..90624)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01110"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73092"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ03"
FT                   /protein_id="CBK73092.1"
FT                   /translation="MAENSSCASASSCSRGSCEGCPSAAAKEAGVRNTAFLEAPNENSN
FT                   IKHVIGVVSGKGGVGKSLVTSSLAGVMARAGYKVGILDADITGPSIPKMFGVHGPAAAN
FT                   AEGVMLPEVAEDGTKIMSINLILDDEESPVVWRGPVIAGVVKQFWTDVAWGDIDYLFVD
FT                   MPPGTGDVPLTCFQSLPVDGIVIVSSPQELVQMIVKKAYNMADMMHIPVLGLVENYSYI
FT                   KCPDCGKKIEIYGESHIDEVAAGLNIPVLGKMPMDRSFATAADAGRIFDVENTYLADAK
FT                   SVLENIKGEL"
FT   CDS             91015..91788
FT                   /transl_table=11
FT                   /locus_tag="CIY_01120"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73093"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ04"
FT                   /protein_id="CBK73093.1"
FT                   /translation="MTDTKKILSFAVELGDILLRNGAEVYRVEDSVLAILNSYDITDCD
FT                   VYVLSNGIFASADEVTEHASSMIRHVPMYPMHLARIAALNSLCRDVCAKNITIEDAWIK
FT                   LAEYKKLPGYNLPVMILATGIGCGGFAYLFGGTALDGVIATIVGCILRIFLYFESGMGN
FT                   SKTVTNVLGSMVITILALAFAFTGLPIHYDKIIIGGIMPLVPGIPLTNSIRDFINSDYL
FT                   SGSIRLIDALLTAFCIAVGVGIVITVVSLFGGSFI"
FT   CDS             91788..92243
FT                   /transl_table=11
FT                   /locus_tag="CIY_01130"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73094"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ05"
FT                   /protein_id="CBK73094.1"
FT                   /translation="MLVNYIIEFIVSMVATIAFAIVFSAPRSELLYCGLSGAIGWIFYS
FT                   LINTILLAPTFGNVIGSFALTFFSRALASKRKNPVTVYLISGIFPLVPGAGIYYTSYYL
FT                   IMNDMVSFSQAGLSTIKTAGAIVMGIILGMAFPQSFFNTAFAPSGRK"
FT   CDS             complement(92209..93963)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01140"
FT                   /product="Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73095"
FT                   /db_xref="GOA:D4IZ06"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ06"
FT                   /protein_id="CBK73095.1"
FT                   /translation="MYWKEMLSAIAKPDKNGVRHELCTDFKYTGLQEYPRPQLQRKSYI
FT                   NLNGTCDYRIIDGKGKVACSGPIEVPFSPETKLSGTERHILLPEETLEYTKIFSIDKIK
FT                   KSKHLLLHFGAVDQVAQVSLNGVHIGIHEGGYTSFTFDITDYVIEGDNELKVKVRDYTD
FT                   RVGYARGKQSLDPYGMWYSAQSGIWQTVWMEWVPEAYVSRLFIIPDIDNDRVTLEMKVS
FT                   EMKGQVRIQSSNPDLIKDYSVEKINDDKLNVVVKLGEYKLWTPDDPQLYFINVDYGKDS
FT                   FTTYFAMRHFGVEKDEKGILRLTLNHVPTFMNGVLDQGYYPESLMTPPSDDAMIYDIEF
FT                   IKSLGFNMIRKHCKLEPMRWYFHCDRLGMIVWQDIVNGGTKYDMNMICHVPTVVRPFGN
FT                   TRDKNRLFLRFTGRNTDKSKEVWHKECKEMMEQLRSVPSLGQWCLFNEGWGQFDAQDCL
FT                   KFALKFDDTRPIDSASGWFHEDCGDVFSEHVYFEELKVKLTERPYVVSEYGGFSLKVGN
FT                   HVIRDSVYGYKKYSHQKDLQDAYNALMDKIKSLEAEGLAGAVFTQATDVEEEVNGLITY
FT                   DRKVQKLY"
FT   CDS             complement(94015..95379)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01150"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73096"
FT                   /db_xref="GOA:D4IZ07"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ07"
FT                   /protein_id="CBK73096.1"
FT                   /translation="MKATNKIDMTHGPLLGKLIIFTIPIILSGVLQLLFNAADVIVVGR
FT                   FAGEASLAAVGSTNSLINLMTNLFIGMSVGANVCAAQFYGAGNHSDVKKTVHTSTAFSL
FT                   ICGVLLIFIGLFLAKPILEIMGSPEDVIDLAVLYVRLYFLAMPAIMLYNFLAAILRAAG
FT                   DTTHPLVFLTIAGVVNVILNLFLVIVLNLGVAGVAIATVTSNYISCFMLVGFFKKQEDA
FT                   LKLEFSRVRIDKRILNRIIRIGLPAGIQGTVFSLSNVVIQSAINSFGTAVIAGSSAAAS
FT                   IEGFVYISMNSVSQTTVTFVGQNYGAGDEKRVRKVIFESLGIVTVVGLIMGNLAYGFSD
FT                   SLLGVYTDSADAIAAGTLRLFWVCCPYFLCGIMDTLTGGLRGLGNSTLPMIVSLLGACA
FT                   TRLIWIATYFQIHHTQNVLFFSYPGSWLLTLSVHSICLTIIYRKWVQKKNSEIRI"
FT   CDS             complement(95499..96545)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01160"
FT                   /product="Electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73097"
FT                   /db_xref="GOA:D4IZ08"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ08"
FT                   /protein_id="CBK73097.1"
FT                   /translation="MSLEEYKGVAIFAQQVDNKLSSIAFELIGKAHELAADLGTDVTAV
FT                   VLGHNIADLADKLGEYGADKVVLIDNEELETYRTEPYAQALTAYINEYKPEIMLVGATA
FT                   IGRDLGPTVSARVKTGLTADCTSLEIGDFPLVAKEGQEQKHNQLLMTRPAFGGNTIATI
FT                   ACPDNRPQMATVRPGVMQKLEKQPGRKAEVIDFKPELTKNNRFVEILNIVKNATSTVDI
FT                   MDAKILVSGGRGVGSAENFKMLEDLAEVLGGTVSCSRAVVDSGWKPKDLQVGQTGKTVR
FT                   PNVYFAIGISGAIQHTAGMEESDIIIAINKDETAPIFDVADYGIVGDLNKIVPALTEAI
FT                   KAELAAQN"
FT   CDS             complement(96565..97347)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01170"
FT                   /product="Electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73098"
FT                   /db_xref="GOA:D4IZ09"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ09"
FT                   /protein_id="CBK73098.1"
FT                   /translation="MNIVVCIKQVPDTKGGVKFNPDGTLDRASMLAIMNPDDKAGLEAA
FT                   LRIKDETGAKVTVLTMGLPKADDMLREALAMGADEAVLVTDRRLGGADTWATSSTVAAA
FT                   VKKLDYDLIITGRQAIDGDTAQVGPQIAEHLALPVISYAEDIKVEGNSVIVKRQYEDRY
FT                   HEVKAQMPCLITALSELNEPRYMTPGGIFDAYDKEVTVWGRDDLTDLDDANIGLAGSPT
FT                   KIAKASDKVRKGAGEKVALDPKESVEYIVGKLKEKHVI"
FT   CDS             complement(97387..98556)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01180"
FT                   /product="Acyl-CoA dehydrogenases"
FT                   /EC_number="1.3.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73099"
FT                   /db_xref="GOA:V5ISG9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:V5ISG9"
FT                   /protein_id="CBK73099.1"
FT                   /translation="MDFTLDKKHEMARQLFREFALNEVKPMAQEIDETEQFPRENVEKM
FT                   MKYGFMGIPIPKEYGGQGCDVLTYIMCVEELSKVCGTTGVIVSAHTSLCCDPILTYGTE
FT                   EQKQKFLVPLASGKKLGAFALTEPGAGTDAQGAQCRAEEDGDSWVLNGSKCFITNGKEA
FT                   DIYIIFAVTDIVEDAKGRKSKKFSAFIVEKGTPGFTFGTKEKKMGIRASSTYELIFQDC
FT                   RIPKENILGPRGKGFGIAMHTLDGGRIGIAAQALGIGEGSIDATIDFVKERKQFGRPIA
FT                   AFQNTAFQLADMKARMDAAKYLVYKAACTKDQYMEDHKTSYSIEAAEAKLFAAEAAMAV
FT                   TTKAVQLHGGYGYTREYDVERMMRDAKITEIYEGTSEVQRLVISGAMLK"
FT   CDS             complement(98671..99543)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01190"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73100"
FT                   /db_xref="GOA:V5ISG8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniProtKB/TrEMBL:V5ISG8"
FT                   /protein_id="CBK73100.1"
FT                   /translation="MKVGVIGAGTMGQGIAKAFAQVDGYEVALCDIKQEWAEGGKDKIA
FT                   KGYARLVEKGKMEQAAVDAILAKITPGLKEDLCKDCDLIVEAAFENMEVKKTTFKELDE
FT                   IAKPECVFASNTSSLSITEIGNGLNRPMIGMHFFNPADRMKLVEVIAGVNTPAETVECI
FT                   KKISEEIGKTPVQVNEAAGFVVNRILIPMINEAAFIKMEGVSDIAGIDAAMKLGANHPM
FT                   GPLELGDFIGLDICLAIMDVLYNETGDSKYRACPLLRKMVRGGNLGVKSGKGFYVYNAD
FT                   RTKTAVDAQ"
FT   CDS             complement(99560..100711)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01200"
FT                   /product="acetyl-CoA acetyltransferases"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73101"
FT                   /db_xref="GOA:D4IZ12"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ12"
FT                   /protein_id="CBK73101.1"
FT                   /translation="MGGSLSNTPAVDLGAIVIKEAVKRAGIKPEDVEHVYMGCVIQAGL
FT                   GQNVARQAAIKAGLPNETTAVTTNVVCGSGLNCVNQAAQMILAGDADVVVAGGMENMSL
FT                   APFALPNGRFGYRMTWPSNSQGALVDTMVKDALWDAYNDYHMIKTADNVAEQWKLTREE
FT                   LDEFAVNSQNKACKAIESGAFKDEIVPVEIKKKKETVLFDTDEGPRPGTTMEGLAKLKA
FT                   LYPNGVVTAGNASGINDGAAALVVMSEEKAKELGVKPLVTFVAGALGGCAPEIMGVGPV
FT                   PATKKALAKAGLTIDDLDVYEANEAFAAQSVAVGKELGFDLNKLNPNGGAIALGHPVGA
FT                   SGARILVTLIYDMIHNPEYKKGLATLCIGGGMGCATIVEKYEG"
FT   CDS             complement(100747..100815)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73102"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ13"
FT                   /protein_id="CBK73102.1"
FT                   /translation="MVLNQPEKISILKKEKENMGKK"
FT   CDS             complement(102849..106403)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73103"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ14"
FT                   /protein_id="CBK73103.1"
FT                   /translation="MGGINKFIMGFRDTYGSEEKNILMIRKKAQRAKSGNFRVRPLSFF
FT                   KRVLSVLVVLSMVFTTRICEFVSYANEISEKSTISKINLDDNIAVQHLSVGDAENSIIF
FT                   PSTLKANIDTYEEVLVEVVEDTNEPYDITMEDVDVQEPEKEVTNEEPQVEEQQTSDEAQ
FT                   EAVEPVIENNDEIPTEEVVEPTSEEVVSNKEQVPSIIEEAPAAEATPVETAPVESAPVE
FT                   SAPASVEPVVEETDDTASIINVIVDALFPAIIANAEELVVNQEPIQEDSEVKTVFKKEY
FT                   VKTTTEITLNDVQWSLDTENSTSDSFDSSVAGATYIYKASINTEYELATALPTITVIIV
FT                   EKEIEEVAFDATATVDGIVITVNADKGVFPEGATLSVKRASADQAEAAEEAVEEKEDAP
FT                   IVEAYSFDISILNEEGLEIQPDNSKGKVTVSFALEEAANDELNTEVYHMDEQVDGSFEA
FT                   EKLDSTSVADTVTAETTGFSVYTVAITGGTVTFENDGYPYGKNMGDTPTLSIRVTNQGA
FT                   KYQWQSSTNKTSWTDIAGATSQDYSFTPTSGTWYRCKVNGAESKAVQFVKPGDDGRTWT
FT                   CPMGYNSWYLTNGTMAYSINDNRFDVTGLYVKNGTTYMLQTTYAGAGWAINTSNEATPT
FT                   PVAYNYYGEPHDIDDIIVSFSDEDDYAVIFTIDLGEEQKAISFSCDTMLGNGDTSGHYA
FT                   DYAALEATLNSDKTLKQVSMIGAYSADNSNDDDPAFVITPITKRGLKFWIGSYSSRMHY
FT                   KFAEGSDSIVTDGQTYNSVKLACNNTDSGMSMSWSNVPDGGQVSFQFSVGDVASTGAVE
FT                   SNINYRDERIEDLTPGTAYTIRVNGDNTTYVKTADSNGTISFIGKDNNNVNYDFVGKTL
FT                   NLTAVVNNVNLSANIAIAGRPIAREADTTGTADLTDATKPSEVGKDAVVSSTDSVTLNI
FT                   SVGDTVRMAQEYRIYDKDGNPKSDWISPNTNGTVEFNGLTKESDYTIKARIPATQNTPA
FT                   SNPTTGVAVKTIGTVDIDAPENTTADYNGNAQTYLALTDMDEVEITYSTNVNSEYTSEV
FT                   PTFTMPGIYTVYYKATKPGFRSTYGSYQVIINKIDREKPIEIPGIKTDVDSENPSVDLS
FT                   GYIDDGDTATVNRVTGDIRDYIYNVRIVDNVLTYDQRESDEEKQEISLLRLKTQSIEIT
FT                   RFLFLLHFHQQSRLKSHR"
FT   CDS             complement(106564..107280)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01240"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /function="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73104"
FT                   /db_xref="GOA:D4IZ15"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ15"
FT                   /protein_id="CBK73104.1"
FT                   /translation="MATAHNEANKGDFAKTVLMPGDPLRAKFVADNFLENVKCVNTVRN
FT                   CLGFTGTYKGVPVSVMASGMGMPSIGIYSYELFAFYDVENIIRIGSAGSYTDKLNVLDV
FT                   VISESAFSESTFAKYTNGVEEKTLYPSKKINDIAIAKAKELGIDAKLAKVHSADQFYTA
FT                   PEMGGWKAVKERCQCDCVEMESFALFNNANMLGKNATCMLTISDSFVTSEEIPAEDRQK
FT                   SFTEMMKLALETAIVL"
FT   CDS             complement(107425..108612)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01250"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73105"
FT                   /db_xref="GOA:D4IZ16"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ16"
FT                   /protein_id="CBK73105.1"
FT                   /translation="MGVCYKKKFVAFIAVVASIFLCFSSTVQASQSEVDRLKEESKNAT
FT                   QKVDDIKNKKKQTQDVKNQLQGQADSLSGQINSLNNQISSVTVEISETEENIALVQADI
FT                   ETLNGELEEIQNSLDVQKNAMKLRIKYMYENRTTNTLVNFMESGSMAEFLQRLEYMAQI
FT                   TAYDQRAVKKFEATQMALEQKKAEVEEKNKQLSAYQESLEFKKGQLGALVGSTTSALNT
FT                   TNSQIANTQAAIEELEKQQKEAEEYEKRIQKQYQDAQLALAQKLAGEHGGYSGGYSTTD
FT                   EETLLLAALIQAEADNQGTAGRLAVGSVVMNRVASSKFPNTVAGVIYSPGQFAPVTSGR
FT                   VAMILANGPNSGCQKAAADAIAGNTNTDALFFFTVSYAQNLHDKQVAAGQEGFFG"
FT   CDS             complement(108619..109134)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01260"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73106"
FT                   /db_xref="GOA:D4IZ17"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ17"
FT                   /protein_id="CBK73106.1"
FT                   /translation="MKMKNRWIALYVENQVGVLAKVSGLFSAKSYNLQTLTVGTTERED
FT                   VSRMTISVMADDVTFEQIKKQLNAMVEVIKVIDLTTIPIHMKEILYATVSGLDVTGKTE
FT                   AFQIAEVFARGGSVKICDIGGDSVLFECTLTENKNNELISLLKSRFKKVQIVRGGAVAV
FT                   EAISRSNR"
FT   CDS             complement(109140..110831)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01270"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73107"
FT                   /db_xref="GOA:D4IZ18"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ18"
FT                   /protein_id="CBK73107.1"
FT                   /translation="MALNITGRKLFVKALKEEGVDTIFAYPGGMITDIVDELYKTDGIR
FT                   VVLGRHEQALVHEAEGYARATGKTAVVLVTSGPGATNTITGIADAYYDSIPMVVFTGQV
FT                   PLHLIGNDAFQEVDIVGMTRSITKFGVTVRNREDMGRLIKMGFQVASTGKPGPVLIDIP
FT                   KDIQVASGSPDYPGHVDIRGYHPNENVHIGQLKKAYRLLKNAKRPLILAGGGVRISGAE
FT                   SELLEFATKMNIPVTTTVMGKGVMPDDCPLYIGNCGMHGRYAANKAVTECDVLFSIGTR
FT                   FNDRITGELDEFAPKAQIVHVDIASASISRNVVVDVPVTADAKIALERLVEYAEPMDTK
FT                   KWLCELKAWEKEHPLAMPKPKVGVCPQTICEAINEVFPTANIVTDVGQHQMWASQFIKL
FT                   NKGQEFITSGGLGTMGFGFPAAIGAAIGNPKKPVVLITGDGGFQMNMQEMATAMTENIP
FT                   VIICIFNNSNLGMVRQMQQLFYGKRYEITDLAAKDGSYYPDFLKWAEGYSCPGIRVTDS
FT                   ADVIPALKKAKSHKGGPIVIDFIVSPDDLVLPMVKSGTPLSEMILR"
FT   CDS             complement(110881..111366)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01280"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73108"
FT                   /db_xref="GOA:D4IZ19"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ19"
FT                   /protein_id="CBK73108.1"
FT                   /translation="MNLIVAVDRNWAIGKDNKLLVSIPDDMKFFRETTTGKVVVMGRKT
FT                   LESFPNGKPLKNRVNIVLTRDPKYLVKDAIVVHSKEELDKELAKYNSDDIYVIGGESIY
FT                   RMLLDDCSRAFVTYVDYSYDADTYFPNLDEKPEWKLAEESEEQTYYDIEFYFRTYVK"
FT   CDS             complement(111476..112327)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01290"
FT                   /product="thymidylate synthase"
FT                   /function="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73109"
FT                   /db_xref="GOA:D4IZ20"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ20"
FT                   /protein_id="CBK73109.1"
FT                   /translation="MSKADVIFKAMCRDILENGTDTKDEIVRPTWQDTGEKAYTIKQFG
FT                   VVNKYDLREEFPALTLRKTALKSCMDEVLWIYQRKSNNIHDLKPHVWDEWADENGSIGT
FT                   AYGYVVGEKFEFKGEMIDQMDYVLKQLKETPYSRRIMTNLYQFHDLATGHLDPCCYSAT
FT                   YNVTKDKNSDKLVLNMVLNQRSQDILAANNWNVCQYAILLMMVAQVNDMIPGQLIHVIA
FT                   DAHIYDRHVDAIKELLERPELPAPKVRLNPEVKNFYDFTTDDLIVEGYEAGEQIRNIPI
FT                   AV"
FT   CDS             complement(112817..112975)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73110"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ21"
FT                   /protein_id="CBK73110.1"
FT                   /translation="MFDFSIFQDLKAEGINKELIEGICQRIQQKEDQMHEQSANWGVYL
FT                   TPNTFNK"
FT   CDS             complement(113429..113512)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73111"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ22"
FT                   /protein_id="CBK73111.1"
FT                   /translation="MAPKGQISKYLLKMVHISKPILWARIS"
FT   CDS             complement(113593..114228)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01340"
FT                   /product="Flagellar hook-associated protein 2 C-terminus."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73112"
FT                   /db_xref="GOA:D4IZ23"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ23"
FT                   /protein_id="CBK73112.1"
FT                   /translation="MSSINNSYEYYQSNQGLLSMLNKNKTGNPLINQLIEKNELEYQQK
FT                   MEAFGIHSAKGNNKYKSVETSANNLEDALIKLGKDELYKAEQGKEYDNSTLIKNINNYV
FT                   AAYNSAISALDNCGGSLKNSFKTDLIEAFKEKTEALNSIGFSLSADGKLYVDQEKLKVA
FT                   KPEDVQKIFNKESEYYKSILNSASAMDSIINKALAMKSGTYNARGIML"
FT   CDS             114610..115023
FT                   /transl_table=11
FT                   /locus_tag="CIY_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73113"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ24"
FT                   /protein_id="CBK73113.1"
FT                   /translation="MISGDNVKMGSKNKGAKKGKHKNKNSKNTMEKDFLDTIEEVGSES
FT                   ENDCTRFLGGFVKRRRKNSEDTIVFKRLIMIAFIVLIIFLLNLLFNNTDTSKQQIVNNN
FT                   PSQDVEININNGSSVDSVEDSVARKVLSEDEKE"
FT   CDS             115080..115955
FT                   /transl_table=11
FT                   /locus_tag="CIY_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73114"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ25"
FT                   /protein_id="CBK73114.1"
FT                   /translation="MDDDYPGWEVCPTSELVPYDQLFTGEPEIWVDNCQQAFKAEILDR
FT                   QHDVKLKDKMPVEYAENVISANEIYDTLNSKQSAEEKDNVCVEASDERTDARELYRNES
FT                   NEAIIGNYFAKRSKIAFENEPDEAYKFYMQAIDLYYDAYAVSSLKQTYKNKTILYAGTC
FT                   YFNIGQSENLPIDVREQAYMFSIALTNEYRTKSKEDTIALNHTIGTAYMKLCELSDDDS
FT                   VKYYFNRKAEAEFEKDFANAGCGKKAKKAAAEELVYVEQYCYDHIDSSVYINETRNSVS
FT                   KKHKKYLKML"
FT   CDS             116217..116339
FT                   /transl_table=11
FT                   /locus_tag="CIY_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73115"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ26"
FT                   /protein_id="CBK73115.1"
FT                   /translation="MSDYEMLMIMLTVLALLFTACGFLLALLSFLDKRNNKRKK"
FT   CDS             complement(116456..116683)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73116"
FT                   /db_xref="GOA:D4IZ27"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ27"
FT                   /protein_id="CBK73116.1"
FT                   /translation="MLQLRIDEILEEQEHTKYWLYKRMEPMSYQNFNKIYNNETSSIKF
FT                   DTLEKLKMLYLLIMMTYLEKCKIQKFIESQ"
FT   CDS             116844..116930
FT                   /transl_table=11
FT                   /locus_tag="CIY_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73117"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ28"
FT                   /protein_id="CBK73117.1"
FT                   /translation="MFCFEFNQILHDKNIAKGNLNKIKIRIN"
FT   CDS             116971..117483
FT                   /transl_table=11
FT                   /locus_tag="CIY_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73118"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ29"
FT                   /protein_id="CBK73118.1"
FT                   /translation="MTFCSCGSSSASDNSYIDVIKNGYLGEFDDVTVDEMLTNYLSVFY
FT                   DSLTWDVGTTNDNKVIVQLHASAVDKELKFDDTDIQFTFLDNDVFQVSGLKDGTLLTED
FT                   TKASDVAYFMDAVYLNYYMKKINPDENAYSERLNSINATSCLYGASASYDGDRKNYMNY
FT                   LKISRWI"
FT   CDS             117474..117983
FT                   /transl_table=11
FT                   /locus_tag="CIY_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73119"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ30"
FT                   /protein_id="CBK73119.1"
FT                   /translation="MDMTAFGLINYYLGLNPEGTSLQAEDTQEEAIADNNDIMVDAVED
FT                   SENGYENTETVSDVVSTLSNISGAFTGGWGNEIHVEAYTDKKYVLYSGDPIGYLSVYGY
FT                   DEGYLYNAEDFSGYDLGKGYYICEGTEETIIMEVSDNGDGGYYVAIYHDDDEMHMIDDF
FT                   VCYPFS"
FT   CDS             118045..118251
FT                   /transl_table=11
FT                   /locus_tag="CIY_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73120"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ31"
FT                   /protein_id="CBK73120.1"
FT                   /translation="MSKNKNIILESSAPLDDGGRKYNLIYPICGVGLGIVFLVMSGAGL
FT                   AGLVFGLLLGLAIGWLIKIKYAT"
FT   CDS             118581..118700
FT                   /transl_table=11
FT                   /locus_tag="CIY_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73121"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ32"
FT                   /protein_id="CBK73121.1"
FT                   /translation="MGTLYLIVWVLWIVAIEYLYHKVFTVYYFSLGEGLKKKS"
FT   CDS             118793..118951
FT                   /transl_table=11
FT                   /locus_tag="CIY_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73122"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ33"
FT                   /protein_id="CBK73122.1"
FT                   /translation="MSKTRNKMHIIIAVVIAIVVAILGLMVRTSSTEEEANYSFEQVIQ
FT                   ENISETI"
FT   CDS             119228..119365
FT                   /transl_table=11
FT                   /locus_tag="CIY_01450"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73123"
FT                   /db_xref="GOA:D4IZ34"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ34"
FT                   /protein_id="CBK73123.1"
FT                   /translation="MYANGMQQADIQRMAGHSDPATTDHYKRVSRLGDIDTNSWNEMFG
FT                   "
FT   gap             119409..122076
FT                   /estimated_length=2668
FT   CDS             complement(123197..123652)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01470"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73124"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ35"
FT                   /protein_id="CBK73124.1"
FT                   /translation="MGSKILEVTVYLILAFFMINAQGADILYVFFALIFLLLAFLMFFM
FT                   CVSVISTIGFWIIQMWPLRSILTAIYLLMGGLYFPLDLLPKPYYMVLSVTPFAIVGHVL
FT                   TKVLTCQVENTFILYYCLITLIWIVFLYYIYNILLSKGLKKYEGMGN"
FT   CDS             complement(123724..123978)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73125"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ36"
FT                   /protein_id="CBK73125.1"
FT                   /translation="MNKYLRILYSQISSQLIYKFDTCVKLALKVMQILTTVFIWKAIYI
FT                   SNEYNYIGEYSYNNMIMYIILANVASVIFLLNLVLGWGL"
FT   CDS             complement(123975..124298)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73126"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ37"
FT                   /protein_id="CBK73126.1"
FT                   /translation="MNDIEKMANRIAVIIKGKIVKESTIDEIRKEYSTQNCYIIETKEN
FT                   KIPFDAKAYRIERIESCKYKLYLNEDSENILNNVNISNIVSIREEVPKLEEIIFKMFTQ
FT                   ENQ"
FT   CDS             complement(124934..125737)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73127"
FT                   /db_xref="InterPro:IPR024131"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ38"
FT                   /protein_id="CBK73127.1"
FT                   /translation="MQTVYIEEHQEAFKEIVKLHRVKKQKFTLIHIDDHSDMNEAIVSE
FT                   SAINNLTDESIDLISYSQLNYGNYIPPLLYTDIIEDVIWISNHNSERFSEICINTEQKA
FT                   NDFISLLPIKTKVAGNIHKLITCRADTNLTHIYDFSNKSVIVSVDLDYFGSNDHLGELI
FT                   ELEITRNQFFELQNNIYNKVRCSFGSNLNVYSKDSRYYVKLFGLEPIPACKISENEIKA
FT                   NLATLRDFFVRHNLNPDLNIICKSESSGYTRQEVIKYFVENRINI"
FT   CDS             complement(126956..127120)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73128"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ39"
FT                   /protein_id="CBK73128.1"
FT                   /translation="MGNRRSEINVVMSEILEDNQLMDISLADIVNKSFSEINVSQQEKM
FT                   LIEALNAAE"
FT   CDS             complement(127325..128026)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01570"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73129"
FT                   /db_xref="GOA:D4IZ40"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ40"
FT                   /protein_id="CBK73129.1"
FT                   /translation="MKRSLTHNERLSRFNQELCTKIQSGDDNAKQLLILANKGLVIANA
FT                   ILVEKEYSLNSNPYGGWDIEDLIQEGYLALIDAALSFSPEAGAKFSTYATEVIRNKMRD
FT                   VGRRTFGTFEKHSVDDGLTNIFLDDDPANGYRDEYIGQLTAEASVDSHRDPTGELAVHR
FT                   TMLLKMLIRLQDLPSDARKVLTYHYGFSLREGRTLEATARHFNKSKETVKGIEQSSLQH
FT                   LRVAMNDYSVT"
FT   CDS             complement(128026..128751)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73130"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ41"
FT                   /protein_id="CBK73130.1"
FT                   /translation="MESGGVDSITGKSLKALADLYNVSTDFILGLTDNPEPFYHDIGEL
FT                   GLSAEAVKHLLTDNVNPDVVNELLLNKNFRQATKSMAIYFSGQMDETYKIRNDLLSCTA
FT                   EFLEDEVDINEITDVEEFQNDIKEIKSQKFTASRYEFDQIIHRIEAAVREIKKKSEEEI
FT                   KANGLNRTSDLNRKVFNTFVEEYKGKSKKNLSTDEKIDIMMTATEKSLLEQGANEKMVK
FT                   ALRTPIRWFYKVVALFDKK"
FT   CDS             complement(128805..128885)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73131"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ42"
FT                   /protein_id="CBK73131.1"
FT                   /translation="MDVMELDVFLPEDRPKRLEQLRRKKV"
FT   CDS             129228..129548
FT                   /transl_table=11
FT                   /locus_tag="CIY_01600"
FT                   /product="Rice tungro bacilliform virus P46 protein."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73132"
FT                   /db_xref="InterPro:IPR024215"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ43"
FT                   /protein_id="CBK73132.1"
FT                   /translation="MTELEKLRQQHETACKKVEQAEHQITRAENRLKSALRKQDKERTH
FT                   RLIVEGAELEYIFDGIENLSQDDFWKFMRKLTQIPDVRELYSSFNPSAVFLSEDVMKEG
FT                   DN"
FT   CDS             129548..129817
FT                   /transl_table=11
FT                   /locus_tag="CIY_01610"
FT                   /product="MobA/MobL family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73133"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ44"
FT                   /protein_id="CBK73133.1"
FT                   /translation="MALYHFNVTQASRGKGQSAVACAAYRSGEKLYDDYYGEIQDYTKK
FT                   GGVLYTEVMLPEYAPERLKDRQTLWNEVEKLKNIHKLSLHFLLM"
FT   CDS             129898..130095
FT                   /transl_table=11
FT                   /locus_tag="CIY_01620"
FT                   /product="MobA/MobL family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73134"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ45"
FT                   /protein_id="CBK73134.1"
FT                   /translation="MIVDLAIHNPDKGNNGIPNPHFHVLAPIRPLNKDGLWGEKQHREY
FT                   LYDEVGNPILDKKESQSLTL"
FT   CDS             130272..130748
FT                   /transl_table=11
FT                   /locus_tag="CIY_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73135"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ46"
FT                   /protein_id="CBK73135.1"
FT                   /translation="MEKRGIKTNVGDWNRLIKQTNRLISSLKSNLRSLLEWIAVLKVKI
FT                   SDFIETEKLQKADSNALAETLCAYYERRNAGAYSNKAKANNAKKQMEIINFLTENKITT
FT                   IPELESVIKNMYSKVNDLQMKMKKVEAEKDSIEKLSKHSTTSKLTSRFMTIFVP"
FT   CDS             130810..131046
FT                   /transl_table=11
FT                   /locus_tag="CIY_01640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73136"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ47"
FT                   /protein_id="CBK73136.1"
FT                   /translation="MSRRILKEKYPNGKVPYNTLKSRLEQLENDYSSLFSEYKQMKADA
FT                   SKAYSLRMAIDSDYKQVLKEQNREVKRREDISL"
FT   CDS             131046..131468
FT                   /transl_table=11
FT                   /locus_tag="CIY_01650"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73137"
FT                   /db_xref="GOA:D4IZ48"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ48"
FT                   /protein_id="CBK73137.1"
FT                   /translation="MIDFNMLKQAVSLEEAASFYGIFYDKRSKKCCCLFHNDKHPSMKL
FT                   NKEYFYCFSCGAHGDVINLVQQIYGLSAIESAQKICNDFNLNGSTDTCKSPSIIKQRQQ
FT                   EIEHRKALERAFHQARRDALLFCMNIIACFFHGDVI"
FT   CDS             133180..134613
FT                   /transl_table=11
FT                   /locus_tag="CIY_01670"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73138"
FT                   /db_xref="GOA:D4IZ49"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ49"
FT                   /protein_id="CBK73138.1"
FT                   /translation="MDTKLKNIEIVKMMYKLQADVESLNSQVNLGIIDASGARDELNIL
FT                   NTKQQRLRDQLVLSNHVTKDGQPRLIKHHTPTDGDPKEYYITIMPDGKRMKAVSYDKLM
FT                   DKLYNYYADGLLDFSVESVFKAALEEKVVTENPKPRTIEKNKGDFKRFISEDFAKKDIR
FT                   TISEVDLKKFIQTWVTETHPKQKTFLSFKGILNLIFEYAYMHKIIVENPVSYVKNRPYM
FT                   KSCDTSKAKSEEKIFSPEEIQMLKDEVRRRIDSGLKRFGDYYINGYAMLFAIETGVRVG
FT                   ELCALKWEDVKDNYIHIHAQQLFQNVDGKKEVYYAPYTKNEKGISEDGRQFPLTNAIES
FT                   LLNEIKAKQEKLGIESEFIFCNKDGRWIIEEAYTSFLRRLCRSKGLTITNNHAFRMSLN
FT                   SNVLIPMGITVADRAAMLGHSIETNLKYYSFAQKDYLEDVKAKLNAMGSSTQGTPSGHP
FT                   KIVPFAKKESPESLNYQAF"
FT   gap             134628..134775
FT                   /estimated_length=148
FT   CDS             complement(134893..135435)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73139"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ50"
FT                   /protein_id="CBK73139.1"
FT                   /translation="MKKVIATILIATTSLMMVACGSSSGDTKVIESSSNSSNGAAASSN
FT                   SESGFTFEYEGLEITVDADVAPVIEKLGEPSKYFESPSCAAEGIGKLYTYSDFEIQTYP
FT                   DGDVDRVLYVRLRTDNVSTKEGVDLSSSKDDIISAYGEPTSEGTGSMTYENNGTSLIFI
FT                   FDGDALSSIEYDSELNK"
FT   CDS             complement(135608..136684)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73140"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ51"
FT                   /protein_id="CBK73140.1"
FT                   /translation="MKKRIVVLGVIILALAGVGVGCYAYYNQLSDLVYKEVYVEAGTSD
FT                   CDVSEFLKREDDTARFTKDSKFDAKTPGDYNLKIKASLPIFGEKTFDTVLHVQDTVAPQ
FT                   VTLAKDSIEIYTTEGAPVVTDFVDSIDDVTNCSIDFAEQYDFTKEGQFDITILVKDTSG
FT                   NETKVSIPCTVIEDVTPPEIKGVEPLVIAQGDAVSYKKNIEVVDDRDENPRLEVDSSGV
FT                   NVDKRGVYTVKYIASDAAGNTTEKTATVKIVSAKISAATEETVYAKADEILAEIIKPGM
FT                   SQLQEARAVFNWVVDNITYSESAGIDDVLSAAYKGMFNRIGDCTVKQKTAEVMLNRLGI
FT                   KNMEIEKFEIPEGITGCL"
FT   CDS             complement(136684..137403)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73141"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ52"
FT                   /protein_id="CBK73141.1"
FT                   /translation="MNQISLNNKFINVVQAAREPSFGGNQGWFVEKSLGNMASQGCGVI
FT                   SAVDTLLYINGLYNPTLEKYSNEVERFCRERRFAKLFMNEIKIRKYDNGVISLGIIPIQ
FT                   MSGFLNRMMKAIGKPFRFRWNGKHGHKDMYQKMKYMLSNDIPVIWSLYAFGRQIRMYHM
FT                   SMDCQDFVYADISVNSHYVTVTGIIEGLSAAHPRMIEVSSWGKRYYIDYDEYLEYVGKS
FT                   LINAYCSNIMFIKKERY"
FT   gap             137664..137800
FT                   /estimated_length=137
FT   CDS             complement(137974..139155)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73142"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ53"
FT                   /protein_id="CBK73142.1"
FT                   /translation="MKIENSHVNMASSHNSYSYTHVEVATIERRASSDTLGAIMQLSEE
FT                   GEKSYKEAIKQYEKDEEQARKDRQQKNMQNSMKLMAEQEKKAREANAGRSQWNFEDLEI
FT                   SIVKKILAVLNGEKLDTKLKEQLHNWQKGILGGCDNNSDGVSFSVNGISQNTLNLSSAE
FT                   SVSRTQVWQKITATEGTHLEYENTTFASQGTIQTADGRSLNFNVEVQLGRSLSQKINTL
FT                   SAESYTRILTDPLVINMDSNITSVSDMKFKFDIDSDGKEDEISFVGKGSGFLALDKNED
FT                   GKINDGSELFGTKSGDGFSDLAEYDEDHNGWIDENDSIFSKLKVWTKDENGNDQLLNLK
FT                   EADVGAIYLNSAETEFSYKDIVGETNGVLRKTGIYLKESTGAASTVAHVDLAL"
FT   CDS             139402..139635
FT                   /transl_table=11
FT                   /locus_tag="CIY_01730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73143"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ54"
FT                   /protein_id="CBK73143.1"
FT                   /translation="MDNILIQANIKMDTIKFDVSVAHEKSKEKLGSEIAASIRDKIEES
FT                   KNNSDQNDEKMMTRIMAKIKSGKRLSQKKNLI"
FT   CDS             139683..140018
FT                   /transl_table=11
FT                   /locus_tag="CIY_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73144"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ55"
FT                   /protein_id="CBK73144.1"
FT                   /translation="MAEAMASRLKHANSKEEVNDIIMQSISGISDKDPYKEFIVAALNE
FT                   VAKEFKNSDAYGELPATSEEANEKKKSSPNNDEDSFSKDNSDDFDPMSWSPLQELVDAM
FT                   PTFDAPA"
FT   CDS             complement(140106..140498)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73145"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ56"
FT                   /protein_id="CBK73145.1"
FT                   /translation="MRKMKLMTKMVAFAMSIIIASSTALPVSAKGSGGFIEESRIVAQG
FT                   VLEDGTPYTLYAVPEKGAHVNIVDSVHYELRVTFPWNSTPPDYMDVSIPMNGTTYKGTL
FT                   KLWGYFRNFNDYCLDATYTGTLIGRL"
FT   CDS             complement(140655..140948)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01760"
FT                   /product="Predicted transcription factor, homolog of
FT                   eukaryotic MBF1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73146"
FT                   /db_xref="GOA:D4IZ57"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ57"
FT                   /protein_id="CBK73146.1"
FT                   /translation="MNNEKIGKLIKNARLSKGYTQKEIANKLGVTDKAVSKWECGKSFP
FT                   DITMIESISRELGISVNQLVGVADNSKEEAVMLEKNEKKIKIRIMISIIIFQ"
FT   CDS             141198..142118
FT                   /transl_table=11
FT                   /locus_tag="CIY_01770"
FT                   /product="Peptidase C39 family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73147"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ58"
FT                   /protein_id="CBK73147.1"
FT                   /translation="MACKSHTNHPCCFYWFNSNGLFFAPEWLTDSVAFCILALSFFIYV
FT                   LISIIKIKHSPKATKKQKVDFEIDDLNLPEEKHTKKHLKMLKPVLAIVLIFLIVILRFN
FT                   IFGNQDVEDIPQNVIEFGEKYPEASDYVKNFNKYKDEDFDMDVSKEMSERDIPLFIQWD
FT                   KRWGYKDYGGNYVGIAGCGPTCVAMVACGLEQNAAINPYVVSQYAAQQGFYTYGQGTSW
FT                   DIMTTGAKHFGLDVSACSVSADYILNNLTSSTPLICSMTPGDFTKTGHFIVLTGVTDDG
FT                   QIIVNDPNSPKNSKSTGMSISLFLR"
FT   CDS             complement(142430..143011)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01780"
FT                   /product="NUDIX domain."
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73148"
FT                   /db_xref="GOA:D4IZ59"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ59"
FT                   /protein_id="CBK73148.1"
FT                   /translation="MQLDNNLEWKMVSCEHLVEDEYIDFRKCAYELPDGTVFEPFYNYS
FT                   RRDYAVIVATDEQGKYICVKQFRHGINKVTVEFCAGGLERLDGKEYGSNNGAMVETALE
FT                   GAKRELLEETGYVSDDWKFLLKIPSNATMADNYANIFVAKNCRKVAGQNLDDTEFLNVH
FT                   LYNRGEIDEMIQSGDFPQMAHVLALLLAEK"
FT   CDS             complement(143031..143576)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01790"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73149"
FT                   /db_xref="GOA:D4IZ60"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ60"
FT                   /protein_id="CBK73149.1"
FT                   /translation="MTIYNGRPENTDGRLEKEIRTYDYLDNLGIEYERVDHEAAETMEA
FT                   CKAVDEAIGIEMCKNLMLCNRQKTSFYLLLMPGDKKFKTKELSSQINSARLSFAEAEDM
FT                   IKYLDIVPGSLSVMGLINDKNNDVKLLIDEDVLKAKYIGCHPCVNTSSLKILTADVIER
FT                   FIPSTNHDITIVHLVGED"
FT   gap             143753..143906
FT                   /estimated_length=154
FT   CDS             144232..144561
FT                   /transl_table=11
FT                   /locus_tag="CIY_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73150"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ61"
FT                   /protein_id="CBK73150.1"
FT                   /translation="MKEISIFIDESGDFGEYAVHSPFYIITMVFHDQSIDISEDISKLD
FT                   KELDYLGLHDLCIHTGPIIRKEEIYKRMSIPERRRVFNKMVAFVRQLDITYKSFYIEKN
FT                   MWMIR"
FT   CDS             complement(145109..145846)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01820"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73151"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ62"
FT                   /protein_id="CBK73151.1"
FT                   /translation="MHKLRRVYALLAILSLVYSVAVFMVGSGTFSFIIWIFAAIFWGFL
FT                   YLMDKKSLWPKIPKAIKYAFRSIVAICLTIFVICQGCILTQFFSKGESGAEYIIVLGAQ
FT                   MRDWGPSVVYKARLDSAVEYLNNNPDTKVIVTGGQGANESISEGEGGQEYLLSQGINKD
FT                   RILVEKDSVDTDENISNALSLIDTDNDMKICIVTNNFHVFRGVMIAKRYTNAQISGIAA
FT                   FTQYQYLPNNMVRETFGILKDIL"
FT   CDS             complement(145881..146285)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01830"
FT                   /product="Archaea bacterial proteins of unknown function."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73152"
FT                   /db_xref="GOA:D4IZ63"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ63"
FT                   /protein_id="CBK73152.1"
FT                   /translation="MDSDVFYEKYINKDFEEFYVPHKFEEICRQYLIRQNRLGNIEPVI
FT                   EKIGKYYYDNPKERTNGEFDVVTLDENGYVFYEVKFRNKKTSDEVINEEIHQVKETGLN
FT                   CYKYVFISRAGFTGKETDEVKHIELSELYI"
FT   CDS             complement(146291..147259)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01840"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73153"
FT                   /db_xref="GOA:D4IZ64"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ64"
FT                   /protein_id="CBK73153.1"
FT                   /translation="MKFYGRATELKRMKRELNADDMRMTLIYGRRRIGKSELVKQAIKE
FT                   ANIKAIYYECKQVTEESNVQSICEVVYDTLDLPKLGYTKVEEIVDYIFKLSKDENIVFV
FT                   LDEYPYLRGAVKGLDSIIQALVDKYRDNSKLKLIILGSYVDVMKSLLSESNPLYGRVDL
FT                   VIDLKQMDYYESALFYPNLSDEDKVRIYSVFGGIPYYNRLVDDKRSVKENIIELIASSG
FT                   ARLENEVSMYLSAEISKIVNANEVFEALSRGFSKYSDILSQSHVSSGPTLIDVLDKLMN
FT                   MEVVEKKAPINDEFNKRRLVIISVIIYPFSITDTYLSIHLS"
FT   CDS             147559..147921
FT                   /transl_table=11
FT                   /locus_tag="CIY_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73154"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ65"
FT                   /protein_id="CBK73154.1"
FT                   /translation="MELTTLNKEYKLLREDGAEKFIKMSAIDPTINFVEEYWITSDHTL
FT                   GNARAYFDSYEMGIEYAMDRVDYRMTLNEDGQKPFIILLNGKVINTLGQLENFLNGEFK
FT                   ISTSNVIEKNVRKLYS"
FT   CDS             complement(147963..149285)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01860"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73155"
FT                   /db_xref="GOA:D4IZ66"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ66"
FT                   /protein_id="CBK73155.1"
FT                   /translation="MIQTKNNSLFNIFIAVVMVALPTMLEQILSVLMQYVDTAMVGRLG
FT                   ADATAAVSTSTTITWLIGSIPVAFGVGAMTQIAQAIGSGEKHKISQVAKVSLVFAVGVG
FT                   VIIEAICMAVAPFVAGWMGASEEVAPAATRYFFWISVPIVFKSLNIVLSAAIRATKDTK
FT                   TPMFIGVGANLLNVVLDYVFIYIFGLGVDGAAYATCISAVVSGLVTLSVFLGHKEFKLE
FT                   SSVFSLDKEIVDRMWRLSLPVLLINVASTSGYVVFAGLVSHMGTIIFAAHSIAVGAEEL
FT                   FYIGGYGFKSAANTMVGISYGEQNHDKYHAVCVSSVIATVAIMTISGVLLFIFAEALMG
FT                   FFTNDPQVIALGTTVLKMVAFNEPFFGLYIISEGIYYGLGKTKYPFVIEFGGMWLVRIV
FT                   STFIGIHFFGMGLIGVWCCMIADNVIKAILLTVPLKTLWKK"
FT   CDS             complement(149266..149742)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01870"
FT                   /product="DnaJ domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73156"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ67"
FT                   /protein_id="CBK73156.1"
FT                   /translation="MIKTRAEALRALGLGPDAGEQQIKAVYKDLVKKCHPDVTGRDDAS
FT                   LYNRITEAYQFLINDSKGRVLTHSRVVGKSSTKKPASKADYAAFQKKAAKQKERRAQEF
FT                   EEKQREFSAMYEKQEADYKRAMEAIDAIRVARAIESMVWANGLGKESNNDTNEE"
FT   CDS             complement(151079..151801)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01890"
FT                   /product="EDD domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73157"
FT                   /db_xref="GOA:D4IZ68"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ68"
FT                   /protein_id="CBK73157.1"
FT                   /translation="MYKIILDSCGELNEEMKKDGHFVNVPLTLEIDDKQIIDDETFDQA
FT                   SFIKAVAESPNAPKSACPSPNAYMEEMECDADNIYVVTLSAQLSGSYNSACLGKDLYEE
FT                   DDESKNIHVFDSKSASIGETLIALKIAECENAGMSFEEVIEKVDAYIEEQHTFFVLETL
FT                   ETFRKSGRLSGLKAAIAETLNIKPVMGSTETGYIQQLAKGRGMNQTIDKMTKCVMDVTT
FT                   NCEEKFLQFLIATVQNVR"
FT   CDS             complement(153203..153406)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01910"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /function="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73158"
FT                   /db_xref="GOA:D4IZ69"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ69"
FT                   /protein_id="CBK73158.1"
FT                   /translation="MSKGTVKWFNNSKGYGFISDEEGKDVFVHFSGINSEGFKTLEEGA
FT                   TVEYEVTDGAKGPQAVNVTVVR"
FT   CDS             complement(153616..154260)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01920"
FT                   /product="ATP-dependent protease Clp, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73159"
FT                   /db_xref="GOA:D4IZ70"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ70"
FT                   /protein_id="CBK73159.1"
FT                   /translation="MLKLLEGADVEVPIGASSKNAMVPTTTINTRNILFICGGAFPAMD
FT                   EIIKARLNKHSSMGFMADLKDKYDDDKNILQKVTVEDLREFGMIPEFIGRLPIVFATEM
FT                   LDEDMLVRILKEPKNAIIKQYQKLLELDEVKLEFEEGALHAIARKALDKKLGARGLRSI
FT                   IEEFMLDIMYEIPKDDNIGQVIITEDYIEKKGGPKILVRTAGMLPERAAAN"
FT   CDS             complement(154284..155111)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01930"
FT                   /product="ATP-dependent protease Clp, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73160"
FT                   /db_xref="GOA:D4IZ71"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ71"
FT                   /protein_id="CBK73160.1"
FT                   /translation="MSNQDFREFDPEDTNGADISDEIIEEVTGKDKDSSDKDKKPTEFC
FT                   YMCHRPDNICGPLIKMAPGMGVCNECLQRTFDSMGSFGFGGGDNSKSNMDMNKMPNISF
FT                   LNLGSLFGEGPKVKNAHGTASQKKEDKPAPAIDINNIIPPHKIKAMLDDYVVGQDYAKK
FT                   VMSVAVYNHYKRVATGTMDDIEIEKSNMLMLGPTGSGKTYLVRTLAKLLDVPLAITDAT
FT                   SLTEAGYIGDDIESVVSKLLAAAGNDVERCQQGIIFIDEIDKLAKKKIQISVM"
FT   CDS             complement(155121..156101)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01940"
FT                   /product="Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73161"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ72"
FT                   /protein_id="CBK73161.1"
FT                   /translation="MTFENLFISDQDFEASVQEVIRPFLRERANDGYFVNTDGLSLHYK
FT                   YLINPDERASIVISHGFCEYIPKYEETVYYFYKMGYSVFVMEHRGHGFSEREVDNLSKV
FT                   YVKHFEDYVNDFNQFVEKIVTPKSKSGHLYLFAHSMGGGIGAMYLEKYPNVFEKAVLTS
FT                   PMIEIATPTTNAFVIKLVCLLSHLRIFAKSFLPKHHEYDHTYKYPQCSAMSKARYNSQY
FT                   NQREEEPHYRTNGATFAWTREAVNVSKKILKNAHLIEIPVILMQASKDTLVMPQAQVKF
FT                   SQLAKNCTLRIFEGSKHEIFNATDDIIREYYKEVFSFFENRSCEE"
FT   CDS             complement(156950..158281)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01960"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73162"
FT                   /db_xref="GOA:D4IZ73"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ73"
FT                   /protein_id="CBK73162.1"
FT                   /translation="MKFDVKKTVQMGFGFLSICAFWQMYNALIPLVLTNTFHLNETISG
FT                   VIMAMDNVLALFLLPLFGNISDRCKNVMGRRKPFLLYGTIAAVVLMMMLPFVDNSYYAN
FT                   PSVSKEILFIGILGALLIAMGTYRSPVVALVADCTIKPLRSRANAIINLMGALGGIIYL
FT                   IVAAVFYPASKTKGLEHVNYLLIFMVVAGIMLVSLCIVMITVDEKAMRKQVENYELLHP
FT                   EENLTVEDENGKTVLPREVKISLGFLLASVALWFIAYNGMETWFTTYAVRMWGMALGDA
FT                   SKCLLIANAGAIIFFIPSGMIASKIGRKRTILLGILLLGGSFFAGFVYTLFSSSFSPFL
FT                   YFFFATMGAGWAFINVNSLPMVLEMCSDSESGKFTGYYYTFSMAAQIVTPIVAGWLLNN
FT                   VGYLTLFPYATIFAFAAFITMLFVKHGDVDIEVKKGLEAFEAMD"
FT   CDS             complement(158452..159597)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73163"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ74"
FT                   /protein_id="CBK73163.1"
FT                   /translation="MLDGNGSIITGQLSGKIVKGDKVYVCMPATKPIECEVQAVEAQVD
FT                   GRGAIVDEAEDTKVSLQLSLPDDAQVKKYAVVTNIQPQDKIDPRVSIENPALAGIIYGL
FT                   TSYAQDNAFHGTVAYWASHAHFLTPIKMDQEPEVNEQGVTVIKKDTKIGFYMLKSTIKL
FT                   AGAPEDQDNMVLPLFTDWDALRKWEGLAKEGQKIHTQILSFQDVYAMLKRGNAYAGIAI
FT                   NPFNKVPCTLPIPYLDTITGTPGYQAEFGPKDGQAQGNVQEQKIPAGQKILLGVPKESE
FT                   ENAAIRGKLVEYGQSHDEIKSISFLTKVEEESKMVRHLVVLEFPEGYSKEDMKNHMEAI
FT                   YQELRPLAHEIQAIEYALKGAIPAVDNVVSQHADKMLVYTA"
FT   CDS             complement(159654..159713)
FT                   /transl_table=11
FT                   /locus_tag="CIY_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73164"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ75"
FT                   /protein_id="CBK73164.1"
FT                   /translation="MGLFDKKKRKKMLQLQILT"
FT   CDS             159943..160389
FT                   /transl_table=11
FT                   /locus_tag="CIY_01990"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73165"
FT                   /db_xref="GOA:D4IZ76"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ76"
FT                   /protein_id="CBK73165.1"
FT                   /translation="MSEKKGFISEFKEFIMRGNVMDMAVGVIVGGAFTAIVTSLNEDIL
FT                   SPILGIFGGTDFSELKVTLGSGELAPTLTYGNFITAVINFLITALVIFCIIKGLNRATE
FT                   RAAALVKKNKEEAEAADPTEKDCPYCYSKINIKATRCPHCTAQL"
FT   CDS             complement(160495..161709)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02000"
FT                   /product="LL-diaminopimelate aminotransferase apoenzyme"
FT                   /function="LL-diaminopimelate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73166"
FT                   /db_xref="GOA:D4IZ77"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ77"
FT                   /protein_id="CBK73166.1"
FT                   /translation="MFKVNTNFQKLPGSYLFSTIAKKVTAYNEANPNADIIRLGIGDVT
FT                   QPIAPAMIKALHDSVDEMGNASTFHGYAPDLGYPFLRETIAKNDYQARGCDISADEIFV
FT                   SDGAKSDSADIQELFAADVKIAVCDPVYPVYVDSNVMAGRLGTFDETTGKWSDLIYMPT
FT                   TAENKFVPEFPKETPDVIYLCLPNNPTGTTLTKSQLQLWVDYANKNGSLIIFDAAYEAY
FT                   ISEADVPHSIYECAGAKTCAIEIHSFSKNAGFTGVRLGYTVVPKNLVFDGASLNAMWAR
FT                   RHGTKFNGAPYIIQRAGEAVYSAEGQAQIKEQVGYYMNNAKTIYTGLKDAGFEVYGGVN
FT                   APYIWLKTPDNMTSWEFFDYLLEKVQIVGTPGAGFGPSGEGYFRLTAFGSAENTVRAIE
FT                   RIKTL"
FT   CDS             complement(162347..162535)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73167"
FT                   /db_xref="GOA:D4IZ78"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011858"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ78"
FT                   /protein_id="CBK73167.1"
FT                   /translation="MEFRPCIDIHNGKVKQIVGSTISDLWKENGRPKENFVADKDAAYY
FT                   ANLYRQDGLKGGTHYQP"
FT   CDS             complement(162593..163897)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02030"
FT                   /product="Aspartyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73168"
FT                   /db_xref="GOA:D4IZ79"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ79"
FT                   /protein_id="CBK73168.1"
FT                   /translation="MNKTVKGLFDFIEKSPSQFHVVANQRQVFLDAGFEELTEASSWDL
FT                   KLGGNYFVTRNGSSILAFRMPKKEYRSFMIMASHSDSPTFRIKEMPEMKEGHYVKLNTE
FT                   RYGGMLMAPWFDRPLSIAGRAIVKTKTGIQTMLVNLDRDLCMLPSLAIHMNREANDGYK
FT                   FNAQKDMLPLISMDEKFNLKELVAESLSVKAEDIVGSDLFLYNRDAGRVWGAKDEFISI
FT                   GRLDDLQCAYSSMMGIVNAKNTDTAVELHVTFDNEEVGSGTKQGADSTFLYDALVRINE
FT                   AMGGNNSKLLEAIANSFMVSADNAHALHPNYSEKSDPTNKVYMNEGVVIKFNANQKYMT
FT                   DGLAFGIFSEICRNAKVPFQTFVNRSDVPGGSTLGNISNAHVSINGVDIGLAQLAMHSP
FT                   FETAGVKDTEYLLKIATKFYETVIESQGIDSYTVK"
FT   CDS             complement(163920..164489)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02040"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73169"
FT                   /db_xref="GOA:D4IZ80"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ80"
FT                   /protein_id="CBK73169.1"
FT                   /translation="MAKQKWKAGNMVYPLPAVMVSCRGKDGKDNILTVAWTGTVCTNPP
FT                   MAYISVRPSRHSYQMIMETGEFAINLTTEELAKITDYCGVTSGRDVDKFEKCGLHKVEA
FT                   DEINVPLIEESPVNIECRVREYHEYGSHTMFVADVLCVHADEKYMDENGRFALEEAGLL
FT                   AYSHGTYFGLTKPQGTFGYSVKKIKN"
FT   CDS             165931..168189
FT                   /transl_table=11
FT                   /locus_tag="CIY_02060"
FT                   /product="formate acetyltransferase 1"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73170"
FT                   /db_xref="GOA:D4IZ81"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ81"
FT                   /protein_id="CBK73170.1"
FT                   /translation="MANHDFPQWNGFVGRVWKDNVDVRDFIQNNYTPYDGDESFLADPT
FT                   EATNTLWGKLQELQAAERAKGGVLDMDTDVVSSLTSHGPGYISEETKDLEQIVGLQTDK
FT                   PLKRAFMPYGGITMAEQSCKMYGYEPSEKLHEIFTKYHKTHNQGVFDIYTPEMKKARHN
FT                   KILTGLPDTYGRGRIVGDYRRVALYGIDYLIEKKQADFAATNRQGMRRYDFQLREEIAD
FT                   QINALKGMKEMAAIYGIDISKPAGTAKEAAQWLYFGYLAAIKTQNGAAMSVGRVSTFLD
FT                   IYFTRDLANGVITESEAQEIIDHFTMKCRMVKFARIESYNQLFSGDPVWATLEVGGIGL
FT                   DGRHQVTKTCYRFLHTLENMGPSPEPNLTVMYSSRLPETFKKYASKISVTTSSIQYEND
FT                   DVMRVTWGDDYSICCCVSATETGKELQFFGARANLAKCLLYAINGGVDEKSGDQVGPEY
FT                   KAITSEYLDYDEVMQKFDQMMDWLAHLYVGTLNMIHYMHDKYNYEACQMALIDTHVRRS
FT                   FATGIAGFSHCVDSLSAIKYAKVKAIRNENGVTKDFEIEGDFPRYGNDDDRADEIAIWL
FT                   LRTFMGKLRHIHTYRDSEPTTSILTITSNVVYGKATGALPDGRPAGEPLSPGANPAYGA
FT                   EVNGLIASLNSVAKLPYEEALDGISNTQTINPGALGHTDEERTANLVNVLDGYFDQGAH
FT                   HLNVNVFGKEKLIDAMEHPEKPEYANFTIRVSGYAVKFIDLTKEQQLDVISRTCHEAL"
FT   CDS             168295..169029
FT                   /transl_table=11
FT                   /locus_tag="CIY_02070"
FT                   /product="pyruvate formate-lyase 1-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73171"
FT                   /db_xref="GOA:D4IZ82"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ82"
FT                   /protein_id="CBK73171.1"
FT                   /translation="MEEIIGYVNKLESFGAVDGPGVRYLIFLNGCRMRCAFCHNPETWK
FT                   EGQGQQFTADELLKKALRFKPYWKNGGGITVSGGEPLLQIDFVLDLFKKAKAQGINTCI
FT                   DTAGQPFTHDEPFYSKWKELMSLTDTVLLDIKNIDTAAHKELTGVDNANILEMAREISD
FT                   MEIPIWIRHVLVPGGSDNDDYLRRTREFIDTLKTVEKVEVLPYHTLGVPKYNELGIPYR
FT                   LEGVESPTAERIENAKKILGAK"
FT   CDS             complement(169069..170622)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02080"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73172"
FT                   /db_xref="GOA:D4IZ83"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ83"
FT                   /protein_id="CBK73172.1"
FT                   /translation="MQDLATLCAEIVEQEIEVNGVTGVNYETLKPVLEGRGLNGIESSY
FT                   IYVINQEGTFIYHKKPDKIDTKVANAEINKLITEIPSGNYVASNISRYTDENGVVKYSA
FT                   YQVIKSTGWVTVCVADDKDIMAEINAIRNVGILLSTIMAAVVLLIGIIAARGITNPIQI
FT                   ITGIIKNVAALNFVVGDDIEKLEHKRDETGIMARAVSEMENNLRDIVEKIASTSVDLEG
FT                   HALRLKDITMEIDSANSDNSATSEELAASMEETSATTDVISERAASIKENANVIAEEAK
FT                   EGASSAKEIKQRAVSVYNETVTAKEKTGRIYDEISEQSKTALEKSKAVEKVNDLAVAIQ
FT                   DIASQTNLLALNASIEAARAGEAGKGFAVVATEIGGLATQSSNTVAGIMEIVAEVKESV
FT                   NSMNECLSKTLGYIEKDVADDYTNFMKMADDYKNDAENFSTVMDEISEKISELQESTTE
FT                   ISISVDEISKTVSEAAEAVSTVAEKATDVANLSDGVVKVVGETEANSDELREIKESFTI
FT                   "
FT   CDS             171017..171472
FT                   /transl_table=11
FT                   /locus_tag="CIY_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73173"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ84"
FT                   /protein_id="CBK73173.1"
FT                   /translation="MPKNKFQDVVFTIIMATVMVYGMVVYNVALNTGGVTGQTFLLALH
FT                   ELPIMVPIAFVLEFFIVGKIARGLAFSVMDPAKDRPQFITYAISICICCIMCPIMSLVA
FT                   TILFKDTHTFGTWIQTWAMNFPMALLYQLFYCGPFVRLIFRTIFKKK"
FT   CDS             complement(171514..173364)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02100"
FT                   /product="Trehalose and maltose hydrolases (possible
FT                   phosphorylases)"
FT                   /EC_number="2.4.1.230"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73174"
FT                   /db_xref="GOA:D4IZ85"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ85"
FT                   /protein_id="CBK73174.1"
FT                   /translation="MNESKITGYKRWLDMRDGSLNRHLTWHTKEGQVVEMEFFRFISKE
FT                   NAHLAISQIKLKLASGNGEVTFFGGVNVGVRTNGFNHFTGTENSAIDKNTIQVSVDTNG
FT                   GNKVVILSKLLANRKVSTVTLGDEKRGFTTGTLELGEGEELVIQRIITVATDRDKVKEV
FT                   TDPFETCTTTMDYAIESGCDVLLKRHQDKWKEYWNRSDVIIEGDDRVQKALRMSIYHLL
FT                   RADNDRDDRVAICAKGYAGAAYFGRYFWDTEISLLPFFIYTNPEAAKKLLLFRYNTLEG
FT                   AKRNATSYGYKGARYPWESSVSGDEECANWQYADHEIHVTADIVYAIMHYVFATEDIDF
FT                   IRKYGIDIMVETARYWCTRVDRFADGSYQLLGVMGPDEYLPITNNNRYTNKMVKYSLEQ
FT                   TIFWLEQFRPEHLHVTDDEIALFKDVAANLKLDLDSPEGVILQCDEFLNYADIDFDTVW
FT                   KDRSKCFGTYISQERNYRSKALKQADVLEMMMLFKNEFTKEELRANYDYYEPITTHDSS
FT                   LSAAVHGIIAAWLGKEDEAMAFLNRVINIDMDDNKLGAEEGIHIANCGGLWQLVVFGFA
FT                   GMKTAFESDEIVFEPHLPKGWKKIIIPIEKDGQLKRYEVQ"
FT   CDS             complement(173361..173705)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02110"
FT                   /product="Trehalose and maltose hydrolases (possible
FT                   phosphorylases)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73175"
FT                   /db_xref="GOA:D4IZ86"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ86"
FT                   /protein_id="CBK73175.1"
FT                   /translation="MIEMKGNKYDINWCLTEETYDPEKSKHYEGLFTQGNGYMDVRGSY
FT                   DEGVSCVNQAREYERKPANVTLEKHLKEQSNWGTYIPGIVGKHPHLMTEIINLPYFLKQ
FT                   VFALMVKPLI"
FT   CDS             complement(173719..174396)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02120"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73176"
FT                   /db_xref="GOA:D4IZ87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ87"
FT                   /protein_id="CBK73176.1"
FT                   /translation="MHISNYVTAFKLAPILTFYKNSIVVAIVATLLNLFVCSMAAYVVV
FT                   RCSFKAKGLVTLMFSLGLIIPGAALIQPLYTILNGSHLYNSLTGLVLVYTALGMPTTFY
FT                   IMVSYIKTIPFTLEEAAYIDGSGFFRTFLQIVLPITRPAFATAGVIQFLLAWNEFQFAL
FT                   TLTGNTEKRTLPIALYYFKSAFASDYGAMFAATVVVAIPSIIAFIILQKQVIAGLAAGS
FT                   VKG"
FT   CDS             complement(174375..174539)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73177"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ88"
FT                   /protein_id="CBK73177.1"
FT                   /translation="MKAIQKILIGLFLTIIVVISLVPFIWVLFLHSKPIVKSCLQGWDF
FT                   LLGCIFQIM"
FT   CDS             complement(175169..175423)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73178"
FT                   /db_xref="GOA:D4IZ89"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ89"
FT                   /protein_id="CBK73178.1"
FT                   /translation="MTKNKKWIALFLAPGVLIFAYIFLTSIVVLLGTSFTDWAIGKDMS
FT                   FVGLKNYITLFTEDKTYIESIKTHLFGLCFSLQFTYRLA"
FT   CDS             complement(175544..176887)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02160"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73179"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ90"
FT                   /protein_id="CBK73179.1"
FT                   /translation="MKRKLFRLLAAGLVATSTLSLVACGSAGTATGEGTVEDSQVPTNG
FT                   DGPIEISYATFMVGSHASAEAETEVIEAFNKEYEGKIKVVVEELPSDDAFVDKMKTLAS
FT                   SKSLPDVVIGKNGIRELAIENGQAVDLKPFLEEDAEWMKYVGEDAMNYNMEDDGKVYSI
FT                   SNQRQVVGYFYNKDMFEDAGITPAKTWDEWMSNNEKLSAKGYTPLALMTGENAWTTNLW
FT                   LAAYIGTHGADGNKFMNTTYPESYNTDAVVEGLDLMKECLQKYTTPDAIGAIYANAANN
FT                   FEQGNVAMIANGPWMCPDFTDETKSAPGFQDKVGVALYPEDGLIAQYEVGYILCTNGKS
FT                   EAEQQAALEFLKFKTGKYAQSVFLEKGGVLPLTENVEISDEYKAANPVLAELLEISANA
FT                   KYTFGNLDNNAHESVIDEFAVRYPELAYDEITAEEFATHLTEAANASK"
FT   CDS             complement(176994..178544)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02170"
FT                   /product="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73180"
FT                   /db_xref="GOA:D4IZ91"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ91"
FT                   /protein_id="CBK73180.1"
FT                   /translation="MNNVLIVDDERNIRDGIKALIDWTDLECQVVGDCVNGSQALDFIA
FT                   KNQVDIVVTDIKMPVMDGLTLSKNIREEYPELKVIILTAYSEFEMARAALKNKVFDYII
FT                   KNEFIDELPKTITRCVKVIEEQKKEQASHLIDKDSQEYFFNVLKGLLVSNNISQSDVEK
FT                   YGLDRYNYVICAASIKVYEDNNSDRDMMDILNNILKISLGQCKYSIMPLTENLYTIGVC
FT                   YEKKSGIGINQVVNYFSNILIMIEEFMRIEVMIGISTQIEDVNDLKAGYSNARDALSKL
FT                   TGSGCKLKVYDGDVVSTEGDSIDVTWYSERITEACFDEKKNEAAVILEDFTNKLLLSKL
FT                   TFEQCRLYILVIFSSLIHKAVRYQVNTKLDFNDYEKQVYNSVKNAGTIQDFTVIGTDVI
FT                   NNLREICIGKKNTKNELVGKVDNCIKAHYKEELTLQFISDELFMNNSYISRAYKKVTGM
FT                   TVTEAIAIYRVTKAKELLANTNKKIYEIAQEVGFNDAAYFTNVFYKYTNSSPRDYRQR"
FT   CDS             complement(178549..179808)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02180"
FT                   /product="Putative regulator of cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73181"
FT                   /db_xref="GOA:D4IZ92"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ92"
FT                   /protein_id="CBK73181.1"
FT                   /translation="MQRVLVYNNVWNFDLFDYLTVYENEKLLAYTYTKSYSTQQIIDRT
FT                   GKVFYAVKNDTAYNQMIPPSYEDQTIYTVLKIQSDFDSEDAMYIIGGTSVAGLNERLCS
FT                   MASFEGAKAFLINNKGIVYASTNPEDLGNFLNDQLFYAKGQRAQVRFAGEKYDLIRKRV
FT                   NNDFQILYMFPKQAIMRQTLIGMESLIIVSVIIAVLMVFILTLVESSYEARHLNDEAEI
FT                   KFLQHQMNPHFLFNILLTIQIKAKMSKDESVYKMISSLSSLLRAGIYKDERGLISIEEE
FT                   LKYVEYYLSLQKERYEDKLTYNIIVDDEALKKCEIPRLSIEPIVENAVIHGVEACDRPA
FT                   LVTINVTAEGGDLIIHVTDNGVGFDVDEMDLESESDRVGLRSTQKRIQLIYGKEYGLDV
FT                   VSYKDIGTDIAIRVPQKKWV"
FT   CDS             complement(179751..180110)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73182"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ93"
FT                   /protein_id="CBK73182.1"
FT                   /translation="MKKNWSKLYLKIMVMLMVAFMVYGAIVTFVVYRNVLEENYHSIES
FT                   MLDTGAENINRTFEMMDGTTIALSGSESISKWRNKKHILVPKIKVALCIPKVLTRKCRE
FT                   YLFITMYGILTFLTI"
FT   CDS             complement(180079..180732)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73183"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ94"
FT                   /protein_id="CBK73183.1"
FT                   /translation="MIQTKLFSNFIIRKEVSKNVSGNTVPIDDGYHIQFSGEYLNDGGR
FT                   YILPTTADKMLLRDSAPVEEDPKVIYPLNEHFEPIRCYQYVPEKVYGLGGLEELEWIDF
FT                   INQNATNLTAEMLVNNNRSNGAIIIRPLSSFPRTLIAKRNDGSPMYSVEPCKSRPNSLK
FT                   QKAIDGELQYLLPGEEKESQIAFGFLEEEASIRNFEKLIERAACYEEKLVQAVP"
FT   CDS             complement(180695..181153)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73184"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ95"
FT                   /protein_id="CBK73184.1"
FT                   /translation="MLENVQLKEIKDTYGSSLHELWVDNGKLKFSLIVERGLEIGQVFL
FT                   KGTCMSWDRSDSFKLHPENVELKKEGWDKGFYSAVAVIGPEVFGTPDEVVTVHGTGSYS
FT                   ISDINTLKVDLCGCIISIEVNVSIKGYSYKQIHQKNNDTDKAIFKLYN"
FT   CDS             complement(181147..181785)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02220"
FT                   /product="beta-phosphoglucomutase"
FT                   /EC_number="5.4.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73185"
FT                   /db_xref="GOA:D4IZ96"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ96"
FT                   /protein_id="CBK73185.1"
FT                   /translation="MDIKGFIFDLDGVIVFTDKYHYKAWKTMADEMGIYFDEEINNRLR
FT                   GVSRMESLEIILENYHGEPLSEEKKIELATKKNDIYRNLLETMTRADVSDEVRNTLDSL
FT                   HQKGIKVALGSSSKNAKFILEKVELLDAFDAISDGNNITNSKPDPEVFVKAADFIHLKP
FT                   SECAVVEDAFSGIDAAKSGNMYAVAIGDATNYDKADYKINRFSEILNIC"
FT   CDS             complement(181788..186071)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02230"
FT                   /product="Predicted beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73186"
FT                   /db_xref="GOA:D4IZ97"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ97"
FT                   /protein_id="CBK73186.1"
FT                   /translation="MRKKFLMLALALGLVVTSTPTLTVEAKTTGQYTNPLMNGADPTIV
FT                   RGEDGYFYSGFGTDNDIYIKRSETLLGLSTADSHLVYDNPRTGNPNGNENYFIWGPYIY
FT                   HIDDAWYIYYSSSTENDFGWGHPSCYVLKNDSKDPFEGEWYFPCENTNVDDFEGNESSK
FT                   PGLMNTESYGLACGLLKINGELYYTYTKYDYFANEPGHTKFNECPTIVKMENPYTLTGP
FT                   ECTVARPTYKWELQGDNIDEGCAYVEHDGYGYFAHSSSSFMNDNYCVGLSVIDLSTDVM
FT                   DENNWKKSTTPIMSRSDENASFGPGSPLFVKSPDGTEDWLIYHGGPIGGQTSTDRRVRA
FT                   QIINWTDDGQINLGIPSNPDTVLDAPSGEMKTDVYEAEDAICSSVTKQMFNNTAKASGS
FT                   GYVKYDQKKGYVEFEVDAAETGDYILNLRYNNLGEAVTADVKVNDDNYTASFKKNGNYA
FT                   VDLDTAKVYNVRLNQGENKVRISVDEASDFALDAMVITKGHMYDGSGVANISVNAPYTG
FT                   SYQVLFEGADGNAIKNINLTKGSNVINNPDGKYDKVSVCETLTSTYYVNGSEASVHVES
FT                   EGIYDITYTTEEGKITVAKKLDKGENTIPVVEGTTKLHLSRRIPWHYQAEHGEFTGMGD
FT                   KKSDHLYYNGSGFVGGFENIGNSVKINTSVANSGTHTLSIRYSGTGDEKSLSLYINGSK
FT                   VKQLVTEGTVDWDSWNEIDEEVYLRAGKNIVELRRDEEDTGAVNIDEIVVDKYAMGEPT
FT                   ATVNKLIAGEVYVIKDTNSGLSADIDGYSPDAGKEIHLWHYLENNNQKWKVIDLGNGYW
FT                   AFKATYGSKRFGINENLTAMTFPEGSTDDAVQWKLEKVGRNYKLINKKYNKVLTVENGS
FT                   KIAGARLTVAEDEGLDNQIFSIDGGLFHDVTEVRDIQNPQNPDDYAAYGSQYELADPKV
FT                   PEPYDPYEQIDNGKYRRYDGANCLLESGARIETDHNGYYGQGFVGGMYNGDARLTFRVN
FT                   VDASGQYKVRLGYCNGFGADQEKVAATYVNGEYIGATELPGTGGWDDWGTIEFILNLHE
FT                   GVNQISFRNNAEIAGHSGDVNYDYLDISKYPVVVDADETEYELSEDKIIKHYELENVNL
FT                   ENGARLERDHNDYSGDGFVGGMYNGSAKIIVNVNVPESDTYKMILRYCNGHGEDVAEKV
FT                   SALTVNGEYIKGIELPKTGTWDDWSTVEFDVELNKGTSAIAFVNSSSLTGYAGDVNYDY
FT                   LDFYMNEPVEEAEPEEPTEPEEPAEPEEPTDPETPTDPETPTDPETPEKPETPSKPAEP
FT                   AKPGKPSTPQNPSGQQPTGNAASSNRTQTPATEQYTVPVATIPDVAVPTTGKKNPSTHT
FT                   IAATKPNENESASEPAEEANEEATEEVVEEDLAETPESVIVDDEEVPTTVSTEKSAPIV
FT                   PIAAGVIAAGAIGAAGLYIFRRRRL"
FT   CDS             complement(186287..187879)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02240"
FT                   /product="Protein of unknown function (DUF3298)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73187"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ98"
FT                   /protein_id="CBK73187.1"
FT                   /translation="MKRINALLIIACMAISATGCKNTDSSLAIQEEPANTVSQEVEEAP
FT                   QQSSTLRPEIYSSKEYIFEEAYVDGVYSDPYLTGHYDMYELSKETKEAYPALATAIEDS
FT                   MNARKKKYDDIHAEYLDSSKQLREGGEVNTFILDSDLFLRRADEKVISYVDQRTEYAAG
FT                   AHGFTRYESYNFDVQSGKEILLADIVTDKEAFQGKLAQALTEKYGASTFNDLDGNLADL
FT                   SLDYYTWAFDANGITFYLNDFAAYAAGIITANLPYDSSFFTQDYMLNSNEGYISEIPLY
FT                   FPDSNHIDIVDTMDEGISISPNYDSENPDLFWIQSLNISKDGQSFTTDDLYVWKVDAYI
FT                   IHLPDGTENLMLMTTGDNDFNCSYVYSLDGQIKLLSNDYFARGRVGAGDDYHEIVPADS
FT                   AKVAFANRFDMLSTFDGTKYYSLESDGTFTPLDKYYKTSRSNEQDLVSKMELTVPVVDE
FT                   AGDETGEEVTLPSGTHYSIIRTNGKDEVDCTIEDGRIIRFHLQDSLGEGYISDIEINGV
FT                   NAEDIFETLWYAG"
FT   tRNA            complement(187955..188040)
FT                   /locus_tag="CIY_T_35400"
FT   CDS             complement(188368..189390)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02250"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73188"
FT                   /db_xref="GOA:D4IZ99"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZ99"
FT                   /protein_id="CBK73188.1"
FT                   /translation="MLYFSCDYAEGCHPKLLEALSNTNMVSTPGYGEDDFCKSAKDKIR
FT                   KYIDCPNADIYFLVGGTQTNQVVIDSMLSNYDGVVAASTGHVAVHEAGAIEYSGHKVIT
FT                   LPGHEGKIDSKELKQMLVDHYADDSAEHMVNPGMVYISYPTEYGTLYSRQELEAISSIC
FT                   SEYDIPLFIDGARLAYGLAAQNDLSMSDIASYADVFYIGGTKVGALFGEAVVFSKGNTP
FT                   KHMITQIKQHGALLAKGRLLGVQFDALFTDDLYMEMGAHAIKQASIIREDLRNKGYNLF
FT                   MENPTNQIFVIMENNALKAFGEKVAYGFWEKYDDNHTVIRIATSWATSDEAVEALKKIL
FT                   "
FT   tRNA            complement(189573..189658)
FT                   /locus_tag="CIY_T_35390"
FT   CDS             complement(189823..190512)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02260"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73189"
FT                   /db_xref="GOA:D4IZA0"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA0"
FT                   /protein_id="CBK73189.1"
FT                   /translation="MNKFTAIVLAAGSGKRMEQEIPKQYMKLGDAPLMVHCLRTFQESK
FT                   VNQIVLVVAPGDIEKCQREIIQRYGITKCIAIVEGGEERYDSVYAGLKAIDDGYVLIHD
FT                   CARAFVTIDIIHRCMSAVALYESCVVGMPTKDTVKITDDHRKVLDTPDRSNVWIVQTPQ
FT                   CFEYNLIRKAYDIVIANADTSITDDAMIVEKATDHDVHMIQGSYLNIKVTTPEDIAFGE
FT                   AILKNKR"
FT   CDS             complement(190512..191537)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02270"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /function="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73190"
FT                   /db_xref="GOA:D4IZA1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA1"
FT                   /protein_id="CBK73190.1"
FT                   /translation="MDTKEIKILAIESSCDETAAAVVVNGRDVRSNVISTQIPLHTLYG
FT                   GVVPEIASRKHIERINQVIEQALEEADMGLEDLDAIAVTYGPGLVGALLVGVAEAKAIA
FT                   FAQGLPLVGVHHIEGHISANYIENKELKPPFLCLVVSGGHTHLVRVADYGKYEILGRTR
FT                   DDAAGEAFDKVARAIGLGYPGGPKIEKAAHEGNPFAIQFTRPKVSDGVYDFSFSGLKSQ
FT                   VLNYINGAQMKGETVNEADIAASFQQTVIDTLCEHAALAIDEFGMDKFAIAGGVASNQT
FT                   LRAAMEKMCKEKGVEFYHPSPILCTDNAAMIGAAAYYEYLAGRRDSWDLNAIPNLKLGE
FT                   R"
FT   CDS             complement(191527..192111)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73191"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA2"
FT                   /protein_id="CBK73191.1"
FT                   /translation="MKKVLRIGIAVICMVCLVVGYYTYLSRRNASAKADEKVELSEVQA
FT                   IISKNFKNDYPATPRAVVKWYNRIITAYYAEEFDQGQLEKMADQARALMDDELLSYNPK
FT                   DTYIASLNMEIEDYHNRSRTIVSSTVSDSKEVRYKTVNGYECAFVSTYYFIREGSSYTR
FT                   TYEDFCLRKDKNGDWKILTWRLSTEDEVNGY"
FT   CDS             complement(192113..193024)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02290"
FT                   /product="RNAse Z"
FT                   /function="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73192"
FT                   /db_xref="GOA:D4IZA3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA3"
FT                   /protein_id="CBK73192.1"
FT                   /translation="MLDVCLLGTAGMMPLPNRWLTSCLFRFNGEGLLVDCGEGTQVALR
FT                   EAGFSPNPISIICLTHYHADHVSGLPGFLLSMGNSDRTEPITIIGPKGLERVVNSLRVI
FT                   APELPFEIKFHEITEADEYIELLGYHIHAFKVNHNVLCYGYTIDIPRKGRFDVDAAKAL
FT                   GLPVQLWNPLQKGQTVEYEGNTFTPDMVMGDARRGIRVTYCTDTRPTKSLVEASKEADL
FT                   LICEGMYAEEDKLVKAKQNKHMTFYEAAKVAKDAEVKELWLTHFSPSLTGHKRYMKAVC
FT                   DIFPQAKLGEDGKFLELDFAEE"
FT   CDS             complement(193134..193574)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02300"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73193"
FT                   /db_xref="GOA:D4IZA4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA4"
FT                   /protein_id="CBK73193.1"
FT                   /translation="MAFTYRFAKEQDLSTIVEIENASMSCPWSLKSFQEAITSDHAFIM
FT                   VAESEGQIAGYSVFYLTPPESELPDIVVDEKYRGQGLGRLLMEKSIQELESRGVDTVFL
FT                   EVRVSNTPARALYEHIGFEEIGVRKYFYSNPVEDAVCMSLHI"
FT   CDS             complement(193574..194284)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02310"
FT                   /product="Inactive homolog of metal-dependent proteases,
FT                   putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73194"
FT                   /db_xref="GOA:D4IZA5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA5"
FT                   /protein_id="CBK73194.1"
FT                   /translation="MKILGIDGSGLVASVAIVEDDNLIGEYTTGYKKTHSHTLLPMLDE
FT                   LKKMVELDLNSLDAIAVAAGPGSFTGLRIASATAKGLGLSLGCPIVSVPTVDALAYNMW
FT                   GNDGIICPILDARRGQVYTGLYQFEQSGDFTVLLQQCAVDFNEIAEKINEKGLPVTFLG
FT                   DGVPVFKDKIEEIIKVPYRFAPAHLNRQHASSVAALGSIYYANGDCEIAADHRPEYLRL
FT                   SQAERERMEKEGKA"
FT   CDS             complement(194288..194719)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02320"
FT                   /product="conserved hypothetical nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73195"
FT                   /db_xref="GOA:D4IZA6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA6"
FT                   /protein_id="CBK73195.1"
FT                   /translation="MIEVFETNSPEETDALGRKLSESATPGQVFTLIGDLGVGKTVFTQ
FT                   GFATGLQIDEAICSPTFTIVQVYDTGRLPFYHFDVYRIGDVEEMDEIGYEDYIYGDGVS
FT                   LIEWANLIEDILPEHYTQITIEKDLEKGFDYRKITVEEK"
FT   CDS             complement(194716..195213)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73196"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA7"
FT                   /protein_id="CBK73196.1"
FT                   /translation="MDNISFETQIKEADLFKFNWHHALTQRIFSVTMAGLLLVVLALRF
FT                   NTLPVFWRLAYLAFAAIILFYMPLTLKSKAKLQMQQEVFKHPINYQLKESGLVVSSPAA
FT                   EEPAELPWEYVYQVSTWKNYLLIYSNRVNAYIIPKEDIGDVYDPAINYIKNHVEDYKLK
FT                   IK"
FT   CDS             complement(195476..197635)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02340"
FT                   /product="Transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73197"
FT                   /db_xref="GOA:D4IZA8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA8"
FT                   /protein_id="CBK73197.1"
FT                   /translation="MDITKKIATELQVRPQQVEAAIGLLDEGNTVPFISRYRKEATGGL
FT                   NDEQLRALSERLTYLRNLEDKKATCLASIEEQGLLTEELKKAILEAETQVAVDDLYRPY
FT                   RPKRRTRATIAKEKGLEPLANIIILQMTDKSLEEEAKAFINPEKEVNTPEEAIAGACDI
FT                   IAESISDDADYRTWIREKTFKFGRIVSKAKDPEAESVYENYYDYDEAIAKLPGHRILAL
FT                   NRGEKEKILKVSIEAPVEDILNYLEKKIISRDNVNTNQALINTIEDAYSRLIAPSIENE
FT                   IRNNLTEMAEDGAIKVFGKNLTQLLMQPPIAGRNVLGWDPAFRTGCKIAVVDATGKVLD
FT                   TTVVYPTAPQNKVEETKKVIKSLIKKYNVSLISLGNGTASRESEQIIVDMLKEIPEKVE
FT                   YIIVNEAGASVYSASKLATEEFPNFDVGQRSATSMARRLQDPLAELVKIDPKSVGVGQY
FT                   QHDMNQKKLDETLAGVVETCVNAVGVDLNTASASLLEYVSGINKTLAKNIVEYRETNGR
FT                   FNSRAELKKVPKLGPKAFEQCAGFMRITGGKNPLDATAVHPESYDAAKALLEKLGFNTK
FT                   DIAAGTLKDIHKSISDIKALSTELGVGEMTLEDIVKELEKPGRDPREDMPKPILKSDVL
FT                   EMKDLKPGMQLKGTVRNVIDFGAFIDIGVHQDGLVHISQMTDRYIKHPLEVVSVGDIVD
FT                   VEVISVDEKKGRIALTMKLNKSKEK"
FT   CDS             complement(197645..198694)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02350"
FT                   /product="Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73198"
FT                   /db_xref="GOA:D4IZA9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZA9"
FT                   /protein_id="CBK73198.1"
FT                   /translation="MKKRIIGLDILRDIGVIFIFFYHFFVEYIVTAGGTDGAMFGYNYF
FT                   FNILARPASLFLFVISGYALMYNHEDELPLGKYYLRRFKGLFIPFYVAYTLMFVVTFLV
FT                   NNQVVGHDIPFNRFVLTILGLDGVGQLVTVDFYLIGEWFMSCIVICYAVFPFLAKLLKK
FT                   YKLVTLGVLLVWYIVVLLIYNPFPFTQLMNPLFIIVYFYIGMLLQQQLGDEKINTKLRL
FT                   VCAVLSALIFIYFCLIGFVPSLEWMKLTQEQNELIYFAISMTMLVALRDVEIPSDKFVY
FT                   TLITYISGISWYVILLHHRIMILFYSHLSVEAYNHREIFALLLACIFITWSASILVRNL
FT                   SSRVKKIFK"
FT   CDS             complement(198832..199419)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02360"
FT                   /product="ribosomal protein L25, Ctc-form"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73199"
FT                   /db_xref="GOA:D4IZB0"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB0"
FT                   /protein_id="CBK73199.1"
FT                   /translation="MDTYKVQRRDMEKKAKRLRREGYVTGNLFGRDIEQSIPLQFEVKE
FT                   AEALRKSKHTQMTLDLEGKKYNVLLKELHFDAAKHQIVEMDFQELVKGEVIHATAEVVL
FT                   ENKEAVTEGVLEQLVSEVAYKAKAEDVVEKIEIDCSSLRLGDTITVADLAIAKNKKVEV
FT                   TTRADQVVVEVIAAKNKVEDAEEEEDSTQAAS"
FT   CDS             complement(199623..199988)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02370"
FT                   /product="Uncharacterized protein with conserved CXXC
FT                   pairs"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73200"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB1"
FT                   /protein_id="CBK73200.1"
FT                   /translation="MEKRELTCIGCPMGCQITVELENGEVLSVTGNTCKIGENYAKNEV
FT                   THPERTVTSTAVILGGDKPRVSVKTKSNIPKDKIADVMKEIDAAVMQAPVHIGDVVVKN
FT                   VCETGVDVVATRNVEAL"
FT   CDS             complement(200009..201271)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02380"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73201"
FT                   /db_xref="GOA:D4IZB2"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB2"
FT                   /protein_id="CBK73201.1"
FT                   /translation="MLNYDIVIVGGGPAGLAAAVAARNAGVDKILILERDKELGGILNQ
FT                   CIHNGFGLHTFKEELTGPEYAYRFIEKVLDAKIEYKLNTMVMDISNDRVVTAMSREDGM
FT                   YQIKAGAVILAMGCRERPRGALNIPGYRPAGIFSAGTAQRLVNIEGYMPGREVVILGSG
FT                   DIGLIMARRMTLEGAKVKVVAELMPYSGGLKRNIVQCLDDFGIPLKLSHTVVDIEGKEH
FT                   LTAVTIAAVDNKGKPIPGTEERYTCDTLLLSCGLIPENELSRNAGVEMSPITSGPIVNE
FT                   SLETNIPGVFACGNVLHVHDLVDYVSEEADRAGQNAAKYVKGELSDGAADVEIVATEGA
FT                   RYTVPSTINVDRMDDKLTVRFRVGAVYKDSYVSVYFDDERVMHNKKRIMAPGEMEQVIL
FT                   LKDKLAEKPGLKKITVKIEAE"
FT   CDS             complement(201271..202731)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02390"
FT                   /product="Predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73202"
FT                   /db_xref="GOA:D4IZB3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB3"
FT                   /protein_id="CBK73202.1"
FT                   /translation="MLYDVIIIGAGVSGSAIARELSRYEANVCVLEKCEDVCEGTSKAN
FT                   SAIVHAGFDAAAGSLMAKLNVRGNEMMDDLCRDLDIPFKRNGSMVVCIHKEALPGLQDL
FT                   YDRGIKNGVKGLKILTREEALEMEPNLSDNVEGALYAPTGGIICPFKLCIAMAENANVN
FT                   GVDFRFNTKVENIVKDEDGLWHIRTNNGEYVSRYVVNAAGVYSGVIHNMVSKPDDKIEI
FT                   IPRRGDYCLLDKEVGGHVSHTIFPQPTNLGKGVLVSPTVHGNLIVGPTAIDIDDKEGTN
FT                   TTADGINDLIAKANDHVKNLPMRKVITSFAGLRAHEARHEFIIGEVDGAPHFIDCAAIE
FT                   SPGLTSSPAIGEMVANMLKDMMGLTPKANWISTRKDVMNPENLSVEERNELIKKNPAYG
FT                   NIICRCESISEGEILDAIHRPLGARSLDGVKRRTRAGMGRCQAGFCSPKTMEILHRELG
FT                   LKYEEITKSGGRSNIVMERTKNQKGGEQ"
FT   CDS             complement(202847..203569)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02400"
FT                   /product="Glycerol uptake facilitator and related permeases
FT                   (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73203"
FT                   /db_xref="GOA:D4IZB4"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB4"
FT                   /protein_id="CBK73203.1"
FT                   /translation="MSVYLGEFIGTILLVLLGDGVCCNVSLNKSGFKGGGAVHILIGWG
FT                   MAVMVPAFAMSNFTGCPSAFNPAVTIGIAIRSGDWSTVPGQIVAQMLGGFVGAAILIFL
FT                   YGDHIRETADDAVVRGCFCTAPSIPNQVKNFASEFCATFVLVFTLALIPAGEDRTVWIL
FT                   VYGVIVACGASFGGLTGYAMNAARDTAPRLAYLCLAPNFGKKDGNWSYGWIPAVAPICG
FT                   GVVASLLYNALAAAQMFG"
FT   CDS             complement(203597..205096)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02410"
FT                   /product="glycerol kinase"
FT                   /function="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73204"
FT                   /db_xref="GOA:D4IZB5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB5"
FT                   /protein_id="CBK73204.1"
FT                   /translation="MAKYVMALDAGTTSNRCILFNEKGEMCSVAQKEFTQYFPQPGWVE
FT                   HDANEIWQTQLSVAREAMRKIGATSDDIAAIGITNQRETVIVWDRATGQPITHAIVWQC
FT                   RRTADFAEQMKGKVPGIVEKFQQKTGLKFDPYFSGTKIRWILDNVEGARARAEKGELCF
FT                   GTVDSWLIYKLTKGKVHVTDYSNASRTLLFNINTLEWDDELCQILEIPKSMLPEAKPSS
FT                   CIYGETDPEFFGGPIRIAGAAGDQQAALFGQTCYKEGEAKNTYGTGCFMLMNTGEKPIF
FT                   SKNDLLTTIAWGLDGKVTYALEGSVYVAGAAIQWLRDELKIVDSSPDSEYFATRVKDTN
FT                   GCYVVPAFTGLGAPYWDPYARGAITGLTRGVNKYHLIRATLESLAYQTYDVLHAMELDS
FT                   GKHLTALKVDGGASNNNFLMQFQSDIINTDVLRPSCVETTAMGAAYLAGLAVGYWKSKE
FT                   DVIKNWSVDREFKPEMTDADRTAAIKGWSKAVAATRGWAKE"
FT   CDS             complement(205162..205740)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02420"
FT                   /product="Glycerol-3-phosphate responsive antiterminator
FT                   (mRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73205"
FT                   /db_xref="GOA:D4IZB6"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB6"
FT                   /protein_id="CBK73205.1"
FT                   /translation="MHRDFIEKLEMNPVIAAIKDDKGLEKAIGTDCEIIFILYGDVCTI
FT                   PSIVERIKSADKLAMVHIDLVTGLNNSKEISVDFIKNNTQADGIITTKGNLIGRAKELG
FT                   LYTVLRYFVIDSMALVNIEKQDRHGITQPDVIEILPGILLPKIIKRVNQASRVPVLAGG
FT                   LIGDRDDVMNALNNGVLAVSTTNEKVWEL"
FT   CDS             complement(206116..206592)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02430"
FT                   /product="phosphoserine phosphatase
FT                   /phosphoserine:homoserine phosphotransferase"
FT                   /function="phosphoserine phosphatase"
FT                   /function="phosphoserine:homoserine phosphotransferase"
FT                   /EC_number="2.7.1.39"
FT                   /EC_number="3.1.3.3"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73206"
FT                   /db_xref="GOA:D4IZB7"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB7"
FT                   /protein_id="CBK73206.1"
FT                   /translation="MNYRIGILKEHGLGLREIQDTIATIDPLPGAKEFLDKLRAFGQVI
FT                   IISDTFSQFAGPLMAKLGMPTIFCNELIVSDDGEITGYKMRCEKSKLTTVKALQSCGFE
FT                   TIASGDSFNDLAMIEASKAGFLFRTTDAIKKDYPQYPAFEEYDDLYNAIVEAQK"
FT   CDS             complement(206612..206716)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73207"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB8"
FT                   /protein_id="CBK73207.1"
FT                   /translation="MFVTCLDLEGVLVPEIWIAFAEATGIPELKNNKR"
FT   CDS             complement(206729..207925)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02450"
FT                   /product="homoserine dehydrogenase"
FT                   /function="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73208"
FT                   /db_xref="GOA:D4IZB9"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZB9"
FT                   /protein_id="CBK73208.1"
FT                   /translation="MKAAIMGYGTIGSGVAKVLETNKDILAARIGEPLELKYILDLRDF
FT                   PGDPYEKCFVKDYKEIVKDKDVKIVVETMGGVEPAFIFVKAMLEAGKSVTTSNKALVAD
FT                   KGAELMEIAEKHNVNFVFEAAVGGGIPIIRTLTACLTGDVIEEIDAICNGTTNYMLTNM
FT                   EQFGSDYAEILAEAQSLGYAEKDPTADVEGFDSCRKIAILTSLVTGKNVDFNDIPTEGI
FT                   SKISSTDFKYAKAMGRSIKLIARSVKVGDKYACRVAPYLVKPDNMLYHVAGVMNAVSVK
FT                   GNMLGESMYYGAGAGALPTASAVVGDMVFLAKNINKYVKIGWTSEKYQLANPADEKFRY
FT                   FVRTSALQSNIENEFDNVEYASLDLDEEVGFITSEMTEHEFNERKAALGGIISVIRLA"
FT   CDS             complement(207933..208376)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02460"
FT                   /product="ACT domain-containing protein"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73209"
FT                   /db_xref="GOA:D4IZC0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008310"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC0"
FT                   /protein_id="CBK73209.1"
FT                   /translation="MAEKTTYFVLKEKAVPEVLLKVVAAKKLIDTGKCDSVQEATEKVG
FT                   ISRSSFYKYKDDIFPFHEDIKGKTVNMVIQLEDEPGILSRVLDEMAHFHVNILTIHQSI
FT                   PVNGFATLTISVDVLEDSGDFADLVSAIEAVDGVHYVKILARE"
FT   CDS             complement(208477..209493)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02470"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /function="bacterial peptide chain release factor 2
FT                   (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73210"
FT                   /db_xref="GOA:D4IZC1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC1"
FT                   /protein_id="CBK73210.1"
FT                   /translation="MEAPDFWTDAQVSTAKMKELKSMKDDVAVIDKLEDLYKEIEDYIE
FT                   LGNEEEDQEIVDTVALLIEEFENDLESLRMKTLLSGEYDSDSAIVTLHSGAGGVEACDW
FT                   VQMLYRMYSRWASDMGFAVDELDYQEGDEAGIKSVTFQVNGDNAYGYLKSEKGIHRLVR
FT                   ISPFNAQGKRQTSFASCDVMPDIEEDVDVEIRDEDIRIDTYRSSGAGGQHINKTSSAIR
FT                   ITHFPTGIVVTCQNERSQFQNKDKAMQMLKTKLLLLKQEENAAKASGIRGEVSEIGWGN
FT                   QIRSYVLQPYTMVKDLRTGEESGNADAVLDGKLTPFMNAYLKWLSLGCPDRGNLADD"
FT   CDS             complement(209632..210924)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02480"
FT                   /product="C-terminal peptidase (prc)"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73211"
FT                   /db_xref="GOA:D4IZC2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC2"
FT                   /protein_id="CBK73211.1"
FT                   /translation="MYEEQNERKEVVDPGVVNYYYEEKPQKKTKKWPYFLVGFICLVLG
FT                   CCITLIAGLMVIGSRVSFSDETSSEVLESLQEGGADNSKFSTIIDIIETYYYKDVDDDT
FT                   LVNGVYKGVVKSLDDPYSEYYTAEEYEDLMTTLTGNYAGIGALLQKNAETGAVSITKVY
FT                   KDTPAEKAGLLAGDIIVSADGFAGTDEGLDTFVQHIRGEAGTDVELVILRESEELKIVC
FT                   TRAAIATPTVEHQMLEGNVGYIAVSQFTEHTYKDFVEAYKDLEKQGMTSVIFDMRNNGG
FT                   GLVDSVVEMLDYLLPKGTVVYTMDKAGHREDYLSDDASSKDIPIVVLVNENTASAAEIF
FT                   TGAIRDFNYGTIIGTNTFGKGIVQSTIPLTDGSALKLTTQTYYTPNGESIHGKGIKPDI
FT                   ELEYEFQGGEDDAYSVDLDNQIQKALDVLSK"
FT   CDS             complement(210989..211486)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02490"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73212"
FT                   /db_xref="GOA:D4IZC3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC3"
FT                   /protein_id="CBK73212.1"
FT                   /translation="MQPTLVSFLEGLDGVRQVNQSEVAAKTLTDINKAITIVSMAIVII
FT                   LLAVSVFLISNTVMVGISVRREEIAIMKLIGAKDAFVRAPFVVEGIFIGLIGSIIPLVL
FT                   LFLIYEKVIEYASSEFNFLSNMVSFIPVETIFRTLVPISLLLGIGIGWFGSRVTLHKHL
FT                   RV"
FT   CDS             complement(211642..211896)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73213"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC4"
FT                   /protein_id="CBK73213.1"
FT                   /translation="MKISTHIYNLGQGLKNVWRNKMFSLASIATMTACIFLFGIFYSLG
FT                   TNFQSMVKTAEEGVAVTVFFDEGISQQRIDEIGKEIKNV"
FT   CDS             complement(212597..213685)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02520"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /function="transcriptional regulator, CdaR family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73214"
FT                   /db_xref="GOA:D4IZC5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC5"
FT                   /protein_id="CBK73214.1"
FT                   /translation="MISNQIMQNTLEGLHQLTKIDLAVMDSDGVMCAATFGDTTQYSDA
FT                   VAVFAASEAESQVALGCHFFKVFDDQQLEFVVLAVGDSEEASTIGKIAAFQIQELMIAY
FT                   KERFDKDNFIKNLLLDNLLLVDIYNRSKKLHVDINARRVVMIVEVGPEKDGDELDRVRS
FT                   VFGGKNKDFVTAVDERNIIVVKELGENDSNNEIDKIAAVIIDAFHDKDTKKVRVSYGTV
FT                   VGEIKEVSRSYKEASMAMDVGKIFFNDQNVIAYSQLGIGRLIYQLPIPLCKMFISEIFE
FT                   NKSPDDFDEETLTTISKFFENSLNVSETSRQLYIHRNTLVYRLDKLEKSTGLDLRVFED
FT                   AITFKIALMVVKYMKYMESEKY"
FT   CDS             complement(214304..215518)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02530"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73215"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC6"
FT                   /protein_id="CBK73215.1"
FT                   /translation="MNIKLTKAVSYTIAACVVASAISLTSDAASATSGVSALSSATGVL
FT                   ETTSYTAFAGVQLTVNDMLANATAISTETQLADNGADAVAAADNPYANIAIAQVDNYVY
FT                   IRETASAESEYVGKLYNNSAATVSDTVEADDGTWLLITSGDVTGYVKSEYVVQNDEELA
FT                   KQVSKRLATVTTTTLHVREAASTDSAVIDLLPIGDDLVVIDESDADNGWVKVTCNEGEG
FT                   YVSTDYVNISTDFTVAESKAAEQARIAKEEAEKKAAQEAARKATAAASKSSKSSSSSGS
FT                   SGKSYSAPSGSGGGSVVSYGSQFVGNPYVYGGSSLTNGTDCSGFVMSCYSAFGVSLPHS
FT                   SSALRSAGYGVSYDEMQPGDIVCYSGHVGIYAGNGTLLHASNKRTGITYSNVNYKKILA
FT                   IRRIF"
FT   CDS             complement(215672..216583)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02540"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73216"
FT                   /db_xref="GOA:D4IZC7"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC7"
FT                   /protein_id="CBK73216.1"
FT                   /translation="MIYDVIVVGAGPAGLAAAIYGKRAGRNILVLDTSSFSGGQILSTY
FT                   EIDNYPGMPGISGEDLASAMRSHCEKLQVEFARGRVTSIEDKGTTKELITKKATYETKT
FT                   VVIATGASNKKLECPGEEELSGVGVSYCATCDGAFFKDKIVAVVGGGDVALEDAIYLAR
FT                   FCSKVYLIHRRDEFRGAVVLQEQVKSSDKIQILFDSTVEEIIGQDKVEGINIKNKNTDQ
FT                   IERIDLDGVFIAVGNIPNTGSIKGLPKQDEAGYIIAGETCETSVPGIYAAGDVRTKQLR
FT                   QVITATSDGANAITSIEKYLQN"
FT   CDS             complement(216602..216979)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02550"
FT                   /product="endoribonuclease L-PSP"
FT                   /function="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73217"
FT                   /db_xref="GOA:D4IZC8"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC8"
FT                   /protein_id="CBK73217.1"
FT                   /translation="MKNVISTDKAPAAIGPYSQAIEVNGMVYTSGIIPVDPATGVIPEG
FT                   AAAQADRVFKSMSALLEAAGTSMANVVKTTVFIKNMDDFAAINEVYAKYFPEPFPARSC
FT                   IEVARIPKDVLLEAEAIATKN"
FT   CDS             complement(217067..217858)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02560"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73218"
FT                   /db_xref="GOA:D4IZC9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZC9"
FT                   /protein_id="CBK73218.1"
FT                   /translation="MKLGEIQKLKIEKKVEFGVYLSDGEDRVLLPKKQVPEGAGIGDEV
FT                   TAFVYKDSKDRLIATTNMPKLTLGQYGVLSVSQVNKVGAFLDWGLEKDLFLPFKEMTRQ
FT                   PSEGDEILVRVYIDKSERLCASMKGIYELLSKKPPYQVGDEVEARIYEFGHDFGTFVAL
FT                   EDKYSSMIPRHEDVSKYRIGDVIMVRITGIKEDGKCDVTIRDKAYVQMEDDAEAILELI
FT                   DSYAGVLPFSEKASPEVIKRETGLSKAAFKRAIGRLYKERK"
FT   CDS             complement(217858..218556)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02570"
FT                   /product="Acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73219"
FT                   /db_xref="GOA:D4IZD0"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD0"
FT                   /protein_id="CBK73219.1"
FT                   /translation="MYQFNSRVSYSEVDSNLNLTYFDLVNYLQDCSCFHSDDVGVGVFY
FT                   LAPQGLGWFVTSYDIHINRMPKYMERIVIKTYPYQVRGMLARRIYTIETENGELLVYAD
FT                   SLWVLMDLKNQHPARLTEKMIEAYPEDPDRPEFSFNRSKLKYNGEGQQVGTFIVNEIHL
FT                   DTNSHMNNSYYIDVTRRFLPREDFSTITVNYKKAALLFDELQVYLVELEQGYQVVLKKD
FT                   DEIYTIVEYK"
FT   tRNA            complement(218624..218695)
FT                   /locus_tag="CIY_T_35380"
FT   CDS             complement(218794..219321)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02580"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73220"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD1"
FT                   /protein_id="CBK73220.1"
FT                   /translation="MERKEFWDARHNCSAFVIGTNNEITRCNDDGEPAQTAGRPMLDVL
FT                   LRENIHNCVVVVTRYFGGVLLGTGGLVRAYQAAVQEGLKNCQILSPKNGRECSITTDYN
FT                   GYGKIEYVLREKNLPILNTDFGADVKISSVAPTEMVENLNTIIADKTAGNAVITWDDEI
FT                   KYDILNGQILKF"
FT   CDS             complement(219287..219445)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73221"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD2"
FT                   /protein_id="CBK73221.1"
FT                   /translation="MSEKEFRIIYKGATGEIEEKKSRFIAHIAPVTSEEEAVQFINGKK
FT                   RILGRQT"
FT   CDS             219525..220313
FT                   /transl_table=11
FT                   /locus_tag="CIY_02600"
FT                   /product="Transglycosylase."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73222"
FT                   /db_xref="GOA:D4IZD3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD3"
FT                   /protein_id="CBK73222.1"
FT                   /translation="MNYGKENAAKQSAKLAGRSKRKRHSAGLAIIRITLICIVSVIVAS
FT                   GVFAYLYAKNLIDQLPDVSTIDISPTGYMSKVYDSDGNEIETLASTGANRTYVTLDQIP
FT                   EDLQHAFVAIEDSRFYEHNGIDPQGIIRAGVDGILSGFHFSQGASTLTQQLLKNNYFTT
FT                   WTSEHTKMDSINRKIQEQYLAVQLEKIVKKSVILENYLNSINLGQNTLGVQSAAERYFN
FT                   KPVSELTLSESAVIASITQNPSKYNPITHPEENAKRRKNV"
FT   CDS             220319..222106
FT                   /transl_table=11
FT                   /locus_tag="CIY_02610"
FT                   /product="Membrane carboxypeptidase/penicillin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73223"
FT                   /db_xref="GOA:D4IZD4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD4"
FT                   /protein_id="CBK73223.1"
FT                   /translation="MLDQGYITKTEYETALADDVYDRIQVLNTELSTSSTSYFVDALTD
FT                   EIVVDLQEKLGYSESEAYSLLYSGGLSIYSTQDSNIQSIVEEEINNTDNYNKLEKVSFS
FT                   YRLTINKADGSTKNYSDVTMLSYYQASNKNYNLEFDSEEAAAEAIEQYKAAVMEEGDEI
FT                   GGESVTYTLQPQAAMTIINHSTGEVAAMVGGRGDKTAAKTLNRATGITRQPGSTFKVIA
FT                   CYAAALDAGGMTLASVENDMPTTYRDGTSLKNYNNAYLGWTNIRTAITHSINVVTVEVM
FT                   GDIGTSLGFQYAKDLGITTLTDGDNNQALALGGITKGVTNLDLTTAYATIANGGEYNKP
FT                   IFYTTVVDHQGNIILDNRDNTSERILKPTTAWLLTSAMQDVMTSGTGKVASFEGMAVAG
FT                   KSGTTTKNRDTVFAGFTPYYTGVIWGGYDDNTPQSYTTYSKVIWKAVMSRIHKNLAYKN
FT                   FTQPSGIVTATVCKKSGKLAVPGVCDCDPRGSQVYTEYFEEGTEPTEYCDKHYLGNVCI
FT                   QSHMFANSECPHYSGVFIIGAGPGSQDEPYGVDPATFGQYCPYHGGEQLPNSGTFGGSA
FT                   GGTTETTSDGVKIQVVGGD"
FT   CDS             complement(222223..224343)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02620"
FT                   /product="Uncharacterized protein related to glutamine
FT                   synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73224"
FT                   /db_xref="GOA:D4IZD5"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD5"
FT                   /protein_id="CBK73224.1"
FT                   /translation="MEQYFNVADIFGENVFNDTVMQERLPKKTYQRLKQTISEGKELDL
FT                   ETADVIAHEMKEWAIEKGATHYTHWFQPLTGITAEKHDSFISAPLPSGKVLMSFSGKEL
FT                   IKGEPDASSFPSGGLRATFEARGYTAWDPTSPAFVRQDAAGATLCIPTAFCSYTGEALD
FT                   QKTPLLRSMEILSEQAIRLLRLFGNTTSQRVTPSVGAEQEYFLIDREMYLARKDLMYTG
FT                   RTLFGAMPPKGQEMDDHYFGAIPERIEAYMRDVNIELWKLGVSSKTQHNEVAPAQHELA
FT                   PIYAQCNVAVDHNQIIMETLRKVANRHGLQCLLHEKPFSGVNGSGKHNNWSLVTDDGIN
FT                   LFEPGKSPHENIQFLLVLCLVLKAVDRHADLLRESASDVGNDQRLGGNEAPPVIISVYL
FT                   GEQLEDVLTQLISTGTATKSKKGEKLATGVRTLPDFRKDATDRNRTSPFAFTGNKFEFR
FT                   MPGSQDSVGEPNVVLNTIMAEALCEACDVLEKAKDFDAAVHDMIKKLATEHQRIVFNGN
FT                   GYGEEWIAEAKKRGLPSINSLVEAIPALTTDATVSMFEKFGVFSKVELESRAEIEYEQY
FT                   IKSINIEARTMIDMASKQIIPAVISYATELGLSIGTISDACPEADVSTQKELLIKLSNY
FT                   LREAKEALVALREINEKAYTMKASSCEKANFYHQEVVKAMDNLRRPVDALEMIVDKEEW
FT                   PMPSYGDMIFEV"
FT   CDS             complement(224466..225317)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02630"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II,
FT                   various bacterial and amitochondriate protist"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73225"
FT                   /db_xref="GOA:D4IZD6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD6"
FT                   /protein_id="CBK73225.1"
FT                   /translation="MLVSAKEMLDKAKAGHYAVGQFNINNLEWTKAILLTAQELNSPVI
FT                   LGVSEGAGKYMTGFKTVAAMVKAMDEELGITVPVALHLDHGTYEGCYKCIKAGFTSIMF
FT                   DGSHYPFEENLAKSTELVHVAHQLGLSIECEVGSIGGEEDGVVGMGECADPEECKTIAD
FT                   LGVDMLAAGIGNIHGKYPENWAGLSFETLDAIQQKTGAMPLVLHGGTGIPADMIKKAIE
FT                   LGVSKINVNTECQLSFADATRKYVEAGKDLEGKGFDPRKLLAPGTDAIKATVKEKWNFS
FT                   VQ"
FT   CDS             complement(225392..225961)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73226"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD7"
FT                   /protein_id="CBK73226.1"
FT                   /translation="MLNAARISVSDNLFPCDIGRFNADSFVYVAAFGIFTEVSYATPQD
FT                   MKNILGHAAYIIEGAKQLRDIPSFRMQVEYDGNVVYEEFIYGMITNSKSVGGFQGIIRG
FT                   DIGLNDGVFEVTLIKMPRNPIELNEILGFMTGIISESDMVYAFQTKEIKFLSSDVVPWT
FT                   LDGEFGGKHDVVVIKDESHAVEIAIE"
FT   CDS             complement(225970..226284)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02650"
FT                   /product="Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73227"
FT                   /db_xref="GOA:D4IZD8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD8"
FT                   /protein_id="CBK73227.1"
FT                   /translation="MSKRLLFIVNPRSGKGQIKEHLADILDIMIKAGYQVSVHVTQSGG
FT                   DATNQTIEQAENFDRIVCSGGDGTLDEVVTGMMQLPPEKESLLDTFQQALQTILEILWV
FT                   "
FT   CDS             complement(226305..226553)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02660"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73228"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZD9"
FT                   /protein_id="CBK73228.1"
FT                   /translation="MQKEVTIQMSNSMEATPIAHLVQLANRFSSSIYFEMDEKKVNAKS
FT                   IMGMMSLVLSSGSRVVIDAAGDDEEKAVAELSDFLTK"
FT   CDS             complement(227438..228241)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02680"
FT                   /product="Predicted P-loop-containing kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73229"
FT                   /db_xref="GOA:D4IZE0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE0"
FT                   /protein_id="CBK73229.1"
FT                   /translation="MGYYCVDNLPVQLLKSVVELADNGSFDKKIVVGIDVRNGTAMKLL
FT                   PDILQELDNDQKPFNILFLDAEDDVLIKRYKETRRNHPLSGRERIAAGIKEERKSIGFL
FT                   REEADYVIDTTHLLTRELKAELEKIFVDDVDYKSLFVTIISFGFKYGIPEDADLVFDVR
FT                   FLPNPYYDTELRPFTGNDQAIKDFVLKYDEAQIFLEKTTDLIKFLIPNYISEGKNQLVI
FT                   AVGCTGGKHRSVCLANEIFEALNGDESYGLKIEHRDIGKDALRGK"
FT   CDS             complement(228306..229169)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02690"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /function="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73230"
FT                   /db_xref="GOA:D4IZE1"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE1"
FT                   /protein_id="CBK73230.1"
FT                   /translation="MDEPMKTHTTFRIGGPADIYVEPSIYQMVPLIAYLREIDAPFMVI
FT                   GNGSNLLISDDGIEGVVVALGKAMSEIVIDESTQTVVAAAGAMLSSVANRAAEAGLTGL
FT                   EFASGIPGTIGGAIYMNAGAYGGEMKDVIVSATILEGNGELKEIYVDDLDLSYRHSALM
FT                   ENEWIVISAKLQLAAGNVDEIKATIADIRDKRIEKQPLNFPSAGSTFKRPEGYFAGKLI
FT                   DDAGLRGYTVGGAQVSEKHCGFVINKSDATASDVLQLMKNVDQIVYEKFGVHLTPEVRI
FT                   IGRNIN"
FT   CDS             complement(229233..230630)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02700"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73231"
FT                   /db_xref="GOA:D4IZE2"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE2"
FT                   /protein_id="CBK73231.1"
FT                   /translation="MERKNAWSKYTSEKDLKKVMAFGEDYRKFLSECKTERECIDFFVE
FT                   KAEKAGYINIEDAIAKNTKLKAGDKVYAVNKGKMMAVFNIGEEALENGLNILGAHIDSP
FT                   RMDLKQNPLYEDTDMALLDTHYYGGIKKYQWVTIPLALHGVFVKKDGSVVKLNVGEDAG
FT                   DPVFGISDLLIHLAADQMDKKGAKVVEGEDLNVIVGSIPGFDKKGEKEKESVKKNILKL
FT                   LKDKYDIEEEDFISAEIEVVPAGAARDFGFDRSMILGYGHDDRVCAYPSFMALLNTTKK
FT                   LNKTACALLVDKEEIGSVGATGMQSKFFENTLAELYNLMGDYSELKLRRALTNSKVLSS
FT                   DVSAALDPNYASAFEKNNAAYLGRGLVFNKYTGARGKSGSNDASAEYVGEVRAIMDKDG
FT                   VCWQTAELGKVDQGGGGTIAYIMGNYNMQVIDSGVAVLSMHAPCEIISKVDLYEALLGY
FT                   EAFIKYA"
FT   CDS             complement(230703..231269)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02710"
FT                   /product="Serine kinase of the HPr protein, regulates
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73232"
FT                   /db_xref="GOA:D4IZE3"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE3"
FT                   /protein_id="CBK73232.1"
FT                   /translation="MSALIFSLNKDFAPYTTIHGVLVDVYGEGLLITGESGIGKSEAAL
FT                   ELIRRGHRLVSDDVVEIRRPNNERLYGRAPSITQYLIELRGIGIIDVKSLYGVEAVKDE
FT                   QRIDLVIKLEDWSKEKEYDRLGMTDEYMNILGIDVTCHSLPIRPGRNLAIICEAAAVNH
FT                   RQKKMGYNAAEELYRRVQNNIETNK"
FT   CDS             complement(231329..231637)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02720"
FT                   /product="Serine kinase of the HPr protein, regulates
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73233"
FT                   /db_xref="GOA:D4IZE4"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE4"
FT                   /protein_id="CBK73233.1"
FT                   /translation="MAANKFVTVATVQERFNLTNYTPELNLEEAKVTVADVNRPALQLH
FT                   GFYEHFEPSRIQVIGNVEAAYISKKSDEEKQKASLSFFLMTFHVLFSVEARSLATFC"
FT   CDS             complement(231687..233372)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02730"
FT                   /product="excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73234"
FT                   /db_xref="GOA:D4IZE5"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE5"
FT                   /protein_id="CBK73234.1"
FT                   /translation="MVQNIDYFEFIVTDSEMEALILECNLIKEYRPKYNTMLRDDKTYP
FT                   YIEVTLTEAYPRVLFSRRLKKNGSKFFGPFTSAGAVHDTIDLVQKLYKIRTCSQKLPEN
FT                   FGKNRPCLNYHIGQCLGPCQGNVDQNEYRKNVEKVIDFLNGDYYDTLKDLEEKMLLASE
FT                   ELDFEKAALYRDLIESVKACAGRQKATQLDGEDRDIIAMAKSNEDAVVQVFFIRGGKMI
FT                   GREHFFINIRVDDTDEELIQYFLKDYYTGTPFVPREIFVQYDLEEAELIENWLTNKKGA
FT                   RVYLRTPKRGAKEKLVELAAKNAQMVLDQDREKIKKEEGRTIGAMKEISSLLGLPNASR
FT                   MEAFDISNISGFQSVGSMVVFEKGKPKRSDYRKFKIKTVEGPNDYASMYEVLKRRFSHG
FT                   LEELEENGGVIEDSFTKFPDIIMMDGGKGQVHIAEQVIAELGLHIPIAGMVKDDHHRTR
FT                   GLYYKNQELPIDTHSEGFKLITRLQDEAHRFAIEYHRSLRSKGQVHSFLDDISGIGPKR
FT                   RKALMKRFISADKMAEATLEELAATEGMNQEAASNVYNYFHPVN"
FT   CDS             complement(235859..236575)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02750"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73235"
FT                   /db_xref="GOA:D4IZE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE6"
FT                   /protein_id="CBK73235.1"
FT                   /translation="MLNAMNLQKTFNPGTINEKIALAGATLNLQEGEFCTVIGGNGAGK
FT                   STFLNAVAGVWPVDGGSITIDGIDVTGLPEHKRAKYLGRVFQDPMTGTAANMQIDENMA
FT                   LAARRGKSRGLGWGVTRSERAHYHEMLKELDLGLEDRLTAKVGLLSGGQRQALTLLMAT
FT                   IQKPKLLLLDEHTAALDPKTAAKVLEITDMLIKEHGLTAMMVTHNMRDAINYGNRLIMM
FT                   NEGRVILNISGEEKRI"
FT   CDS             complement(236568..237497)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02760"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73236"
FT                   /db_xref="GOA:D4IZE7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE7"
FT                   /protein_id="CBK73236.1"
FT                   /translation="MGIETLISGLPGTAAQGIIYGIMALGIFITFKLLNFADLSVDGSF
FT                   ATGGAVAAMVIISGKSWILAITLAFVAGALAGMITGVLHTIFGIPDILAGILTQLALYS
FT                   INLRITRNQPNTPISVDKYNLAVSLRYKEDALVTVFVMAVIIIAIMYWFFGTEMGSAIR
FT                   ATGTNPAMSKAQGINVNYMKALGLVISNALVAFAGALSAQFNGNADVNMGRGAIVIGLA
FT                   SIIIGEVICNAIFKKRRNFVLTLSFVVFGGILYYLFIAIVLWLKMPANDMKLFTAIIVA
FT                   IFLAVPYLKSVSNSSFRKAARRGGKENA"
FT   CDS             complement(237573..238592)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02770"
FT                   /product="ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73237"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE8"
FT                   /protein_id="CBK73237.1"
FT                   /translation="MKKIVSLLAVMTMTFSLVGCGTDAAAQKEAENTEVVTEAEAPTDD
FT                   GKTYNVGVIQLVQHPALDAATEGFKAALVEKLGDNVNVTIENASGDIPTCATIANTFVS
FT                   DNVDLIMANATPALQAAQTATNSIPVVATSITDYASALDIDDWSGATGINVTGTSDLAP
FT                   LDGQAEMLHEIFPDAKEVGIIYCSGEVNSLYQANTITTTLESFGYKVTHYTFADSADVG
FT                   TVVQSACASSDVLYVPTDNVAANAAETINNIALTEKVPIIAGEEGICKGCGIATLSISY
FT                   YDIGYAAGLMAYEILANGADPASMDIQYATEFTKEYNPKIAEELGITLPEDYVAIEME"
FT   CDS             complement(238699..239589)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02780"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73238"
FT                   /db_xref="GOA:D4IZE9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZE9"
FT                   /protein_id="CBK73238.1"
FT                   /translation="MRSLGDSKTPTYFLIMAAGINVVLDIVFIIVLGMSVNGPALATVI
FT                   SQFIAGISCVIYMKKRFPILKLAKGDIKLGKHHSQVLISMGIPFGLQYSVTAIGSVILQ
FT                   TAVNGLGTVAVASMTAGAKVSMFVVCPFDALGGTMATYAGQNVGAKNIPRVKKGTWTAQ
FT                   LLGTIYAVIILIILFFTGKYMLRMFTSTEVVINQAMMFLLANAATYTLLAAVNIFRFSI
FT                   QGMGFSTFAIYSGVMEMIARILVAFTFVPMIGYAGAIWASPVAWLFAVIFLIPGFYYCC
FT                   NKLEKKFCAENCHQL"
FT   CDS             complement(239577..240062)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02790"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73239"
FT                   /db_xref="GOA:D4IZF0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF0"
FT                   /protein_id="CBK73239.1"
FT                   /translation="MAANTTKKMTQGNPLTLILGFSIPMLAGLLFQQMYNLVDTIIVGQ
FT                   TLGDSALAAVGSTGSINFLINGFCMGMCSGFAIPVAQRFGAESYDSMRKFVGNAIVLSA
FT                   IFALVITTLVSIFCYQILAIMQTPSDIIDLAYSYISIIFFGIPVTFYITLQQVLCVH"
FT   CDS             complement(240216..240740)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02800"
FT                   /product="LSU ribosomal protein L17P"
FT                   /function="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73240"
FT                   /db_xref="GOA:D4IZF1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF1"
FT                   /protein_id="CBK73240.1"
FT                   /translation="MAKYRKLSRTSSQRKALLRNQVTELLYHGKIVTTEAKAKEVKKIA
FT                   EHIITLGVKEKDNFEEVTVQAKVARKDKDGKRVKEVVDGKKVTVYDTVDKKIKKDSPSR
FT                   LHARRQMMQVLYTPTAKGTKKSESHKVDMANFVFDEIAPKYVDRKGGYTRIVKIGPRKG
FT                   DAAMEVVLELV"
FT   CDS             complement(241992..242585)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02820"
FT                   /product="SSU ribosomal protein S4P"
FT                   /function="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73241"
FT                   /db_xref="GOA:D4IZF2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF2"
FT                   /protein_id="CBK73241.1"
FT                   /translation="MAVNKTPVLKRCRSLDLDPTFLGYDKKSRRQKNRGRGKKSEYALQ
FT                   LQEKQKAKFIYGVLEKPFRNYYEKADRQKGMTGENLMTMLESRLDNVVFRMGFARTRKE
FT                   ARQVVDHKMFLVNGKAVNIPSYLVKAGDVIEVREKSKSLQRFKDITEVTAGRMVPEWID
FT                   VDAENLKGTVKELPNREQIDVPVDEMLIVELYSK"
FT   CDS             complement(242602..242994)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02830"
FT                   /product="SSU ribosomal protein S11P"
FT                   /function="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73242"
FT                   /db_xref="GOA:D4IZF3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF3"
FT                   /protein_id="CBK73242.1"
FT                   /translation="MAKVAKKTTKKRVKKNVEHGQVHVQASFNNTIVTITDAQGNALSW
FT                   ASAGGLGFRGSRKSTPYAAQMAAETAVKAALVHGLKSVDVFVKGPGSGREAAIRAIDAN
FT                   GVQVLTIKDVTPVPHNGCRPPKRRRV"
FT   CDS             complement(243029..243397)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02840"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73243"
FT                   /db_xref="GOA:D4IZF4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF4"
FT                   /protein_id="CBK73243.1"
FT                   /translation="MARIAGVDLPRDKRIEIGLTYIYGIGRVSSNKVLEAAGVDPNTRV
FT                   KDLTDEEVKKISTVIDETLTVEGNLRREVALDIKRLQEIGCYRGIRHRKGLPVRGQKTK
FT                   TNARTRKGPKRTVANKKK"
FT   CDS             complement(243852..244070)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02860"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73244"
FT                   /db_xref="GOA:D4IZF5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF5"
FT                   /protein_id="CBK73244.1"
FT                   /translation="MSKADVIEVEGVVVEKLPNAMFKVELENGHQILAHISGKLRQNYI
FT                   RILPGDKVTIEMSPYDLSKGRIIWRDK"
FT   CDS             complement(244157..244327)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73245"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF6"
FT                   /protein_id="CBK73245.1"
FT                   /translation="MDLMLATSKAGHDKNQTYIIIEEMNDFYLIANGTTKTVAKPKKRK
FT                   DSFTDHKKYSI"
FT   CDS             complement(244318..245118)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02880"
FT                   /product="methionine aminopeptidase, type I"
FT                   /function="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73246"
FT                   /db_xref="GOA:D4IZF7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF7"
FT                   /protein_id="CBK73246.1"
FT                   /translation="MSEVITIKTEEEIQLMREAGKILAQVHETLAKEIHEGMSTLDVDR
FT                   LGEEVIRSYGCEPNFKGLYGYPASVCVSVNDEVVHGIPTADHILVNGDIVSLDTGVLYK
FT                   GYHSDAARTVGVGEISEEARLLIERTRQSFFQGMKFATAGRHLYDISGAIGDYAESFGY
FT                   GVVRDLVGHGIGRSLHEAPEIPNFRRKFRKGPKLLKGMTLAVEPMINAGTPDVAWMDDE
FT                   WTVVTMDESLSAHYENTIVITDGAPEILTLTPSELSNPEGNKWI"
FT   CDS             complement(245120..245764)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02890"
FT                   /product="Adenylate kinase"
FT                   /function="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73247"
FT                   /db_xref="GOA:D4IZF8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF8"
FT                   /protein_id="CBK73247.1"
FT                   /translation="MKIIMLGAPGAGKGTQAKQIAAKYSIPHISTGDIFRANIKNGTEL
FT                   GKKAKEYMDQGLLVPDELTCDLVMDRIAQDDAKNGFVLDGFPRTIPQAEALDAALTKIG
FT                   QAMDFAIDVDVPDENIINRMSGRRACLNCGATYHIVSIPPKKEGVCDSCGSELVLRDDD
FT                   KPETVKKRLDVYHDQTQPLIDYYSGKGILKSVDGTQPMEKVFEDITAILGA"
FT   CDS             complement(245872..247185)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02900"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /function="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73248"
FT                   /db_xref="GOA:D4IZF9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZF9"
FT                   /protein_id="CBK73248.1"
FT                   /translation="MLQTLRDAFKIKDLRRRIGFTFLMLIVVRLGSLLPVPGINGSAFS
FT                   SLFADSDSALNFFDSITGGSFSAMSVFALNITPYITSSIIMQLLTIAFPKLEEMQRDGE
FT                   AGRKKMTQITRYLTIGLALGESIAMAIGFGRSGYLVAYNPLYVILVVASLTAGSAVLMW
FT                   IGERITERGIGNGISIVLTINIISRIPSDLTKLYEQFMKGKTMPKATLAGIIIAAIIVA
FT                   LVVFVVILQSAERRIPVQYSNKIQGRRQVGGNSSVIPMKVNTAGVIPVIFAQSLLQTPI
FT                   MLVQLFDKNGVQGFWGKVLNAMNQSNWFNPGNWVNTIGAVVYVLLIIGFAYFYTEITFN
FT                   PLEIAENLKRSGGFIPGIRPGKPTSDYLTSILKHIIFIGAIGLSIVALLPLVFNGLLGA
FT                   SVSFGGTSIIIIVGVIVETLKQVESQMMVRNYKGFLND"
FT   CDS             complement(247185..247628)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02910"
FT                   /product="LSU ribosomal protein L15P"
FT                   /function="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73249"
FT                   /db_xref="GOA:D4IZG0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG0"
FT                   /protein_id="CBK73249.1"
FT                   /translation="MDLSNLQPAEGSKHSDNFRRGRGHGSGNGKTAGKGHKGQKARSGG
FT                   SIRLGFEGGQMPLYRRLPKRGFKNRNTKEIVGINVSYLERFDNGATVTVDTLIESGIIK
FT                   NPRDGVKILGGGELTKKLNVQANAFSASAKEKIEALGGTVEVI"
FT   CDS             complement(247646..247831)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02920"
FT                   /product="LSU ribosomal protein L30P"
FT                   /function="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73250"
FT                   /db_xref="GOA:D4IZG1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG1"
FT                   /protein_id="CBK73250.1"
FT                   /translation="MAEKKLRVTLVKSTIGAVPKNKKTVEALGLRKVNKTVELPDNDSV
FT                   RGMLRMVNHLVKVEEI"
FT   CDS             complement(247846..248355)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02930"
FT                   /product="SSU ribosomal protein S5P"
FT                   /function="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73251"
FT                   /db_xref="GOA:D4IZG2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG2"
FT                   /protein_id="CBK73251.1"
FT                   /translation="MKREIIDASQLELTEQVVEIKRVTKVVKGGRNMRFTALVVVGDKN
FT                   GHVGAGLGKAAEIPEAIRKGKEDAMKKLITVKLDDNHSITHDIQGKHTGASVLLKKAPE
FT                   GTGIIAGGPARAVCELAGIGNIRTKSLGSSNKQNVVLATIEGLKLLKSPEEVAKARGKK
FT                   VEDILA"
FT   CDS             complement(248367..248735)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02940"
FT                   /product="LSU ribosomal protein L18P"
FT                   /function="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73252"
FT                   /db_xref="GOA:D4IZG3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG3"
FT                   /protein_id="CBK73252.1"
FT                   /translation="MVSKKSRSVVRQTKHRRLRNTLAGTAERPRLAVFRSNNHMYVQVI
FT                   DDTCGNTLVSASTLDADVKADLAKTNNVEAASKLGTVIAKKAQEKGIKEVVFDRGGYIY
FT                   AGKVAALADAAREAGLEF"
FT   CDS             complement(248754..249293)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02950"
FT                   /product="LSU ribosomal protein L6P"
FT                   /function="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73253"
FT                   /db_xref="GOA:D4IZG4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG4"
FT                   /protein_id="CBK73253.1"
FT                   /translation="MSRIGRMPIAVPAGVTVEIAENNHVTVKGPKGTLERTLPSEMDIK
FT                   LEGAEVVVTRPNDLKKMKSLHGLTRTLINNMVVGVTDGYEKTLEVNGVGYRASKAGKKL
FT                   TLNLGYSHPVEMEDPEGIESTVDGNKIIIKGIDKEKVGQYAANIRDKRRPEPYKGKGIK
FT                   YSDEVIRRKVGKTGKK"
FT   CDS             complement(249382..249783)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02960"
FT                   /product="Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73254"
FT                   /db_xref="GOA:D4IZG5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG5"
FT                   /protein_id="CBK73254.1"
FT                   /translation="MNMSDPIADMLTRIRNANTAKHDTVDIPASKMKLAIADILVDEGF
FT                   ITKYDIVDNGNFKDIRVTLKYGANKNEKIISGIKRISKPGLRIYAGKDDIPYVLGGLGI
FT                   AILSTNKGIITDKEARKLQVGGEVLAYVW"
FT   CDS             complement(249825..250010)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02970"
FT                   /product="Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73255"
FT                   /db_xref="GOA:D4IZG6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG6"
FT                   /protein_id="CBK73255.1"
FT                   /translation="MAKKSMKVKQQRAAKFSTQEYSRCKICGRPHAYLRKYGICRVCFR
FT                   ELAYKGQIPGVKKASW"
FT   CDS             complement(250589..250900)
FT                   /transl_table=11
FT                   /locus_tag="CIY_02990"
FT                   /product="LSU ribosomal protein L24P"
FT                   /function="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73256"
FT                   /db_xref="GOA:D4IZG7"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG7"
FT                   /protein_id="CBK73256.1"
FT                   /translation="MATMKIKKGDTVRVIAGGDVNNEGKVIAVDKKNNTVTVEGVNMVK
FT                   RHVKPSMANQAGGIIEQEAPIDASNVMLLHNGQPTRVGFKMDGDKKVRFAKKTGEVID"
FT   CDS             complement(250913..251281)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03000"
FT                   /product="LSU ribosomal protein L14P"
FT                   /function="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73257"
FT                   /db_xref="GOA:D4IZG8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG8"
FT                   /protein_id="CBK73257.1"
FT                   /translation="MVQQESRLKVADNTGAKEILVIRVMGGSTRRYANIGDVITATVKD
FT                   ATPGGVVKKGDVVKAVVVRSVKGARRKDGSYIKFDENAAVIIKDDKTPRGTRIFGPVAR
FT                   ELREKQFMKIVSLAPEVL"
FT   CDS             complement(251596..251802)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03020"
FT                   /product="LSU ribosomal protein L29P"
FT                   /function="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73258"
FT                   /db_xref="GOA:D4IZG9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZG9"
FT                   /protein_id="CBK73258.1"
FT                   /translation="MKNTKYVEDLKNTSVAELNAQLVEAKKELFNLRFQNATNQLDNTA
FT                   RIREVRRNIARIQTVITEAEKNA"
FT   CDS             complement(251802..252230)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03030"
FT                   /product="LSU ribosomal protein L16P"
FT                   /function="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73259"
FT                   /db_xref="GOA:D4IZH0"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH0"
FT                   /protein_id="CBK73259.1"
FT                   /translation="MLMPKRAKHRKQFRGNMAGKASRGNKIAYGEYGIVAMEPAWIKSN
FT                   QIEAARIAMTRYIKRGGKVWIKIFPDKPVTAKPAETRMGSGKGTLEYWVAVVKPGRVLF
FT                   EISGVSEEVAREALRLATHKLPCKCKIVSREDLEGGEA"
FT   CDS             complement(252232..252894)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03040"
FT                   /product="SSU ribosomal protein S3P"
FT                   /function="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73260"
FT                   /db_xref="GOA:D4IZH1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH1"
FT                   /protein_id="CBK73260.1"
FT                   /translation="MGQKVNPHGLRVGVIKDWDSKWYAEGENFSDYLVEDYNIRKFLKK
FT                   KLYAAGVSKIEIERAAGRVKVTVYTAKPGVVIGKGGAEIDKIKTELQKQTSDKLVVDIK
FT                   EIKRPDRDAQLVAENIAGQLENRVSFRRAMKSCMGRAMKTGIKGIKTSCSGRLGGADMA
FT                   RSESYNEGTIPLQTLRADIDYGFAEADTTYGKVGVKVWIYKGEVLPSKKKNVEGGAE"
FT   CDS             complement(252906..253295)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03050"
FT                   /product="LSU ribosomal protein L22P"
FT                   /function="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73261"
FT                   /db_xref="GOA:D4IZH2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH2"
FT                   /protein_id="CBK73261.1"
FT                   /translation="MAKGHRSQIKRERNDVKDTRPSAKLSYARMSVQKACFVLDAIRGK
FT                   DVDTALAIVMYNPRYASSVIEKLLKSAIANAENNNGLDRKDLVVAECYANKGPTMKRIR
FT                   PRAQGRAYRIEKRMSHLTIVLDQKN"
FT   CDS             complement(253318..253629)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03060"
FT                   /product="SSU ribosomal protein S19P"
FT                   /function="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73262"
FT                   /db_xref="GOA:D4IZH3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH3"
FT                   /protein_id="CBK73262.1"
FT                   /translation="MVEQSNKEDTHGTFIKKGPFADASLLKKVDAMNASGDKSVIKTWS
FT                   RRSTIFPQMVGHTIAVHDGRKHVPVYVTEDMVGHKLGEFVATRTYRGHGKDEKKSKVR"
FT   CDS             complement(253610..254452)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03070"
FT                   /product="LSU ribosomal protein L2P"
FT                   /function="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73263"
FT                   /db_xref="GOA:D4IZH4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH4"
FT                   /protein_id="CBK73263.1"
FT                   /translation="MGIKTYNPYTPSRRNMTGSDFSEITKNSPEKSLTVSLKKHAGRNN
FT                   QGKITVRHHGGGNRQKYRLIDFKRNKDGIPAKVIGIEYDPNRTANIALICYADGEKAYI
FT                   LAPAGLTDGMTVMNGADAEVRVGNCLPLEKIPVGTLIHNIELYPGRGGQLVRSAGNSAQ
FT                   LMAKEGKYATLRLPSGEMRMVPLNCRASIGVIGNGDHNLVKIGKAGRKRHMGIRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRPGPCTPWGKPALGLKTRKKHKQSNKLIVRRRDGRAIK"
FT   CDS             complement(254539..254838)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03080"
FT                   /product="Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73264"
FT                   /db_xref="GOA:D4IZH5"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH5"
FT                   /protein_id="CBK73264.1"
FT                   /translation="MANVQYYDVILKPVITEKSMNAMAEKKYTFLVHPEANKTMIKEAV
FT                   EKMFDGVKVASVNTMNADGKTKRRGMTFGKTAKTKKAIVQLTADSKDIEIFSGL"
FT   CDS             complement(254838..255458)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03090"
FT                   /product="LSU ribosomal protein L4P"
FT                   /function="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73265"
FT                   /db_xref="GOA:D4IZH6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH6"
FT                   /protein_id="CBK73265.1"
FT                   /translation="MAKVSVFNMEGKEVGSMDLNDSIFAVEINEHLVHMAVVQQLANNR
FT                   QGTQKAKTRSEVSGGGRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYSFKLNKK
FT                   EKRAALKSALTSVVNENKFIVVDELKLDSIKTKDFAKVLTNLNVEKALVVLDTNDQNVV
FT                   MSAKNIPTVKTALTNTINVYDILKYNTVVVTKAAVDQIQEVYA"
FT   CDS             complement(255488..256171)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03100"
FT                   /product="LSU ribosomal protein L3P"
FT                   /function="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73266"
FT                   /db_xref="GOA:D4IZH7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH7"
FT                   /protein_id="CBK73266.1"
FT                   /translation="MKKAILATKVGMTQVFNEGGELIPVTVLSAGPCVVTQIKTVENDG
FT                   YDAVQVGFVDKKVKLVNKDANGRKEIIHRNGVNKPEKGHFDKAGVEPKRFVREFRFDNC
FT                   ADYALAQEIKADIFEAGDKVDATATSKGKGFQGAIKRLGQHRGPMAHGSKFHRHQGSNG
FT                   ACSSPSRVFKGKGMPGQMGGTRVTIQNLEIVRVDVENNLLLVKGAVPGPKKSLVTIKES
FT                   VKAGK"
FT   CDS             complement(256341..256652)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03110"
FT                   /product="SSU ribosomal protein S10P"
FT                   /function="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73267"
FT                   /db_xref="GOA:D4IZH8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH8"
FT                   /protein_id="CBK73267.1"
FT                   /translation="MANQVMRITLKAYDHELVDSSAKKIIETVKKNGAQVSGPVPLPTK
FT                   KEVVTILRAVHKYKDSREQFEQRTHKRLIDVIDPTQKTVEALSKLEMPAGVEISIKNK"
FT   CDS             257161..257715
FT                   /transl_table=11
FT                   /locus_tag="CIY_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73268"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZH9"
FT                   /protein_id="CBK73268.1"
FT                   /translation="MQPANNWKDYEIIDCSSGEKLERWGDYVLLRPDPQVIWNTKKSSP
FT                   YYKKLNAHYHRSNKGGGEWEFFDLPEQWTISYPICDKNLTFNLKPFAFKHTGLFPEQAV
FT                   NWDWFSSIINKEIKERIVQLRFLTFLHTQVALHLQLLQLAHRLLTSMHQRVWFSGQKRM
FT                   LHHLVLRMHLSGGLWMTAVSS"
FT   CDS             257757..258047
FT                   /transl_table=11
FT                   /locus_tag="CIY_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73269"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI0"
FT                   /protein_id="CBK73269.1"
FT                   /translation="MDPPSYGRGSKNEVWKIEDDIFPFIQLCEEILADDALFFLVNSYT
FT                   TGLQPAVLNYMISTALLKNHPGEVTADEIGLPVTESGLVLPCGASGRWVRK"
FT   CDS             258134..259504
FT                   /transl_table=11
FT                   /locus_tag="CIY_03140"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73270"
FT                   /db_xref="GOA:D4IZI1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI1"
FT                   /protein_id="CBK73270.1"
FT                   /translation="MNQTTKINPLGTEPVGTLLRKFAIPSIIAMLVGSLYNMVDQLFIG
FT                   NFVGPLGNGATNIQFPLSILNVSIALLCGIGAASTFNLAMGRGETEKAGYYIGNAVSFM
FT                   LIGGLTLSIITELFLEPILLGCGATENILPYAMEYSRICALGYPLFILSAGGAHIVRAD
FT                   GSPNMTMAINMTGAIINTVLDFLFVAVFKWGMAGAAVATIIGQYVAGIMVLIYLTRFKT
FT                   VKLYKKHFIPNLVMIGAIASLGAAPFINQIAMMVVQIVMNHIMGFYGAQSIYGSDIPIT
FT                   CAGIISKVNGICFSFVIGISQGLQPIVSFNYGAKNYDRVKKAYHLAIRIAAIITITSWA
FT                   CFQLFPRQIVSIFGSGSELYFDFCTKYFRIFLFGIFTAFLQPLSSNFFTSIGKPYKGIF
FT                   MSLTRQVLFLTPLIICLPLFFGFNGVLYAGPIADALSFTICFILVRREFNRPEFKNA"
FT   CDS             complement(259560..260324)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03150"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73271"
FT                   /db_xref="GOA:D4IZI2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI2"
FT                   /protein_id="CBK73271.1"
FT                   /translation="MIAVSRSQESVKQELLQYIFPICVTCILTALLMGFVVVYFNRKLA
FT                   VRISKMSKYINTLADGNFDNDIPREVMVEDDELKHLANDGRRMAKAIQTLVEYDALTGL
FT                   NNRRYADKKLAEIRIRAVELGIKYCVCISDIDFFKKVNDTFGHEMGDEVLRRVAEKLKA
FT                   GMVGKGIAARWGGEEFLLIFDGRELDIARRELELIMNEVRTIWVPDSDRQITMSFGLTA
FT                   LQPGEDIDDALKRADDNLYQAKEGGRNQIVCK"
FT   CDS             complement(260321..260845)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73272"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI3"
FT                   /protein_id="CBK73272.1"
FT                   /translation="MKKKLRNSLNTQMLRVTLIPLTLMAIIIISVGISGLYQLMSNETE
FT                   DELIRDAKMAQYVLDEVYAGEYWAEDADGDGEIEMYKGNQRINGEYTMIDDLANLLEID
FT                   ISLFYNDIRLITTLKDSEGNRATGTSASVIVKKDVLNGGESRFYNNVLVYDKKAMPFIL
FT                   LFAPKMEISRE"
FT   CDS             complement(261000..261962)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03170"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73273"
FT                   /db_xref="GOA:D4IZI4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI4"
FT                   /protein_id="CBK73273.1"
FT                   /translation="MYAIGCVIYADKGFGNLQTFLNVLINNAGLICVTCGMTCVMLTGG
FT                   IDISVGSVIAMDCMLLVFGMTEWHMGAVPMVILVLVIGLVFGAVQGFLVGYLEIQPFIV
FT                   TMAGMFFARGMTAVICSGQISITEADNPLFYAWANSKINLPEFLGKANKHGKIVAPYIR
FT                   PTVLIAIIVLVVIFLMLKYTKFGRNLYAVGGNQTSATMMGLNVKKTRMLSHILSSFLCS
FT                   IGGILYCLNTMSGSVNQAKGLEMDAIASAVIGGTLLTGGVGNVIGSLFGVLINGTITVL
FT                   VNTNGKLLSSWANIATAALLCVFIILQSIFALVKAQRNK"
FT   CDS             complement(263037..263093)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73274"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI5"
FT                   /protein_id="CBK73274.1"
FT                   /translation="MENFKKLTKSHCSCQFSV"
FT   CDS             complement(263093..264607)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03200"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73275"
FT                   /db_xref="GOA:D4IZI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI6"
FT                   /protein_id="CBK73275.1"
FT                   /translation="MDENILITMRDISKSFPGVKALDHAQFTLRKGEIHALMGENGAGK
FT                   STLIKVLTGVYSLDAGEIHVAGIEGPVVNHSTLEAQEKGIATVYQEVNLCPNLTVAENL
FT                   FIGREPKTKIGTIDWRTMNKRAKDIMDGLDLHIDVTIALENYSLAIQQMIAIARAVDMD
FT                   CKVLILDEPTSSLDDSEVEKLFRVMRDLKSKGVGIIFVTHFLEQVYEVCDTITVLRNGE
FT                   FAGEYSVDEMPRVKLVAAMLGKDFDDLASIKKEGAGNVSDDVVVEATNLSHKGTIKPFD
FT                   FSIKRGEVVGVTGLLGSGRSEMVRCIYGADKAQTGTLKVNGKELNIKEPLDAIKAGMGY
FT                   LPDDRKADGCIGDLSVRENIILALQARNGIFKKIPMSKQIEMADKFIDMLQIKTASRET
FT                   PINQLSGGNQQKVILARWLCTHPDFLILDEPTRGIDIGTKTEFQKLALKFAEEEGMSIV
FT                   FISSEIEEMLRTCSRMYVMRDGAQVGEISGEMTQESVMAAIAGGGE"
FT   CDS             complement(264783..265877)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03210"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73276"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI7"
FT                   /protein_id="CBK73276.1"
FT                   /translation="MKKRIVAGMLTALMAASMVACGSSDTATETTTDTTAEESTDTAAE
FT                   APSGDKITVGFAQVGHESDWRTASTNSVQDAFSEANGYDLQFVDCDNDSAKQIEAVRQF
FT                   IQNDVDYIVIDPIVSTGWDTVLTECEDAGIPVIVIDRTIEDSDKYVSWVGSEFMNEGLA
FT                   SGAWLKAYAEAKGITDLNILVIEGSNGSSAQIGRTDGFKKYADAEGWTILDSQDGDFTQ
FT                   DGGQQVMESYCKSYAGKFNVVVCQNDNEAFGAMDAMKAAGVSYGVDKDVILISFDACKA
FT                   GLEYVQSGDINADFMCYPLQGSYCADIVKALQNGETVAKQTFMTEPWYVAEDILKSITY
FT                   TNNAGDEVTEDLIQVTDAASQASY"
FT   CDS             266225..267187
FT                   /transl_table=11
FT                   /locus_tag="CIY_03220"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73277"
FT                   /db_xref="GOA:D4IZI8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI8"
FT                   /protein_id="CBK73277.1"
FT                   /translation="MVPKYIYLKEKINEDILSGIYPLDSKLPTEVQLADTYKVSRSTVR
FT                   QALELLVNEGIISKRWGSGNTVISKSNSSKKNTVMVLLPDSKGGNSSALLDDITSTLIK
FT                   EGFTIEEHETANQLSLERAFLSDMLDEIYSGLIISPALSALPSTNSDLIHQLLKRQLPV
FT                   VFIGSAPTGIYNATVVSLDNYDKGYQMARRFINSGHKSLGGIFLHDSADSVSAFSGYID
FT                   AIRDAGLSICDSCFLWCNSVDPQGINTRSASFVNKFLKHACETADIIYLDDESIGADQQ
FT                   FPVRANALEAGKSLGKEAAKALINQKKNGNAPGITIPFH"
FT   CDS             complement(267184..268200)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03230"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73278"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZI9"
FT                   /protein_id="CBK73278.1"
FT                   /translation="MFRSKRIVRAMIGVLIAFGITACSSQTNDELLEEENSDLVVIGFS
FT                   QPGAESAWRVALTDSVKENFTEERGYKLIYKDGRSKQDNQIKDIRTFIQQGVDYIIISP
FT                   IVETGWDTVLSEAKDAGIPVIICDRNVVVGNENLYTAFVGSDFKTEGESAVLRLENILE
FT                   QQEDEDGQINIVHIQGTLGSSAQIGRTKAIEEAVEEHQDWNIVSQDCGEFTKAKGREIM
FT                   AQVLEEIGAENIDVVYCENDEEAYGAISAMNEAGISYGENGGIKVVSFDAMNSALVLCM
FT                   NGQISVEAECNPLQGPYIYNLVSRLERGNAVPKITYVHEECFVSDDLTPEIIEKRRF"
FT   CDS             complement(268193..269638)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03240"
FT                   /product="Predicted signal transduction protein with a
FT                   C-terminal ATPase domain"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73279"
FT                   /db_xref="GOA:D4IZJ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ0"
FT                   /protein_id="CBK73279.1"
FT                   /translation="MRLKERLMKKSTTSAKLRGLIAAILVPMSIVVAILIGVLCWYSLQ
FT                   YQTILQNVTAASAFNQNFKSDVDLKMFYYVSDSAYSEGKPFAEVESARELADTLLSHTT
FT                   EKKSIEAIESVRDLCITLEQRMNEIDDAGSYDEGMTQLENNIYILTELIQTYMYDYLYY
FT                   ESAHMSQLQSEVIEQLQYVIMAAIGLFLIFIIAITIYTSRVTNEITAPLTFLTKRVKDI
FT                   QRGDFEQHTPVEAKEIEIQTLSDGFEEMVGQLNTLIQENKRAERRKRHAELELLQAQIN
FT                   PHFLYNTLDTIIWLIEADKKSESIEMVSALSDFFRFCLSRGKDIITLEEEQKHVLSYLS
FT                   IQKIRYQDRMDYEVVIPESLYGYSIPKLTLQPLVENSIYHGIKLQREKGQIKVSAMDLG
FT                   DKIELTVKDNGAGMTVERLSEMRNAIENGEKVGFGLRTVHQRMQLLYGEEYGLTISSTE
FT                   GVGTTITAVIPKVENNEKGIANV"
FT   CDS             complement(269635..271242)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03250"
FT                   /product="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73280"
FT                   /db_xref="GOA:D4IZJ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ1"
FT                   /protein_id="CBK73280.1"
FT                   /translation="MYSVFLVEDEIVIRDGLKASFPWEQYGFAYVGDAADGEMALPFIR
FT                   QTKPDVLITDIRMPFMDGIALSKMIKKELPNTRIIIISGFDDFSYAQEAISIGVDNYLL
FT                   KPITKDKLGEVMADAKTKLDKENEKDNYLEQFKAESQEYEQFARVRFFNQLVSGAMSVS
FT                   EVYEKSEELGLSLDATNYNLVLLDFSPMTEIAKAPVYSKHMARLSDQLMQFLKCCPEYI
FT                   VFHWNMDTYAIIVKGDVDTIESHTATLIENIQRRCMVYEDEINWYLAESGTITRFSEFA
FT                   KACQIANKRLSCRYMNPAGHIFTDADIEIIRNNNEESDTSSIDQRLVLLFLENAEESEI
FT                   PGFLGNLINKQTKSAMKSTLFCKYFAMTMYMCVCDYLRKLSIDPASVLEANTRRDIENV
FT                   ETDTVMTMVEKMFAIAISKRKNVVGTQSKSQLSAAIKYVDEHYADCNLSLNEVAKEVNI
FT                   SPSYLSAMFSRENKTTFVEYMTGKRMEQAKKMLLTTGEKSQVIAEQVGYKDPHYFSYIF
FT                   KKTYGLSPKEFRAKGQGA"
FT   CDS             complement(271272..271871)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03260"
FT                   /product="Cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73281"
FT                   /db_xref="GOA:D4IZJ2"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ2"
FT                   /protein_id="CBK73281.1"
FT                   /translation="MGQFIISVGREYGSGGHEIATILAEKFNVPLYDRNMLDHMAERNG
FT                   IEAEKLYKHEEMKRHGLHRTVRGHSSSVQDSIAQLQFNFIREKAESGESFVVVGRCAEN
FT                   VLRDNPALISIFVRGEEDAKVERVSRLYKLNKLEAKAKMFRHDKKRKAYHNYYSKMKWG
FT                   DSRGYDFCVNSSLMGVEATAEALYQVISGYLKSKEQ"
FT   CDS             complement(272065..273414)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03270"
FT                   /product="possible tyrosine transporter P-protein (TC
FT                   2.A.45.2.1)"
FT                   /function="possible tyrosine transporter P-protein (TC
FT                   2.A.45.2.1)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73282"
FT                   /db_xref="GOA:D4IZJ3"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ3"
FT                   /protein_id="CBK73282.1"
FT                   /translation="MLAEILAIVIFVAMFVLIVWDRFPKHYVTLGCGALTSIFVFGIGM
FT                   KDAEAFVNTLAVKGIFKTHFWYAAGEHAEQTSGINWATIIFLWGMMIMVEGMAEAGFFD
FT                   WLCLKIAKMANYEPSRIFVAFMVLSSVLAMFIDSITVILFLAAVTIRLARTLKFNPIPV
FT                   IMAEIFCANLGGSATMCGDPPNIIIGTSLGYSFADFVINTGAMGAVSLVIIIVYFYFTM
FT                   RNRLQDPADKVDPSTIDVEVKINNMKEFMTSTIIFLIAVSLLITHAMTGLTVAFIGVFI
FT                   AAITLIASGRKALTLLKRVDYPTLLFFIGLFVVVGGLEETGVLVVIADFIAKISGGNAH
FT                   IMIAIILWVSGIASAFIDNIPFSATMIPVIKTLAETTGVDLSTMAWTLAIGTDIGGSMT
FT                   PIGASANVVGISTAGKEGYPISWATYCKELVPGTVIVLVVSMLNIYLRYL"
FT   CDS             complement(276032..276232)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73283"
FT                   /db_xref="GOA:D4IZJ4"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ4"
FT                   /protein_id="CBK73283.1"
FT                   /translation="MNLNQLKGVITRTGKMAFPEHRDLSRQLGADSMVLLKNNDILPIT
FT                   KGKVALFGAGAVDTIFLRNFI"
FT   CDS             276383..276478
FT                   /transl_table=11
FT                   /locus_tag="CIY_03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73284"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ5"
FT                   /protein_id="CBK73284.1"
FT                   /translation="MFKDMFERDSSLSFEVFPPKKTTNSITASKS"
FT   CDS             276598..277236
FT                   /transl_table=11
FT                   /locus_tag="CIY_03310"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73285"
FT                   /db_xref="GOA:D4IZJ6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ6"
FT                   /protein_id="CBK73285.1"
FT                   /translation="MAHMTCVGSSADDILAVTKELEAVGVNHVLALRGDKPRDMSDEQF
FT                   EKRIFPHATDLIHFINQNTNLIVSASCYPEKHPEAISMDSDIAFMKMKQDMGAEMFISQ
FT                   LFFDNADFYRFVERANQAGITVPIVAGIMPITSAKQIGSTVTLAGSSVPKKLADICARY
FT                   GESPEEMRKAGIAYAIDQIQDLKRCGMGHIHIYCMNKPKMTKEICDAIW"
FT   CDS             277270..278151
FT                   /transl_table=11
FT                   /locus_tag="CIY_03320"
FT                   /product="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73286"
FT                   /db_xref="GOA:D4IZJ7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ7"
FT                   /protein_id="CBK73286.1"
FT                   /translation="MDGKKIEQEILEITEELIKDYKSDRAIDKMDTYHQPNKDSIIDIT
FT                   KKLLRIVYPGYYRDHVYKVYNVETNLNTLMEDVVYNLNKQIALILCYRPDFDGCCEEIC
FT                   STKAEELSLAFLKRIPKVRALLDTDLQAAFDGDPAATSIDEIIFAYPGILAITIYRLAH
FT                   ELYDLSVPIIPRIMTEYAHSLTGIDIHPGATIGEYFFIDHGTGIVVGETTIIGKNVKIY
FT                   QGVTLGALSTRGGQNLRGVRRHPTIEDNVTIYSNASVLGGDTVIGHDSIIGGSTFITES
FT                   VPPESRIYYEIK"
FT   CDS             complement(278233..278418)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73287"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ8"
FT                   /protein_id="CBK73287.1"
FT                   /translation="MEGEILPGETEDNNPEDSVADTENTELESLGEASEEVATTDNQVA
FT                   DTQSDTDVQTETTDGE"
FT   CDS             278660..278728
FT                   /transl_table=11
FT                   /locus_tag="CIY_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73288"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZJ9"
FT                   /protein_id="CBK73288.1"
FT                   /translation="MAATAVKDTNFNMRMNKQKKLA"
FT   CDS             278752..278952
FT                   /transl_table=11
FT                   /locus_tag="CIY_03350"
FT                   /product="RelB antitoxin."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73289"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK0"
FT                   /protein_id="CBK73289.1"
FT                   /translation="MTLAEAVNIFFEKSLMEGGIPFDVRMPRYNKETEEAIQETRDIIS
FT                   GKISAKSYSSSKELFAELDEE"
FT   CDS             278952..279233
FT                   /transl_table=11
FT                   /locus_tag="CIY_03360"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73290"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK1"
FT                   /protein_id="CBK73290.1"
FT                   /translation="MKYTLKTTTKFKKDYKRCKKRGYDMDLLSDVIDTLLDGKELDDKY
FT                   YDHPLHGNYEGFNECHILSDWLLIYAKNENELILTASRTGTHSDLFDE"
FT   CDS             279445..279564
FT                   /transl_table=11
FT                   /locus_tag="CIY_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73291"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK2"
FT                   /protein_id="CBK73291.1"
FT                   /translation="MPLAMPNIKLQLESLRKNDWYITASPGKSLRYQNTHSKT"
FT   CDS             279917..280855
FT                   /transl_table=11
FT                   /locus_tag="CIY_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73292"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK3"
FT                   /protein_id="CBK73292.1"
FT                   /translation="MRNNFVRTLALVGMVGMMSTTGLVAHAAEAPQAAQTQTVKQNLNA
FT                   SVIARVFDAKYYAQAYPDVVAALGNDPAVLLNHYVNNGIYEGRDASATFNMSVYALANP
FT                   DLVTAFGSNYQAFINHYVTSGIKENRVASADALLKQGPKAIATLAQQNDQIKSTSNITG
FT                   NTFAYTAPSADPTVVGGMALEAQQAYQRALDFINGGHDVSEIGLDKAGWTNESYLKHYE
FT                   AATRDIYYNPVTGTSQAYGTTVIDYSRPINGNGEKYGYEGTFVSGSGFGHTVYCANDEQ
FT                   TAAATERANAEAAERAALIGTVDEDGWTIIQ"
FT   CDS             complement(281084..282793)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73293"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK4"
FT                   /protein_id="CBK73293.1"
FT                   /translation="MVGIKQQNKRHRKINDEESSLQTEIKNEKGIDVLKDIDDITALFE
FT                   GSSGYCGGLDATTHCSGHDHSCYAKKLRLTNGTIDESDDTFVIPAELCENDATQNDMLC
FT                   VLLNRNSEAVRYIEGNSTTKAAYGDKDTKETWYYRHEAKHKDWSGYDTPVEPGSLKKNV
FT                   RSARNSCYDPHNNNAAESGMKTTDSRLAYTYKISELLKAVPDQVTTVTLRVSYEGRVID
FT                   QILHSKKSNPANVCDDSTWSSSYGSVSYSAGINHISTIRDKSKQYYKFDLSGCTSEQLE
FT                   DGWVCIQTCASTSSYNGDGRNYCQCILYEIGYETVMDDCDITKHQYSGTPTYTFDEKNK
FT                   LTSVKINYECDKNKRNHKDSYTVPKTKIYSTIKGGSIIYKIEGKYNDFYTKVVQTNGSS
FT                   DPYKAEPILLTNDNTSGSVGQDKSIPSDYGYSDKEVWPSGWGIGYDGHVNSAHYVSASA
FT                   AIDGSVPAGYIPTGVNQIVFGFSANETLEALSISVYNARGQKIGFGGMNMAGSISGNTC
FT                   TVKINARSDADLMGATVKFYGKSSSIRWASSHWEKLGGISSSISLNSMTFVY"
FT   CDS             complement(282751..284154)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73294"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK5"
FT                   /protein_id="CBK73294.1"
FT                   /translation="MKKHINLVKRALALGLIVTTFATTPNLTVFAEEFYEEHTTIEQPI
FT                   IGGTRNDNVQGVAPENETFYGFVYDADKDAFVESIESGLTRTVKRTSLDINNKWFIENF
FT                   GTEAFDMSTDEFAKLIFSKYTYDAESGNYVLTYIDSKANGRTLSVSRNTVESTQWFKNS
FT                   GLRSPAVAERELPNFTVQGDFIPFRDQIPSYLADNSSAKSDIVKKVWCKLFYEELNWKP
FT                   GYAFYDSKYSSWISKYGHTETYRTLSGEQSNVSGQITYSTGDFEAYFGNTIEDNPEFLG
FT                   QLLGITSVSGIEGYDANGLDLKDEAGKELLKNVVGKYLYDESDPTKYNQFFAESIVNLT
FT                   KDGLYLDGCLKSVTCNGIRADYAVLSNLASKYRQKDSSDNLILSQKQIEWIESYQLEFY
FT                   DAYTKGTNAALKGMVTRNENLYDFIARSKYAANDRNDYGQEFFDYVVESGIGAGEWLAL
FT                   NSKINGTEK"
FT   CDS             complement(284237..286156)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03410"
FT                   /product="Carbohydrate binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73295"
FT                   /db_xref="GOA:D4IZK6"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK6"
FT                   /protein_id="CBK73295.1"
FT                   /translation="MQNNTLKKEDNLKASERFKATAKSVYIQKDGKLNKVSLGLSIGIL
FT                   AGLIALTGFTVYKTSPTAITDSFVEGLETDEARMAIQQAFISGIDEYLNGNLTESELRE
FT                   RLYSELAKIIEKDGAFTDDQKIALEEMFAEYIMNLDIENLISKNEENITNLTNEFNKYK
FT                   KENERVIETLRESLEKEIQTNKEYTQEQLDILNELHETLVKTEASHYSELQTKIQDTYN
FT                   ELYKLQQDQLYKGVAAWDKTKVYDIDSYVIYNDKLYRNATGTSTENPPSQDRFTEQNPT
FT                   GNWEQVSVMKTVQDNFNTFVTNLYNGMTEWDEAGSYTPNSYVFYHNKIYKNITGSNSTT
FT                   TPDQDTVNWQEASIMTVINNTYNTFVATVGASDYDPNKSYNAGDYVVYNNITYKNVSDN
FT                   PNGQGGAAIPGVKEGAGTQSVWIPVTLTEMIDNNYQTFIKTVGAVDWNPDKSYQAGEYV
FT                   IYKGNLYRNKTGVNTTPAKDSENWSQVSITDSIESLSDRVQSLELKTASDLDSLKKGLL
FT                   DFIDGNMSLDASQKAALKKMIEDATDSSEAGLKSLYDRLMAAINAGDQSLAEQNAAERE
FT                   KLLEQLKILNSNTASVMDSLERRIKNLEDRTTWTVNDEVSEFQYRVDDGNQGYVDGSGN
FT                   WHPF"
FT   CDS             complement(286261..287205)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03420"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73296"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK7"
FT                   /protein_id="CBK73296.1"
FT                   /translation="MAGILNITPTELISCIKEESNGKNPALSSSFIIRTPQAKRGISAD
FT                   LIELSEHILQPEFNNRLISQYKYDLTHQDRQGIYAYTQKALSYNSSRIEGNTLTPDETA
FT                   ELFNTGTIGADGIVYKPKDVEEMTGHFSMFNRCISTLEKPLDLQLIKDYHFSLQNGVFE
FT                   FIANGGVPGEFKKKKNLVSDITTVLPEDIPFVLEDLLRQYKESEKNIETLAKFHAAYEI
FT                   IHPFQDGNGRTGRMLIFREALLNGIDPFIVEDKNKNTYYKVLHDAQTKNEYDGLVEFFK
FT                   DEQKAFLMEAIPYLLAPDEYTQFLDNNKNDYQR"
FT   CDS             complement(287578..288531)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03430"
FT                   /product="L-aminopeptidase/D-esterase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73297"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK8"
FT                   /protein_id="CBK73297.1"
FT                   /translation="MKLKEIDINSIGNVRIGQTEDNKAGTGVTVIVAPEGAPCGLDIRG
FT                   GGPAGRETGLLDPLAAAEVIHSVVLGGGSAFGLEAASGVMQYLAENKIGFPVGDVVVPL
FT                   VCQSDIFDLQYKRSDVYPDKAMGYKAAKQAFKGKHGNYKDGSVGAGCGATVGKLLGPDR
FT                   CTKSGIGSFAVELGDLKVGAIICTNAIGDIYDADSGKRIAGVKNEKGTGLNKVSCEELM
FT                   YDMYVNPPAGMTTNTTIGIILTNAKFNKSQLCKLAGMGHDGYARSIRPVHTSMDGDSIY
FT                   AMSIGDVEASLDVLGTLANKVICEAIKRSVKREDAH"
FT   CDS             complement(288556..290154)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03440"
FT                   /product="Protein of unknown function (DUF3298)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73298"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR027295"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZK9"
FT                   /protein_id="CBK73298.1"
FT                   /translation="MMKRLLVLAMTVICSLSLVGCDNITNESGSKINQAKIGVTIVKHP
FT                   LEAKADGKVYATGCYPEIILSEDYADSFPNLASSIDSYNSDWENNAKNSVKDYGYMNQQ
FT                   YGEGDATGYIAENTVDVVRADDRLLSALAYSYTDADGAHPSHYTYSINLDTNTGHVLGL
FT                   SEVITDKEALWKKIREKIFEKYPDNKEDIENYLLCECAIDGDPFEVKMNEDTYTWTLSD
FT                   EGVHIYFSPYEIASYATGDMDVVITEDDIPGLIQENYKASGKQDIDSIVTKQTAETEEL
FT                   EPESMGDGEEYEYTGESQGVIISNPTWHKYTSDSVKPAAEKHITLTETSKDKTDWLDTS
FT                   VWAEKNGFEEAFLSYGDGNYYYAPGDGGDFGYEFTTLFLYDYQTNELLHTYDLAELCNG
FT                   PDAEEGKESMARQYIRWAKAMDGILYVSLSHNGYTSEESRSGYMVAIDMKTDTVLWRSE
FT                   PQVSNACNFQIVDDTIICGYGFTAEPDYMYLLDKNTGEKVEQIKIESAASQFEIKDDTL
FT                   YVATYNTAYTYKINR"
FT   CDS             complement(290154..291239)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03450"
FT                   /product="Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73299"
FT                   /db_xref="GOA:D4IZL0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL0"
FT                   /protein_id="CBK73299.1"
FT                   /translation="MTETRLKRADQIQFFRFICFAMIFLWHGKTWRIKYLPGDIGAQTG
FT                   VYFFFLLTGVMASYSLALKEISPTKENIKDYLKRKLVRLYPLYFVTNLLTFLYNEGQGF
FT                   VVSHSIKPILVLVGDFVLSSLMLQTWLLRPFAGNSVGWYLATMMWLSIVNIPFSAWAKS
FT                   KRNTNKPIIRMVCIIVLALLYIAVISTLAGLIGLGDFGFMQTPLFCLGFHLIGLALGEI
FT                   IIILKQSHPEWENQVKKYTIIEIVALLVWLVIVFIPGEMAFGPLMLGFFASIFLILVFM
FT                   LGYGNISVGLRAKPLVFLGDISFECYLFHQIIITIYAHINGWDSLGTLGNAYALTVCMA
FT                   VTVCLSWLVSNVKLPFGREKM"
FT   CDS             complement(291327..292832)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03460"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73300"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL1"
FT                   /protein_id="CBK73300.1"
FT                   /translation="MELIPIIALIIVLLLIIVAGYVKAPPDRAYIISGLRKNPRILVGR
FT                   AGLKIPFFERVDKLYLGQMTVDIKTEQSVPTNDFINVNVDAVAKVRIGTDPAAIQLAAK
FT                   NFLNKNPEQITQDLQDSLQGNMREIIGTLSLKVINTDRDSFSDQVMEKASRDMSKLGIE
FT                   ILSCNIQNVTDENGLINDLGMDNTAKIKKDAAIAKAQADRDVAIAQAEADKAANDARVT
FT                   AQTEIAEKNNALAIKQAELKQQADTANAVADAAYSIQQQEQQKTIEAATVNAQIAKAER
FT                   EAELKQKEVLVKQQELAAQIEKQADAEKYQAEKKAEAELIQRQKKAEAAKYEQEREADA
FT                   KKAQAEAQKFAAEQEAAGIKAKYDAEAAGIAAKGKAEAEAIKAKGLAEAEAMEKKAEAY
FT                   RKYNGAAMAEMMIKVMPEIAAEIAKPLSQIDKINIYETGDGSEGGAARISANMPIVMKQ
FT                   VFDTMSEATGVDFTEIMRANTYDAKVNKNVNITGADVSVKTEQ"
FT   CDS             complement(293014..294150)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73301"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL2"
FT                   /protein_id="CBK73301.1"
FT                   /translation="MFLNMGYIHYDAIGDDLTNELADIMDRLDTLCQSEHVFTIYSWLR
FT                   AVYAGEREPSRNELDLDYRGFVLEERKSGNISEADMPNWMNDQEQKVKFEMNNFFVSAN
FT                   RTTSGKMTSFCPVLTKEDFGAEVMKMLLTKAKLEEAMGKIEEVDYGIFLREGFFTDMEA
FT                   GVKSESYLKRVQPDIILLPNCGMRAMMWQECGGIKVDSPGRFVFPMFTFDDLDKLMIYC
FT                   CGAFRWEICRKEQGSRWNDIGSECLTSDFYDYFTFYRKNKDLSAENKEKVKTLLKSSRN
FT                   NMREAFTKQYTIWINFEAQGSIRLNKAERNILNKHCTFSKAYRAKVANHPMYEQVISRH
FT                   EIKCTQAYNHLKTMIDKVEKNEGEVPEEVRKGLEYLRM"
FT   CDS             complement(294141..294881)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73302"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL3"
FT                   /protein_id="CBK73302.1"
FT                   /translation="MGAEIQEIPMIEEIEPLDLKDEILPWEHDYIDSLNSVDNKEIESI
FT                   YGSRNEIATGVIGISCGYMKRAIESIEIMGFYLEEFAPILISSEKGDIFELLFNLQIYA
FT                   AQHGAKQDDIKKLMKMLYKFISQSGLYDKSLIKERWTEYDSHDFAATAANFDEAKMMKQ
FT                   AEFTQTFEHICEFAEVDEEKQPSTKRSLMHILLFLIERVRRITSVRFVRKPLIYSMKFI
FT                   KRPSLELWNLKPMAVSLILLLRCF"
FT   CDS             complement(294851..295225)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73303"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL4"
FT                   /protein_id="CBK73303.1"
FT                   /translation="MYVIVTGSIEQVWKDQHLTLGPGTIAGLSDALNLEYEADYTVAED
FT                   SMIIKCPYKSMSDFDAIFEAQPVYIFGFSKGAFRQCRDVFKIYDSYKKRLMISIAIVVE
FT                   FIMNIRSNVGQWELKSRKFL"
FT   CDS             complement(296371..297768)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03510"
FT                   /product="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73304"
FT                   /db_xref="GOA:D4IZL5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL5"
FT                   /protein_id="CBK73304.1"
FT                   /translation="MGNNTLEKEAKELVRLRKAASAPKPAYYLGMIMVVLTIIYIVDEV
FT                   TSNINSAMQPYIIFDLFKISSRDVNSTEYKESLNYVASWNLLSNLFLIIAPFYKALSDR
FT                   YGRRLFLMINTIGMGLGMLVVMTSTSVVQYIVGMLFMLFFTPNDMQVLYIMETAPKEKR
FT                   ATYSFVAKGIALISVSSIGILSKFFLNEAVPSSWKYVYVIPVAVALVVGILSVVFVKET
FT                   PVFLEQRIFYLSLTEEEKERRRQTEKENNTSDQGGVFNAFKFIFTNKQLRWILIAGFLF
FT                   FATTFYTSYYATVLEGAMTTQMVSLALLIYPFCNGIVTILSGLFSDKLGRKRVCLLLGT
FT                   IALGGLLIFVLACRLGWGPITAGVAYGCSIGGLWSMSDTLILTMPAESSPSSMRSSVMG
FT                   TISVLIGAGMFIGQIAFIIGQKFIPIDVLFLVICVPFMALSLIILMTKVKETKFVNLDQ
FT                   VTVDTFK"
FT   CDS             complement(297882..298520)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03520"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /function="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73305"
FT                   /db_xref="GOA:D4IZL6"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL6"
FT                   /protein_id="CBK73305.1"
FT                   /translation="MEKLDNVVELTHPLLQHKITMLRDKNTGTAEFRALVEEIAMLEAF
FT                   EALNDLQTVDIECETPIEKCMAPVIAGRKMAIVPILRAGLGMVNGIQRLVPTAKIGHIG
FT                   MYRDEETHIPHEYYCKLPSPIEERLIVVTDPMLATGGSAIDAIGLIKQHGGKRIKFMAI
FT                   IAAPEGVRALHEAHPDVQIYVGHIDRELNSDAYICPGLGDAGDRIFGTK"
FT   CDS             complement(298589..299944)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03530"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73306"
FT                   /db_xref="GOA:D4IZL7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL7"
FT                   /protein_id="CBK73306.1"
FT                   /translation="MNTHEPIKDVSKLGIPKTLILGLQHLFAMFGATILVPILVNNYFN
FT                   GEGLSIQVTLFFAGVGTLFFHLCSKFKVPAFLGSSFAFLGGFHTVANLNTGIFKNMSMG
FT                   EKLPYACGGIVVAGSLYLILALVIKLVGINKVMKYLPPVVTGPIIICIGLSLAPSAITN
FT                   ASSNWLLAIIALSVVIIFNIWGKGMFKILPILMGVVISYACAVIFNALGMTNADGSAIL
FT                   DFTAVHQAAWVGLPDFFICKFNISAILVMAPIAIATMMEHIGDMSAISATVGEDLVTDP
FT                   GLHRTLVGDGLATALSAFFGGPANTTYGENTGVLELSKVHDPKVIEIAAVYAIVLSFIP
FT                   KMADIIGTMPSAIVGGISFMLYGMISAIGIRNVVENHVDFTHSRNLIIAAVILVCGLGF
FT                   SDGLTFTVGSTDITLTSLAIAAIAGVVLNAIIPGRDYEYGNPERYRFDKDGI"
FT   CDS             complement(300753..301229)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03550"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.29"
FT                   /EC_number="3.1.3.45"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73307"
FT                   /db_xref="GOA:D4IZL8"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL8"
FT                   /protein_id="CBK73307.1"
FT                   /translation="MKDIKYLVLDVDGTLTDGCVYMGETGELCKAFNIKDGYGIVHIAA
FT                   PAGIIPIIITGRKSDIVLNRCKELGITNIHQGVSDKLAKLKGILSANGGTLAKCAYMGD
FT                   DLNDMTVMEAIKAEGGLLGCPADAAEEIIGISDYVSKKDGGRGAVREFIEWLVK"
FT   CDS             complement(301277..302815)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03560"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /function="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73308"
FT                   /db_xref="GOA:D4IZL9"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZL9"
FT                   /protein_id="CBK73308.1"
FT                   /translation="MEFTNTIWSLLPPFIAILLALITKEVYSSLFIGIFAGGLLYAGFN
FT                   LTAAMEHIFVDGMIGQLSDSWNVGILVFLVVLGSMVMLMNRAGGSAAFGKWAVSHVKTK
FT                   AGAQVATIVLGMLIFIDDYFNCLTVGSVMRPVTDKHGISREKLAYLIDATAAPVCIIAP
FT                   ISSWAAAVTGFVDGANGLSLFIRAIPYNFYALLTLVMMFAITYMNFDYGSMNLAELNHR
FT                   AQLKERKKKDAASLTGAEDQPHPPVSEKGKVSHLVFPILSLIVCCVIGMIYTGGFFDGA
FT                   NFIEAFSNSDASVGLVYGSVVALILTIINYLITRVLSFSECMNAIPEGFKSMVPAILVL
FT                   TFAWTLKSMTDSLGAAEYVGGIVANIADNNTLMGLLPALVFLVGIFLAFATGTSWGTFG
FT                   ILIPIVVNVFGGDINNELMIIAISACMAGAVCGDHCSPISDTTIMASAGADCNHIAHVS
FT                   TQLPYAFTVAGVSLVSYIFAGIIKNWVASLIFGILLMLGTLFVIKLLSKRQVKA"
FT   CDS             complement(302802..303686)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03570"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73309"
FT                   /db_xref="GOA:D4IZM0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM0"
FT                   /protein_id="CBK73309.1"
FT                   /translation="MSIFTGAAVAIATPFNDDLSVNYEKLDSLIEFQIKNNTDAIVICG
FT                   TTGEASTLSHEEHIDVIKHCVQTVNKRVPVIAGTGSNSTETAIYLSQEAEKAGADAVLL
FT                   VTPYYNKATQKGLYEHFKDTADSISIPCILYNVPSRTGCNILPETAVKLAKDVDNIVAI
FT                   KEACGNISQIAKLIQLADGCIDVYSGNDDQIVPIMSLGGLGVISVLSNVAPQQTHDLCK
FT                   ACLDGDFKKAAAMQLKALPLIDALFSEVNPIPVKKALNIMGFEAGPLRKPLTEMEEAHA
FT                   VVLEREMKEYGIY"
FT   CDS             complement(304112..304384)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03580"
FT                   /product="Protein of unknown function (DUF2442)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73310"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM1"
FT                   /protein_id="CBK73310.1"
FT                   /translation="MIKEIVQVVPHEDYTVWVYFADGKITLYDMAPNLEKGIFKKLKDL
FT                   EVFIGKCRIMNDTLAWDIGEAGPEDCLDIDPLMLYDCPEVVDLTA"
FT   CDS             complement(304389..304649)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73311"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM2"
FT                   /protein_id="CBK73311.1"
FT                   /translation="MPVISKFFGIDIMMYYDDHNPPHFHAKYGEYKVLVDINKARVIEG
FT                   FFPSAQMKLVLAWAIIHKEELLEDWKLAQLMEELQKIEPLR"
FT   repeat_region   304675..306158
FT                   /rpt_family="CRISPR"
FT   CDS             complement(306521..307246)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73312"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM3"
FT                   /protein_id="CBK73312.1"
FT                   /translation="MKLTISKGNEKFVMNFNTITQLGGTNIPLKTYVLDSICKHFSSEK
FT                   YKEYEETFINNVEIDGEVPGRKQWECYRISTFEDIITLIQMSKSSILGKCLKEYVGSFD
FT                   CQNELLQIDGILINIFDRLNKSLLGSDIIQFQYSQEDLFSMIQQTSVRTVDDKNIHELE
FT                   IPELFNVFLEVVSKHQELIPEKRLYVFENIDHILSKKEYTEIVSKCIELCKETNLWFIF
FT                   LVPWMNIYSLTRKLLRILM"
FT   CDS             complement(307243..307566)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03620"
FT                   /product="CRISPR-associated protein, Cas2 family"
FT                   /function="CRISPR-associated protein, Cas2 family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73313"
FT                   /db_xref="GOA:D4IZM4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM4"
FT                   /protein_id="CBK73313.1"
FT                   /translation="MITKYMKMLCMFDLPVDTSEQQRAYRKFRKDIMSEGFMMIQYSVY
FT                   VRTCPNRQFANQLEKRLQKIMPKEGNVRLLTVTEKQYEDMKIMVGSKKVTEEALSIERM
FT                   III"
FT   CDS             complement(307556..308464)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03630"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /function="CRISPR-associated protein, Cas1 family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73314"
FT                   /db_xref="GOA:D4IZM5"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM5"
FT                   /protein_id="CBK73314.1"
FT                   /translation="MAFRVVLIESECVVHQKLNNLLIDKGEGDIWIPLDDISMIVLDNL
FT                   KIEVTVRLMSTLAEHNIGVIVCNMEHLPIGFYSSYDNHSRISKCIGFQIEKDQQFYDSF
FT                   WKEVIFYKIKNQRQVLKELKKDDVDDKLNELMEKLTDGDKTNREAHAAKIYFNTLMDTT
FT                   FSRGNEDILLNSGLDYGYTIVRSYFARLCVGYGLNSQLGIHHKNEFNRFNLVDDLMEPV
FT                   RPFVDLYAYRILENEKYFKVDHRRKLVNILNHKVRYMDKNMFLGNMIEEYIVQYAAFLS
FT                   GKREYVVFPEICNYLGEEDDN"
FT   CDS             complement(308646..308957)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73315"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM6"
FT                   /protein_id="CBK73315.1"
FT                   /translation="MISVGQSRKDLEDLGYEFKLSFYKEDIIEYEKNGDILVERFLSRT
FT                   MPQVRNYIETKPIDRPKYDKRNPVGLSKTSSIRKITMDILGNRFYVDKMSFNNVVGTQ"
FT   CDS             complement(308954..309070)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73316"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM7"
FT                   /protein_id="CBK73316.1"
FT                   /translation="MDENQYYLVGIKQSDIKCEGNLFVIDEDKYAETLVNEK"
FT   CDS             complement(309193..309726)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73317"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM8"
FT                   /protein_id="CBK73317.1"
FT                   /translation="MLIAFSQMGYDAYHELTNKYIDFETGEIIDKEGFNELLNNDLVYK
FT                   NTMYESKWLKIKGNIEKAAEKNKYWYQVNKKCNRGLCNQTVYGTRESDGDVYKISKIDI
FT                   RTDDGFKKFKNIVDKGNESVFLMYENDPKTFELIMDIYKNYSDSKNPFVQYEKETGDII
FT                   RKYSKKITGQRFLN"
FT   CDS             complement(309663..311960)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03670"
FT                   /product="CRISPR-associated protein, Csn1 family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73318"
FT                   /db_xref="GOA:D4IZM9"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025978"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZM9"
FT                   /protein_id="CBK73318.1"
FT                   /translation="MGITIGLDLGVASVGWAVVNDDYEILESCSNIFPSADASKNSERR
FT                   GFRQGRRLTRRRKNRIHDFQKLWEDKGFVIPSQGTEDVLAIKIKGLSEKLSVDEVYWVL
FT                   LNSLKHRGISYLDDADSGDNSSDYAKSISRNEEELKEKLPCEIQWERLQKYGAYRGNIS
FT                   IVEDGEPITLRNVFTTSAYKKEVEQFIDTQAKYNAQYSGDFKADYLEIFNRKREYYEGP
FT                   GNELSRTDYGKYTTEINADGEYITVDNIFDKLVGKCSVNPDERRAAGASYTAQEFNVLN
FT                   DLNNLTISSESSFIEDGKLTEDAKRKIIETIKNAKTVNVKKIICDVIGDKKCQISGARI
FT                   DKNEKEIFHSFEAYNKMRRALEEIGFDISSLSRENLDLIGDILTLNTDRESILNAFNRK
FT                   GIELADEAKDILVKVRKTNGSLFNKWQSFGLSIMNELIPELYAQPKNQMELLTAMGVFK
FT                   SRGDRFLECKEIPGDLIVDDIYNPVVSKTVRITVRILNALIKKYGYPDRVVIEMPRDKN
FT                   SDEEQQRLKKEQRDNENEIKDIKARVKTEYGREITEEDFRQHSKLSLKLKLWNEQQGIC
FT                   PYSGKSIKIDDLLDNPNLFEVDHIIPLSISFDDSRNNKVLVYSSENQDKGNRTPLAYLA
FT                   SVNRQWDIHSFMDYVLKTYAGAQKRKKRDNLLNEQDITKVEVLQGFVNRNINDTRYASK
FT                   VVLNSLQEYFSSKECSTKVKVIRGSFTHQMRVNLKLKKTVMNHMFIMQLMQCLLLFHRW
FT                   DMTLIMNLQISI"
FT   CDS             complement(312337..313245)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03690"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73319"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN0"
FT                   /protein_id="CBK73319.1"
FT                   /translation="MLHILFFLGVDLAVIDVFEAPAGRAIWLPIAVIGLPMIFIDRIYK
FT                   YIFEESVVLSILLIMSYFHNDFEHFKNDAYISMAAFFISILSARIILEMRAKEALAMEE
FT                   VTRLSALDKLTHVLNKNALLERIDNYFYRKTPEESCAMCIIDLDDFKLVNDNLGHNTGD
FT                   LLLEKVGQLLIENFRAYDLVGRYGGDEFVVLMPRMSDINILTARCKTLQMYINDLDIGS
FT                   DHRITASIGAVICKGNCDRKVIFSMADDALYKSKIQGKNCSTNWIYEEQESVDKDVLIL
FT                   MAPEKIKESSTCMMVRRTDLK"
FT   CDS             complement(313221..313544)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73320"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN1"
FT                   /protein_id="CBK73320.1"
FT                   /translation="MSGFKRITKKNRDEMEAIKRYFNECLPTIDDNNLHMLRKASMYIS
FT                   FVYIVMLIVGIFAMEAVRLSIYHFVIVPLIIIYVFINMYTLKHRGEISTAKTAAICCTF
FT                   YFS"
FT   CDS             313740..314543
FT                   /transl_table=11
FT                   /locus_tag="CIY_03710"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73321"
FT                   /db_xref="GOA:D4IZN2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN2"
FT                   /protein_id="CBK73321.1"
FT                   /translation="MKTRIKKIVTATLCFTIAFSLVAGSTISAEAKAKKKSKATPKNIV
FT                   VVLDAGHDTTHLGCHYENFEEGIANLYIAYYCKQELEKYSGVTVYMTRTGFDCPYGANP
FT                   DSSADCLTARVNYAKSVKADVLVSLHNDYDPDLDKSQNGAKVIIPNPNYRPDICVTGAY
FT                   LAKSILTQLTTTGLEINDWKLCPNGTGIVTRDSSSGKYPDGSAKDYYALINKSKTAGFP
FT                   TIIVEHAFCTNESDRVNHLSSPEQYQQLGIADATGIAQYYNLKLK"
FT   CDS             314570..315541
FT                   /transl_table=11
FT                   /locus_tag="CIY_03720"
FT                   /product="Ion channel."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73322"
FT                   /db_xref="GOA:D4IZN3"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN3"
FT                   /protein_id="CBK73322.1"
FT                   /translation="MKTLTKKQIFHIIQIGNKGDVASRSFDIFITATILLNVAVMVMQT
FT                   YEEFTPFFPVLDAIAFVTILIFCIEYALRIWTADLLYPELSKAKAIVKFLLSFDGIVDL
FT                   FTILPFFFLSGFVAFRILRVIRIFHLFRINGQYDSFAVIFAVLKEKRNQIASSLVILLI
FT                   LMLASSIGIYYAEHEAQPQVFRNAFSGIWWSVSTLLTVGYGDIYPITTAGRIMAILTGF
FT                   LGVGAVAIPTGILSAGFVEYYAKVKLMTNFAKDEHIDLLTVHITEGHCWNGLKVTEIGV
FT                   PDHYLPAIVTRDGESLIPVPDLKLKIGDTVVLAAEAYFSHTY"
FT   CDS             complement(315554..316369)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03730"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73323"
FT                   /db_xref="GOA:D4IZN4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN4"
FT                   /protein_id="CBK73323.1"
FT                   /translation="MKYKAIALDLDGTLLNSKKEVSKKNKEVLMKAAEAGVNIILASGR
FT                   PVPGIKNIARHLHLEELGGYILAYNGGMIINCKNGEVIRRETVPESCYSDIIHVAKKYG
FT                   VTPLTYDSDGIITTNENDKYVQLEAKINNIPVKQVFHLDETAKLDPPVKFLCVGEHEVL
FT                   QKVQAELNERLKGEVTVFFSESYFLEIMPNGIEKATSLETLLGKIGLDRKNLIACGDGY
FT                   NDIPMMRYAGLSVAMENAKDETKEWADYIAPTNDEDGVATAIEKYVLNS"
FT   CDS             complement(316439..316639)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73324"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN5"
FT                   /protein_id="CBK73324.1"
FT                   /translation="MDVMVSAKDDLEIANEYFDLYMSLRAALRDGKIETTDVEAYLSYK
FT                   EKLLPKKARELAQEMILNVKD"
FT   CDS             complement(316766..317965)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03750"
FT                   /product="Lipase (class 3)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73325"
FT                   /db_xref="GOA:D4IZN6"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN6"
FT                   /protein_id="CBK73325.1"
FT                   /translation="MRKRVLRTIAAALAVSTILVNPMVAEAGSILPAGGDTNYILHTET
FT                   DFKIMDMVYKIQNGETVTIENAAQMATLTKVGYADYQSAGPISITEGRMTYNTCWGTED
FT                   KEVYVVALSGTETIVENQTTTVKEDLLSGFELSNEYKTNVKNAIIDRIPAGSNIILAGH
FT                   SLGGMIAQQVAADKYIKDNYEVLNTVTFGSPLIKGFTREGMVKRLGDTSDKNPFYSISS
FT                   VLNIVWQYAGVNHEDGGYNGDSSAAHCDSYLREDVWGNYDCCGEKKGTTLWVQTGTRML
FT                   TLNFATTSFYTSLYGTTSVAGTSIAPKKTTAECYDLAKQAVADGYMSEDVLNQFTTFVP
FT                   AINEEYVETEVSEVIESDAELVEADITEADSKVEADLVEETTDAEVDNTAVVETEAVAE
FT                   "
FT   CDS             complement(318168..319550)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03760"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /function="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73326"
FT                   /db_xref="GOA:D4IZN7"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN7"
FT                   /protein_id="CBK73326.1"
FT                   /translation="MNKNDIVRLTIEDMSLEGAGIGHTDGVTIFVKDAVVGDVCDVIIT
FT                   KVKKTYCFAALKEVVEASPFRVQPACPNAKQCGGCQIMQVSYDKQLEIKDNIVANNLVK
FT                   IGGYDRAFVDSIREPILGMAEPLRYRNKAQVPIGTDKDGNIIAGFYGARSHRIVPSDDC
FT                   KICSKKSMNIVYAVIDYMKECGVSAYNEATGKGLIRHVLVREGKATGETMVCVVVNGDK
FT                   LPKVDTLVAHVKSVEPELASLVLNINTRRDNVIMGYETKVLYGKEAIRDTITLTNGDTI
FT                   AFDISANSFYQVNHDQMERLYSKALEYAGLTGKEEVWDLYCGIGTISLSMAKHAGHVIG
FT                   IEVVPQAIENAKANAKLNGLDNTEFYCGEAEVVLPEIYEKMSHPDVIMVDPPRKGCDVV
FT                   ALDTMIKMQPERIVYVSCDSATLARDLKHLEENGYHLQKYTVCDQFGHTMHTETVAILA
FT                   KN"
FT   CDS             complement(319550..320512)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03770"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73327"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN8"
FT                   /protein_id="CBK73327.1"
FT                   /translation="MENYMKYINTLKEGDRGTETYLCKKKTQGISKTGKAFESLTLCDK
FT                   TGTIDAKIWDVDSEGISDYDELDFVTVTGDITSWNGALQFNIKRLRKANEGEFDIADYI
FT                   PSSKKDIGVMWNDLMSLINSIKTPYFKALLRKYFVEDKEFIETFKSHSAAKSVHHGFTG
FT                   GLLEHTLSVATNCDYFSKQYPFLDRDLLITAAIFHDIGKVKELSEFPRNDYTDEGQLLG
FT                   HIYVGATMIDRAIDDIEGFPAVKRKELIHCILSHHGELEFGSPKKPAIAEAIALSFADN
FT                   IDAKLETIYEALENVEENNLTWQGFNRLLDSNIRRTGKN"
FT   CDS             320690..322018
FT                   /transl_table=11
FT                   /locus_tag="CIY_03780"
FT                   /product="Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73328"
FT                   /db_xref="GOA:D4IZN9"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZN9"
FT                   /protein_id="CBK73328.1"
FT                   /translation="MDTKKLFPQVDGLLHGGDYNPEQWLDRPDILEKDIEYMKQAGINT
FT                   VTMGVFSWAVHEPTEGNISFDWLAPIMDKLYANGIYTVLATPTGARPAWLDEKYPSAMR
FT                   CDERGVRNHHGVRHNHCMQSPEFREKVRIMDTALAKKFANHPGLLMWHISNEFGGYCYC
FT                   DTCRKKFQEWLADRYDHDINKLNKAWWTTFWSHTFNSFDQIDPPYANGENCVLGLNLDW
FT                   KRFSTWSATDFMRFEIDTLRSAGATEPTTTNFMEMFYDYDYWYMSKFIDIISWDNYPEM
FT                   HNNRQSDADHLLERSFNHALFRSLKPGQPFMMMESAPGVVNWRPYNKYRRPGMHKLISM
FT                   QAVSAGSDTVQYFQIRKSRGSSEQWHGAVIDHIGTNDTRIFKEVAGLGADLKKISEIAG
FT                   TVSNNKVAIIYDWDNRWAIDDAWALSNETKITIRPVWKSTMSL"
FT   CDS             321994..322731
FT                   /transl_table=11
FT                   /locus_tag="CIY_03790"
FT                   /product="Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73329"
FT                   /db_xref="GOA:D4IZP0"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP0"
FT                   /protein_id="CBK73329.1"
FT                   /translation="MEIYNEFMSLGVEPDIVSSHSDWSNYKIICAPMLYVLQDGIGQKI
FT                   YDFVHDGGQFMATYFTGYVNKDLLANLGGFPGDNLDKVFGLRSEEIDTLYPEDEVAVSI
FT                   LDKAGRTAHRIKVHDYQELLRDVNADVLARYDNDYMAGKPAITRNSLGKGHAYYIACRT
FT                   NQHDIEFVYREILEYADIVYTKLPVGVEKHSRYADGIQYDFYLNVTEDTQTLSGIQGTD
FT                   LLSDSEIDGSLNLERYQVAIIKH"
FT   CDS             complement(322780..323574)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73330"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="InterPro:IPR025386"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP1"
FT                   /protein_id="CBK73330.1"
FT                   /translation="MDNKKWTKKYLVLIWLITLIVVVVSIWGHVINWGGFRVLSNSWPA
FT                   GKNVELKTYDFSNEKLTDVAIDMNEADINIKYGDKLSVDASFPEKYEPKVELKGGKLII
FT                   YQRDNVKHISDSDGFKVDIMIPNNTALDNVKIDVAAGDIDIKDVKADNLDINANAGDID
FT                   IKDITAGKIDIDANAGDIDVTNVTSDKVDVDANAGDINLMESTVKSAEVNANAGDIDIT
FT                   GNYDQIDCECDFGDVDINAPNTDRNKINADCSFGSVNIKARN"
FT   CDS             complement(323578..324546)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73331"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP2"
FT                   /protein_id="CBK73331.1"
FT                   /translation="METIRNYLETMFANMPNTPEVKKAKAELLSMMEDKFNEMIADGVN
FT                   ENQAVGTVIAEFGNLDELAADLGLTKEVEATHEREESKPRHFLRMEEVEDYLNVAKGNG
FT                   LLIGIGVLLCITSVTWPILFEFLLRGQLGDGLGVTGMFISIAIAVALFVFAGIRGKDWE
FT                   FLDKELCQIDMATADMVKSKKRAFKVPHAVIISVAIMLFILWIPTVAIDVEIVSNCLFY
FT                   FIGVGVFMIIYASTVMGSYEKVLKLNDSKTISGSYGKDKGDIVYINKFAEGVMEVYWPT
FT                   ITCIYLITSFVTMDWHITWVIWPIAAIAHRLLEVVLAAEED"
FT   CDS             complement(324572..324910)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03820"
FT                   /product="transcriptional regulator, PadR family"
FT                   /function="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73332"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP3"
FT                   /protein_id="CBK73332.1"
FT                   /translation="MGEISSDVIRGYNDTMILSILIKEPSYGYEISKQIKTITEEKYII
FT                   KETTLYSAFTRMEKNGYIESFVADPDPEGNGKKRTYYRVTEAGQAFYREKCDEWELTKE
FT                   VIERFIKK"
FT   CDS             complement(325173..325310)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73333"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP4"
FT                   /protein_id="CBK73333.1"
FT                   /translation="MAIGEIIRCSTIEEVFRKAFDLNRIGIKTEFLSNCTLRVVSIANA
FT                   "
FT   CDS             complement(326632..327912)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03850"
FT                   /product="MutS domain V."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73334"
FT                   /db_xref="GOA:D4IZP5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP5"
FT                   /protein_id="CBK73334.1"
FT                   /translation="MNLKVLKTLEYDKIIDRLAEKATCESGRLRCKQLLPINDIEEIKV
FT                   MQQETACAFNRLIKFSDVSASGTTDLRPSLARLELGSSLSIEEILAVANVLEVTKRVAA
FT                   YGKQMEEEDALSFYFNGLSPEVAILNEIRRCIIDEETIADDASTALFDIRRGMQRTNEK
FT                   IKSVMNSMLNNSTTRGYLQEPVVTVRGGRFCLPVRADYKSRVPGMVHDQSSTGSTFFIE
FT                   PMQAVDLNNEMRELQVREQDEIERILAILSNKIAEASEGIIRNYELLTEIDFILAKGRY
FT                   AIELNASNPEFNEDGIINLRGARHPLLDPKKVVATDIKLGEDYNLLLVTGPNTGGKTVS
FT                   LKTCGLLTLMAQAGLHIPAKDRSQIAVFDDVYADIGDEQSIEQSLSTFSSHMVNIVHIL
FT                   EAINSGSYSKETEKLIAENKRTLYIPR"
FT   CDS             328156..328647
FT                   /transl_table=11
FT                   /locus_tag="CIY_03860"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73335"
FT                   /db_xref="GOA:D4IZP6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP6"
FT                   /protein_id="CBK73335.1"
FT                   /translation="MANIETLEVTDLDECIKVINAFKQYDFFVEYRDEAFLKEYCQKLL
FT                   SNGKFVVEYHNDIPVGFIGFYCNDIETKTCFVTTLLLSDELGFMKGKTFFRLTTKAIQI
FT                   TKDAGMENVRLEVDKENKKALQLYKHLGFEIISDDNDKSYFMELKLNRLTTKLSNKKDQ
FT                   "
FT   CDS             complement(328674..329303)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03870"
FT                   /product="Cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73336"
FT                   /db_xref="GOA:D4IZP7"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP7"
FT                   /protein_id="CBK73336.1"
FT                   /translation="MGDEKKLVISIARSYGSGGLTLAKKLGKELGLPVYDREILRMASD
FT                   QSGINEEMFGEVDEHVRKIFLSAKAHYKGLPLSPEYAAFTSDDNLFELQADVIKRIANT
FT                   QSCIIVGRCADYILKDRAYVLSLFFYASEENCLTRLRRQVSGTDEELLKRMHDIDKHRA
FT                   DYYKYYTGNDWNDARNYDFCLDTGVMDYDRLIEVVKSYIEIKNREI"
FT   CDS             complement(329356..330060)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03880"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73337"
FT                   /db_xref="GOA:D4IZP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP8"
FT                   /protein_id="CBK73337.1"
FT                   /translation="MLEVKDLVVNYGVIQALKGISFEVNEGEVIALIGANGAGKTTTLQ
FT                   TISGMLQPTSGKVMLEGVDITKVPGHKIVSMGMAHVPEGRRVFPGLTVLENLKMGAYTR
FT                   SNKKEIADEFERVYESFPRLKERRNQLAGTLSGGEQQMLAMGRALMSQPRIILMDEPSM
FT                   GLSPIYVEEIFNIIQEISKAGTTVLLVEQNAKKALAIADRAYVLETGNIVLSGDARTLM
FT                   NDDSIKKAYLGE"
FT   CDS             complement(330199..330957)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03890"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73338"
FT                   /db_xref="GOA:D4IZP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZP9"
FT                   /protein_id="CBK73338.1"
FT                   /translation="MALLEVTNLGISFGGLRAVDEFNLTIEQGELYGLIGPNGAGKTTV
FT                   FNMLTGIYKPTDGKIFLDGKDVTGKKTADINKAGVARTFQNIRLFGDQSVLDNVKIGLH
FT                   NSFDYGTATGIFRLPKFFKTEKEMDKKALEILSVFGLDTSADILASNLPYGKQRELEIA
FT                   RALATNPKLLLLDEPAAGMNPNETRDLMNTIALIRKEFGVTILLIEHDMKLVSGICEKL
FT                   TVLNFGRVLSQGRTSEVLNDPEVIKAYLGE"
FT   CDS             complement(330958..332037)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03900"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter membrane
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73339"
FT                   /db_xref="GOA:D4IZQ0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ0"
FT                   /protein_id="CBK73339.1"
FT                   /translation="MSLFKNLNKSTQKLLGTIGVIVVLYIVMTIMDGTGNLSSLMKGLL
FT                   VPVCAYSLVAVGLNLCVGYLGELSLGHAGFMCVGAFSSAFFSRAFQDAIPDVPRYIIAL
FT                   VLGTAMAALFGFLIAIPVLRLKGDYLAIVTLAFGEIIKNVINVMYVGTDSEGMHFSMKD
FT                   QLSMGMALDGKMIINGPQGITGTPRQSTFTIAVLLLILALVVTHNFVNSRTGRAVKAIR
FT                   DNQIAAETVGLPVTKYKLTAFTISAAIAGLGGVLYAHNINSLTATTNNFGYNMSIMILV
FT                   YVVLGGIGNFSGSVVAAVVLTMLPELLRGLSTYRMLIYSIVLIVLMLFNWAPAILKWRD
FT                   EHGLTTAAILGKFKKKEVR"
FT   CDS             complement(332047..332928)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03910"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter membrane
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73340"
FT                   /db_xref="GOA:D4IZQ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ1"
FT                   /protein_id="CBK73340.1"
FT                   /translation="MGFLTYLINGLSLGSVYAIIALGYTMVYGIAKMLNFAHGDVIMIG
FT                   AYVVFMCMSNSGMPAVVSIVISIVCCTALGMIIEKIAYKPLRKATNLAVLITAIGVSYF
FT                   LQNMALMIFGSNPVSFTSVVKWQGISLAGGALKITGNAIITIITCVVIMIALMWFVKNT
FT                   KPGQAMRAVSEDKEAAILMGINVNATISLTFAIGSGLAAIAGALLCSSYPSLTPYTGSM
FT                   PGIKAFTAAVFGGIGSIPGALIGGLLLGIIEILAKAYISSQLADAIVFAVLIIVLLVKP
FT                   TGILGKQIKEKV"
FT   CDS             complement(333014..334201)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03920"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73341"
FT                   /db_xref="GOA:D4IZQ2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ2"
FT                   /protein_id="CBK73341.1"
FT                   /translation="MKKRALSLALCAAMTASILVGCGNNESAPAGGESVDTSGELTWRI
FT                   GGIGPITGAAAQYGQGVMNAIQLAVDEVNEAGGINGYKISFNFQDDEADQQKSVNAYNT
FT                   LKDWGMQILEGTVTSGAGQAVSAETYADRMFMLTPSASSTDVTNGHDNVFQVCFSDPNQ
FT                   GAVSADYIADNGLATKVGIIYDSSDPYSSGVYQTFATEAKAKGLEIVATEAFTADSKTD
FT                   FTTQLQKCKDAEADLLFLPFYYTEGSIVLTQANQMGYAPTMFGVDGFDGLLGVENFDVK
FT                   LAEGVYLLTPFAADSTDEATQNFVSKYEEKFGGTPNQFAADAYDGIYILKEALEASGLT
FT                   PEASTEEICDALISEIQNVNYNGLTGEGMTWNEKGEVSKSPKAVIIKDGAYASVD"
FT   CDS             complement(334300..335004)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03930"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /function="ribosomal small subunit pseudouridine synthase
FT                   A"
FT                   /EC_number="5.4.99.12"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73342"
FT                   /db_xref="GOA:D4IZQ3"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ3"
FT                   /protein_id="CBK73342.1"
FT                   /translation="MMRLDKLLVELNIGTRSEVKALLKKGLIFVDGEKATKPEQKVDEN
FT                   SVVITYQGKEYTYQKFSYYVINKPKGVITATEDAHEKTVMDVFYSLCPDAPKGLAPVGR
FT                   LDKDTTGLLLITNDGQLAHDMLSPKKHVDKTYFVTLDGELSEEDVAALEAGVHIGEGEP
FT                   TAPATVKYEGGKTCYITIHEGKFHQVKRMFFAVGKTVLELKRTAFGPLVLDEEKVPEGH
FT                   FITLNPESFSCK"
FT   CDS             complement(335017..335889)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03940"
FT                   /product="methionine aminopeptidase, type I"
FT                   /function="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73343"
FT                   /db_xref="GOA:D4IZQ4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ4"
FT                   /protein_id="CBK73343.1"
FT                   /translation="MIKINRNDPCWCGSGRKYKQCHEAMDRKIESFAVKGHKVPTHDML
FT                   KTPEQVEKIRQSAVINMACLDAVAEAIHEGMNTAEIDKIVYDTTTKMGGIPAPLNYEGF
FT                   PYSVCTSVNDQVCHGYPSKDVILRSGDIVNVDCSTILDGYYSDSSRMFMIGDVDPETKK
FT                   LVEVTKECCDLGLEQVKPWGFLGDVGAAICKHAHANGYQVVREIGGHGVGLEFHEEPWV
FT                   GYNTLPGTELLLVPGFMFTIEPMINMGTQKIKTDPNNGWEVSTLDGKPSAQWEYQVLVT
FT                   ETGYEVISY"
FT   CDS             complement(335903..336550)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73344"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ5"
FT                   /protein_id="CBK73344.1"
FT                   /translation="MGDGRGPLIYSEHLDDVAVTVDEKEVTFRDLAFYILYEERKVEEQ
FT                   ARIYNPDYTKDYWNLHTNDTFIQEEAKDVVMGMAVHDYLFYQMAVAEGMDTLTASEEDE
FT                   LAFAITDFWEDMLDVQWENLPCDEETINEQIRIVAIAEKYQDYLAKEQGPSQAAYKYDG
FT                   YYYSLIRDEHSVKINKKLWQKFVMGDITLEHTKLNYINGLTDADKEKIKDKR"
FT   CDS             complement(336621..337709)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03960"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73345"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ6"
FT                   /protein_id="CBK73345.1"
FT                   /translation="MKYEKLAKAAVCAVVCISILASDSTVANAVRSIREIEQEQDALQD
FT                   EIDALDADLYALVSQIAEINAEITDTEAEIEDTQASLAEATAAKEDQYAAMKLRIKYMY
FT                   ETPQESVLEMLISSGSITQFLNRMEYANSVYDYDREKLDQFIATQAEIEELAKALEEEK
FT                   VSLEAAKKELKTQEAALEAMVTEKRGEMDDLDAELKLAKEIAAREAARRAAEAAARAAA
FT                   GNGAVKTTGGYNVNGDLNPGYKTGTSGSSVVSYANQFVGNRYVWGGTSLTNGCDCSGFV
FT                   QGVLANFGITYGSRMTSGSFRGVGQEVSYNYMQPGDIVCYPGHVAIYAGNGLIVEAQST
FT                   ATGITNYRPVTCHSIITIRRVL"
FT   CDS             complement(337871..338110)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03970"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73346"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ7"
FT                   /protein_id="CBK73346.1"
FT                   /translation="MEREDFDKVRESVRSQCGSRVVIQLDKGRNKVDIQQGVIQEAYPS
FT                   VFTILVDDTETCPSQLLSFSYTDIITKEIRMKLC"
FT   CDS             338395..339126
FT                   /transl_table=11
FT                   /locus_tag="CIY_03980"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73347"
FT                   /db_xref="GOA:D4IZQ8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ8"
FT                   /protein_id="CBK73347.1"
FT                   /translation="MVRTIFTVLFITIFLIISIPIWAILFILGLFNKRAKDVIDYKIVA
FT                   WAFGVVAFIAGAKYEVHGLENIPKDKAVLFVGNHQSYFDVVIGYHLCPAVTGFLAKDDI
FT                   RKVPLLSTWMVMNYCLFLTRTDPRQDLKLILKAQEHIKAGINMFVFPEGTRSKTGEMAE
FT                   FHEASLKVATKTNSLIVPVCFTNTRQVLEAHMPKCKRAKVIVTFLPPIDPNALEGENKK
FT                   RPGAYIQGIMAKQLEADKKLL"
FT   CDS             complement(339171..340550)
FT                   /transl_table=11
FT                   /locus_tag="CIY_03990"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alani
FT                   ne ligase"
FT                   /function="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alan
FT                   ine ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73348"
FT                   /db_xref="GOA:D4IZQ9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZQ9"
FT                   /protein_id="CBK73348.1"
FT                   /translation="MKNMTLAHVAQVVKGQLILPEGREALKNSEIQGAVNDNRKVEKDF
FT                   LFIPMVGARVDGHDFIEDAFSKGALASLSERKLENVSGPYIIVEDTKLALKQIATDYRM
FT                   QLNIPVIGVIGSVGKTSTKEMLSSVLATKFNVLKTEGNFNNEIGLPLTICRIKDEHQVA
FT                   VVEMGISDFGEMHRLGDIAKPDYVVMTNIGQCHLEFLKSRDGILQAKTEVFEHMPKNGT
FT                   VILNGDDDKLINADTLGLNKIFYGLNGQEVSASDIVAEGMTGTRAVINLFGESFEATIQ
FT                   LPGTHNVMNALAAAAVGKVLGLSNEEIKKGLEKASTIAGRNNVIEVRDITIIDDCYNAN
FT                   PVSMKASIEVLGKAPGRTIAVLGDMGELGDDERQLHYEIGQTLEDNHIGYVFTVGDLSE
FT                   EINNSLSQKNSSCMAHHYTNVEAMLEDLLPIIRGGDTILVKASHFMNFSTVVEAIQTRF
FT                   E"
FT   CDS             complement(340603..341646)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04000"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73349"
FT                   /db_xref="GOA:D4IZR0"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR0"
FT                   /protein_id="CBK73349.1"
FT                   /translation="MDIVVLAGGLSSERDVSFKSGTMVAKALRNRGHRALVLDVFMGYK
FT                   DADCDITDIFENSEANSVKVSDIPTEAPDIKAIKASRPDQSPSFFGPNVIKICQKADVV
FT                   FMALHGGEGESGKVQAAFDLFGIKYTGNDYLSSAIAMDKQMTKNVIEKAGVPVPTGTSL
FT                   KKENRKKFKFDKFPCIVKPNCGGSSIGVTIVNEPEELNAALDAAFEWEDEVVVEQFISG
FT                   REFSDGVIEGKALPIIEIAPKQGFYDYKNKYAAGSAVETCPAEISHKATDKMRKYAVMA
FT                   YKALGLTTYARIDFMMDKDENIYCLEANTLPGMTPTSLLPQEAKVTGMDFEDLCEKLIV
FT                   VSLKKYS"
FT   CDS             complement(341746..342651)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04010"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73350"
FT                   /db_xref="GOA:D4IZR1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR1"
FT                   /protein_id="CBK73350.1"
FT                   /translation="MHKTSFGIFVKWLRKEFELTQQQLAEKLDCAVSTIARFEAGRELP
FT                   SRRIFMKLNSVFETIGIIYDELWMESVFGFKEARKELLEAIKKGRGDEIERKLDKFKEL
FT                   MEEAEGENDEDEKRENMQYYALGHLISIRKRGLSVEQFLDEITQTFELRRKIPDFEDLP
FT                   NVKLSLIEYQMLYEIGEAYRIMGDVNTAEKICKGLLANKIDHRSPFVKNKYIEASFALA
FT                   KVCVTKNDYSSVNDCLEYIFSQYMDKSDTRTFFHSLMIQIDVFEYLGDKTGAELTKQFL
FT                   ESAQKLKRHMHWSSRIHLKE"
FT   CDS             complement(342740..343108)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04020"
FT                   /product="Sigma 54 modulation protein / S30EA ribosomal
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73351"
FT                   /db_xref="GOA:D4IZR2"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR2"
FT                   /protein_id="CBK73351.1"
FT                   /translation="MKGSYLRAEEVTSDMYASIEAVTNTLEAQLKKHRNKIIDRKQSDS
FT                   RVIFAQDFIEEKVADEEKIQIIRTKKFDMKPMYAEDACLEMEMLGHDFFMFRNADTDEI
FT                   NVVYKRKNGAYGLIEPEF"
FT   CDS             343444..344175
FT                   /transl_table=11
FT                   /locus_tag="CIY_04030"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73352"
FT                   /db_xref="GOA:D4IZR3"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR3"
FT                   /protein_id="CBK73352.1"
FT                   /translation="MKHTAIITGASRGIGKAIAKRLAMEGYHLALFCHNNIDLLNEFAE
FT                   ELRQECKVEVYTYQGDISDYGFTIPACEDALAKLGQVDVLINNAGIAHIGLLTDMTIDD
FT                   WDNVINTNLSSVFYTSKAVAPSMVSRRTGNIINISSMWGTVGASCEVAYSASKGGVNSF
FT                   TKAFAKELAPNGVAVNAITCGVVDTDMNGQLSEDEKAELAEEIPVGRFCDPSEIAETVL
FT                   SIINAPSYMTGQIIGVDGGYI"
FT   CDS             complement(344233..345213)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73353"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR4"
FT                   /protein_id="CBK73353.1"
FT                   /translation="MPHVGGQKLKIINEYQILMEESDEHHQINAIEMTRRLKARGIPAE
FT                   RKTVYKDMETLIDAGVDVVKGEKGYYIGSRVFELAELKLLVDAVGASKFISQRKTKALV
FT                   SKLTTLAGVEDAAQLQRQVVVPEKATSADEKIFYTIDVIYQCLDNDRKMSFKYQEWTLT
FT                   KEMKPRHGGKLYVVSPAFLIRNDENYYLVAYDDENEEIRHYRVDKMVSAEMLDKKRGGK
FT                   EERLALNPQEYARKHVSMFAGEECTVTIRYKKKLVGVVLDKFGSEIDVRPDGDEYVKSR
FT                   VSVAVSPQFYGWLTGIGATICFPEEEATKFREYLLGVIDSKGIQL"
FT   CDS             345311..346684
FT                   /transl_table=11
FT                   /locus_tag="CIY_04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73354"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR5"
FT                   /protein_id="CBK73354.1"
FT                   /translation="MSRQDFYKKCRQDYPTFTYQGYYYDLNDTGISMTFDFSIDGLSEF
FT                   HPTWSIPRINKIDSVDEKLIDEMVFSLGMVELISYWKIACPPTVIIKDRKLSNEQIDWW
FT                   KKLYWGGLGEFYYTNGIEENISDFMTVSCESDKPSNPPKFETGNAVNGTPKVLIPVGGG
FT                   KDSVVSIELLKNNADVNCYVINSRGATDATVQVAELTDKTIYAKRTLDKNMLDLNAKGF
FT                   LNGHTPFSALVAFSSIIAGYLNGLSFVALSNESSANESTVADSYVNHQYSKSYEFEEDF
FT                   RYYERTFIGSGVYYFSFLRPLAELQIAMLFSRFKKYHGIFKSCNVGSKQDIWCGHCPKC
FT                   LFVYIILSPFLSLEELDAIFGKRLFEDETLMEDFDKLCGILPEKPFECVGSRDEVNASI
FT                   VESIRKYESEGRALPVLFSHYKASKDTSTSAFKAITTQYSTEHGLNEFFENIIKDALK"
FT   CDS             346686..347975
FT                   /transl_table=11
FT                   /locus_tag="CIY_04060"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73355"
FT                   /db_xref="GOA:D4IZR6"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR6"
FT                   /protein_id="CBK73355.1"
FT                   /translation="MKETIRDLVKDKKVLILGFGREGQSSFRMISSVGGYACLDIADAN
FT                   AVSSDLTAMHNVITGANYLDVLDDYDVVFKSPGIVLPKDIKEYKCHITCQADLFLQVYG
FT                   AQTIGITGTKGKSTTSSLLYHILKTCGKDVLFGGNIGLPIFDITDQIHPRTIIVFELSC
FT                   HQLEYAHYSPSKAILLNLYEDHLDHYGTVEKYWYAKQNLYRNQGYCDFLFCNPDFLPKQ
FT                   GECKAAIIKVKTGDLPFSSFEEIPGVTLRGTHNLFNTAFVYDVCRRYDISDKEFMDALA
FT                   TFKTLAHRLEFIGTKDGVDYYDDSISTTVESCISAIKAIPNAGTILLGGMDRGIDYDPL
FT                   VEFLQTRTLEHIILMYDSGKVLLEKLQAVATPEFMEHVHYIEDLASACAFVKENASKGT
FT                   AVILSPAAASYGVFKNFEQRGDFFKEQIGL"
FT   CDS             complement(348651..348932)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04090"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73356"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR7"
FT                   /protein_id="CBK73356.1"
FT                   /translation="MYALQETIRPSADLRNHYSEISKRCREEKEAVIITVNGRGDTVSL
FT                   SYEEYRRMKARMELLEILAESEEDVRNGRVAPISDTFDDLRNMLEGMK"
FT   CDS             complement(349307..350644)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04100"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73357"
FT                   /db_xref="GOA:D4IZR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR8"
FT                   /protein_id="CBK73357.1"
FT                   /translation="MDKILNKENAFFQKKSIGDITSAVMNDGPIIAESIGISDLMLILN
FT                   IFQIIIIEAVLSYRNHLYGLIELIIGLMYFAILTIVNSKIRLYFKAFYQENANLTQEVN
FT                   EDIRAIYEIKSLNVNDYFLNRFKDLSWNRYYPKAKRIVSVEVITGGINQFMSLLLPMIM
FT                   FIIGVSFASKGKGSLGTAILLFVYTGKMIEPLNNLSDLYRGIKGALGVADRISEYLFDK
FT                   EVNDNEKAIMNSDNPEIDIQIKKMEWENGRSILNNINCKYKAGDVVLLHGESGSGKTTL
FT                   LKTMCGFIKNDNGKVSINSQEINKYDEKTIFEIIKMQFQEPVIISGTVYDNIALGVNYT
FT                   KKEIEEAISFSGLKEYVNEVGLDYMLNANGSNLSGGQKQRIALARIIIRKPKILLLDEL
FT                   TNGLDSQVEDKILDNIAEYAKDNKAIVVISSHRKEVQRICNQDLAV"
FT   CDS             complement(350927..351181)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73358"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZR9"
FT                   /protein_id="CBK73358.1"
FT                   /translation="MYCLEMPLRIAKRNNGQGIVTFPKSNYRFEVNQNVIELFEYLKDE
FT                   NGFEDSVIDEYTYSKNIMNTEDYRRIYEQLKTFGLVRKA"
FT   CDS             complement(351169..352233)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04120"
FT                   /product="Predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73359"
FT                   /db_xref="GOA:D4IZS0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS0"
FT                   /protein_id="CBK73359.1"
FT                   /translation="MNIKWDITYKCNLNCEHCINGDFLGQIEDELSTEEVFNIIEKLAK
FT                   EGVERVHLLGGEPTARKDIKDIFKCFEKNNLEFGFNTNGLKLSDDNLCKEIVSNNALKN
FT                   IVISLEGPNEFLNDQIRGKKVFGITKSNLEKIIKLKEENNRNDLSITVNTVVSSLNIDS
FT                   IPEMIDFCVAERVNQLVLLQMLPGGNAKDKNYEISIEQSLRLVDLVAQKYEEVKKVLEI
FT                   TPRFIPPLAERYANVVLGKEFPKGFQMCGAGTNFFYINNSGLLFPCDRYRGNILEKNKE
FT                   KNLRLQNGDFWNIASNPGYGDIFEITEGDNPFEKCTCNKCDCFRNTCYPCVLSSKMGDR
FT                   LCKTMMEEIEKCIV"
FT   gap             352296..353339
FT                   /estimated_length=1044
FT   CDS             complement(353583..355328)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73360"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS1"
FT                   /protein_id="CBK73360.1"
FT                   /translation="MKYEKDLIGYHILLESVIRDRGVLPEQVGRGLCSSTQMHYILNGE
FT                   RLPDYLMRNRIMARLGISSEGYEDYVQYDEYERWIQKQKLICLIEEAKWEEARNLFDLI
FT                   VTSWNPVSAIEKQFLLDMKARFTEQAGASSKELLSIYEEIVGLTVDKEIFDCDSSRIFL
FT                   SPVEIYYVIKWVSYRVSVSNGTDVREIILKYDRFIDLVEDSALDDIAKAKVLPFADYVL
FT                   FQGVGKANISWDYRKLWEHTERAIRVLKNTERFYYLKELVEAREKLASTLKYHSDELIL
FT                   EKEVVKILDDFEGKYATDIPMSRSGYIYRDSIIYCIADVIHTRRRMFGISRAELADGVC
FT                   TVRTLERIEAKHSKPQMYVMQGLFSKLNLIGAYRRAEIITDDVKMIRTFNKYKVFINQK
FT                   KYEEAFEIIEYLVDKLDKRYIPNRQAIIRMVNVRKRFENGIEKQIYIANLKKAWKLSID
FT                   HNLNQASMFFFTEGEKVLLYNIATQEDFNSCYRRFLDCSLYELKNEVLLSHFPIYELVK
FT                   DWEASMVGNLGEYDDSNDISEKIIRNSFRLKRFHGLYRANYNIYWNNYEAEKKKPHLMY
FT                   IIKVS"
FT   CDS             complement(355465..356019)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73361"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS2"
FT                   /protein_id="CBK73361.1"
FT                   /translation="MYDVNEQVQSVDDLQQQQIALDEQIMELNRQIIQEKDNLSQALEE
FT                   VERLADIAEQIERLEEQEKEYKKNADILAKTEDFLQKSRESFLSKYMQPLQNGLHKYLS
FT                   LLDSPDGTKSGYAIDDFELDMDLNIKLSYSGSTKSAEYLSQGYQDLVALCSRLALVDVL
FT                   YPDEKPILILDDPFTNLDDKK"
FT   CDS             complement(356055..358055)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS3"
FT                   /protein_id="CBK73362.1"
FT                   /translation="MKIVSCYIAHFGKINEFKFNFEDGFNSVLQENGWGKTTFSVFIKA
FT                   MFYGLEYSPNTKKKLLERNHYLPWDGSVCGGNIVFQAKGKEYRIERTFGQSDKDDTFAL
FT                   YDNVTGLLSDDYSENIGEELFRVDRDSFEKSVYIPQTSLATAMTDSLNAKMGNLAAAKD
FT                   DISNFDVALKSVKDAKTNYTRNSKINPGKLYAVKMEINRCKEEYEKLPAIEESVEAMSC
FT                   LVEEKQANIDKLTADKAKLAETIQLQSKKEQELGAYKLHKENLGKELEHMEQLNSFFAA
FT                   GLPTDEELVILEQTERDLSVHERAVNVLNDEQEKETPVFEKPFEDRIPDEGEFAIWNKM
FT                   ASNLSELRAKAEHAKLSEESNRQLTELKFFFDKMVPTDEQLAHIEHQTTLITGISARVD
FT                   QSNERLITLIAERDAEERHSKSKSITVWHILGTILLVIFILTGVVFTRFINDQVGRIIE
FT                   IGSFVAVMLDLLILLITGRRAYKTKMETALDYAERIAEEEDSLEVSKLELRELEEECEE
FT                   FLSHFLLTRASTMQENVYEIRRKLDQYRHLMAEEQSRHQEAEGTLDELADLQLELYTKI
FT                   QPFASAYGINLYDMGGEYEFLAQLKKDAQRYSDYLAKLEEMARHENTIRTMTADINNVL
FT                   KNFPIDESLDRAEKVQVIGIKNESMRQFLSE"
FT   CDS             complement(358052..359137)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04160"
FT                   /product="DNA repair exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73363"
FT                   /db_xref="GOA:D4IZS4"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS4"
FT                   /protein_id="CBK73363.1"
FT                   /translation="MRIIHCADLHLDSKMESNLDRDQALLRRSELIETYERMVEYAEAN
FT                   QVRAILIAGDLFDKPHIRKEVKKRVVEQIVSHPEIDFYYLKGNHDRCDFMEEGIDTIPS
FT                   NFHMFNSESWTSYTCEDVVITGMELNSTNASTLAQRLVLDSAATNIVMLHGQQSDYDGK
FT                   DGAEIVNTTTLKGKFIDYLALGHVHKYIYEQLDDRGVYCYPGCLEGRGFDETGDKGFVL
FT                   MEINDGKIEAEFIPFAKRRLHEIEVNVKAEMDLQGAINKAKRLIDDVDPQDMIKFVITG
FT                   ERELDDELDIVRFVRNFENKYFFVKCYDRTKTMVDYDSFLYDKSLKGEFVRLVQAQDMD
FT                   EDEKAKIIELGIRAILGEDIE"
FT   CDS             complement(359208..361265)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04170"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73364"
FT                   /db_xref="GOA:D4IZS5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS5"
FT                   /protein_id="CBK73364.1"
FT                   /translation="MNFKKIGTKMLVMILPVLVLAQIVLTIMSATSSNALVDEKTQQAM
FT                   EAELKANNSIVGGYLRDVKTLADAIAISVADSYTYTKWDDYEKMLQDMIATNDIVLGSG
FT                   LWFEPYAYDPEQQYYGPYVYKDGNSTVTTWDYSNAEYDYFNQEYYTNAMGSDVAMITDP
FT                   YYDPSSGIVMSSCSTPIIAGGKKIGCVTVDIELTAITDIIGNVKVGRTGVGILTAANGL
FT                   LIAGHDDQMVQDGKSVSEDSNPSFVAMAEDVLKNPSGVTGYQEGKTNYKVFYDTIEETG
FT                   WKFMISIDGYELLQPIYLLINRLVLVCIAAVCLAIIIIIIGIGGVAKTIKRVQKFATEL
FT                   AGGDFTINQLSIKGKDELAVMSNSLNEMYGNNKGVIQSISDYAVEINNSSSNLKVAAGE
FT                   LKTEFDKIVDIMTSVNADMMNSSAATEELSASVDQVAQSADNLNEETKNSLDLAIDIEK
FT                   RATEIGKNSQEAFDKSQTLQASFQEKLEESISQSQVVENIGEMASVIADIADQITLLSL
FT                   NASIEAARAGEQGKGFAVVATEIGKLAGQTSDSVEKIQETISAIKDAFEGLSTNAKSLL
FT                   DYVSDTVTPDYKNFVGVAERYGQDAENIKNSSEQLSIMTDSIQNIMSEVRLALQNIAEA
FT                   TQNTAANSGEVMDSIDHLSGTVSNINDMSDDQNSISDDLSRVVSQFKLSE"
FT   CDS             complement(361345..362109)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04180"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73365"
FT                   /db_xref="GOA:D4IZS6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS6"
FT                   /protein_id="CBK73365.1"
FT                   /translation="MRKILIVGDFSNDTSDVNSYLEQHFHTQLCTDSGKIVKSMLKMYV
FT                   PDLVLMDIDGFENVNEDVFEAIQEYDPSLPVITYGRELKKQMFISYYYSGQCRHIPQPS
FT                   REIIIREICKEFNMNADAIINAIVDTEKKHIIVVDDNPVLLRNMRNMLQDKYRVTLATS
FT                   AAQCMKAMGQDSPDLIILDYEMPVVDGKQTLEMIRAEEDYRNVPVIFLTGIADKEHVDA
FT                   VLDLKPAGYFVKPPMQTKIINAIENIFLKQGE"
FT   CDS             complement(362128..362805)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73366"
FT                   /db_xref="GOA:D4IZS7"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS7"
FT                   /protein_id="CBK73366.1"
FT                   /translation="MIRDFLPEDLLEYHETNATDEARKNRVKQVELPEIEGVDWDYALL
FT                   HFPEANMVFQTAVDYYDSIGYERDEVLRYYNEIDSDSFPIEDYRIKVHAIKSMSNTIGA
FT                   TALGGLAKLCEYAARDNQIDRIKVLTPVLIDEMDIMKDRLSVLSSEVEKPMIEDMDEMF
FT                   ALLEMLKMSLRSHNSDQSDKIMKQIMAFRYPDDIQVKIDQLNIHILNFEEDEAFMDIDV
FT                   LQM"
FT   CDS             complement(362802..364247)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04200"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase./Response
FT                   regulator receiver domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73367"
FT                   /db_xref="GOA:D4IZS8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS8"
FT                   /protein_id="CBK73367.1"
FT                   /translation="MGIIFIFMLLDGMDFVFMLLTDVAIIIGCYVVSYYHPDYVISLDS
FT                   DRSVVFDVIQSLLISAFAIGAIIKFQKSIYVNLYKQASINNDDLLEKTLQAKKAERQAQ
FT                   TATEAKSSFLANMSHEIRTPINTIMGMDEMILRETSEKVVEEYALDIKAASQNLLSLIN
FT                   DILDITKIESGKMGLVNGEYQFMSLMHDVLNNVMIRAKEKGLEVRLNIASNIPCDMFGD
FT                   DVRIRQVLTNILTNAVKYTQEGYIDISATCKRNYDNTADLTFAVRDTGIGIKQEDIKRM
FT                   FESFERLEENRNRNIEGAGLGMAITQNLLKMMGSNLEVHSVYGKGSTFSFTINQEIVNA
FT                   ENIGDFDQKLRQLTSSYEYSTSFEAPKAKFLVVDDNAMNRKVFVSLLKEAKVQIEEAAG
FT                   GEECLAKIKKEHYDMIFLDHMMPGLDGLETFKLMASLEGNKCLGTPVVALTANAIAGAK
FT                   ERYMTLGFHGFLSKPIVPAQLEK"
FT   CDS             complement(364741..365415)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04220"
FT                   /product="Uracil-DNA glycosylase"
FT                   /function="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73368"
FT                   /db_xref="GOA:D4IZS9"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZS9"
FT                   /protein_id="CBK73368.1"
FT                   /translation="MSAISNDWLEPLTPEFKKPYYKNLYESVKSEYHSHQVYPPADDIF
FT                   NAFDFTPLSQVKVVIIGQDPYHEPGQAHGLCFSVKPGVKTPPSLVNIYKELQDDLGCYI
FT                   PNNGYLEKWARQGVLMLNNVLTVRAHEANSHKDLGWEQFTDAVIDILNKQDRPIVFLLW
FT                   GSPAAKKCAKLNNPNHLILKAPHPSPLSAYRGFFGCKHFSRTNAFLKSKGLNPIDWQIE
FT                   NI"
FT   CDS             complement(365426..365953)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04230"
FT                   /product="Predicted small molecule binding protein
FT                   (contains 3H domain)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73369"
FT                   /db_xref="GOA:D4IZT0"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT0"
FT                   /protein_id="CBK73369.1"
FT                   /translation="MDGQARRQKLIEIIQKSDKPVSGTALAKQLDVSRQVVVTDIALIR
FT                   ANGVDITSTNRGYVITNTNKCKRIIKSRHTDDQILDELFTIVDNGGVAENIIINHRYYN
FT                   RLEAPLNVSSRREAKEFMAAIESGKSKSLSSATSGYHYHVISAADEETLDLIEQELKEK
FT                   GFWLPLDSWILE"
FT   CDS             complement(365967..366818)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04240"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73370"
FT                   /db_xref="GOA:D4IZT1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT1"
FT                   /protein_id="CBK73370.1"
FT                   /translation="MNNITMTLNADELIKMALREDISSEDVTTNSVMPEAQPGEVELIC
FT                   KQDGIICGMDVYERVFKILDESTVVEKYVKDGDEVKKGQLMGKVKGDIRVLLSGERVAL
FT                   NYLQRMSGIATYTNQVASLLKGSKTVLLDTRKTTPNMRIFEKYAVKCGGGQNHRYNLSD
FT                   GILLKDNHIGAAGSITKAIEMAKAYAPFVRKIEIETETLDQVKEAVEAGADIIMLDNMD
FT                   VATMKEAVKIIDGRAKTECSGNVTKENIANIIDSGVDYVSSGALTHSAPILDISMKNLH
FT                   AV"
FT   CDS             complement(366843..368126)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04250"
FT                   /product="Aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73371"
FT                   /db_xref="GOA:D4IZT2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT2"
FT                   /protein_id="CBK73371.1"
FT                   /translation="MDKKYDVIIVGSGVGGLFCALSLPREKKILVISKDALDGCDSFLA
FT                   QGGICMLRDEDDYDAYFEDTMRAGHYENRKESVEIMIRSSQDIIKDLEGYGVEFEKKNG
FT                   EFVFTKEGAHSNNRILFHADITGREITSKLLARAKERDNITLKAHTTMVDWVCKDNVCY
FT                   GIVVADMDGKTTAIQGDVTVLACGGLGGVYPHSTNYRHISGDALALAMYHNVKLENCDY
FT                   VQIHPTTLYSNQSGRSFLISESVRGEGAVLRDKNGNRFTDELQPRDVVSKAIFAQMEKD
FT                   GTEHVWLDFSPIPKEEILNHFPNIYARCKEAGYDPLETWVPVVPAQHYFMGGIYVDKDS
FT                   KTTMKQLYAVGETSCNGVHGRNRLASNSLLESLVFAKRAAADIVNTKSFKTSEDFDNLV
FT                   NMDGYQDLTSIMENYHAMVVGEIKKKRI"
FT   CDS             complement(368194..369132)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04260"
FT                   /product="quinolinate synthetase A"
FT                   /function="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73372"
FT                   /db_xref="GOA:D4IZT3"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT3"
FT                   /protein_id="CBK73372.1"
FT                   /translation="MTPACKRRICYEYTGRRNSEVKKEKDAVILAHYYVNDEVQAIADY
FT                   IGDSYYLAKVAVGLKEKTIVFAGVKFMGESAKILNPEKTVLMPDEKADCPMAHMAEIER
FT                   IEEVRREYDDVAVVCYINSTAELKMHSDVCVTSANAMKIVKSLPNKNIFFIPDENLGRY
FT                   IATKVPEKNFIFNDGYCHVHKNVTADMVKRAKESHLEAEVLIHPECTLDVLEYADYIGS
FT                   TSGIIDYATNSDKKEFIISTELGVLYQLKQKNPDKTFYAAGSVQICPNMKKVTLEKVRN
FT                   CLRDGTGVVEVSDEKMEKSLVPLKRMLELAK"
FT   CDS             complement(369232..370377)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04270"
FT                   /product="Acyltransferase family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73373"
FT                   /db_xref="GOA:D4IZT4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT4"
FT                   /protein_id="CBK73373.1"
FT                   /translation="MNNKNRSSNIELLRIVAMLMIIAYHIILHCVNVQLVNVTSIEKLQ
FT                   NGWFNQPMFFKQLMALEMMMPFGLVGNAIFILISGYFLIDREIDMLKISKKLLSQLLFA
FT                   ATALVLASALFIRNYANTDVSENLFSYIRIQYFNKMSWFVGYYFIIMLLAFCFLNRFIA
FT                   TLDRKKYLGFLFTILAISQLSWSGSLLDDLAKGLRTVVIGVFLYSLGGYIKKYNPFDKV
FT                   RGYVIFLVIILINILIGISYHNIVMGKIQAYYYNQTVQSVPATEFTQSIPKFDNYSIVV
FT                   VILGICIFELFRRINLPSLKILNGIAKATFMIYLIHDNGFAYSLWETQDWITLLYEDFW
FT                   GFMAKLGIWTLGVFVTGLVAYYLFVLGEKLLKKCKILFIKE"
FT   CDS             complement(370386..370637)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73374"
FT                   /db_xref="InterPro:IPR023806"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT5"
FT                   /protein_id="CBK73374.1"
FT                   /translation="MEKFTYIPKGVCARQIDFEMEDGKLHNVKFTGGCDGNTKAISKLL
FT                   EGADAARTVEILKGNLCGMKGTSCADQLAKGIEEVLGR"
FT   CDS             complement(370656..371390)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73375"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT6"
FT                   /protein_id="CBK73375.1"
FT                   /translation="MEDVKERFLDFIDWILDRRDDVRDFFKENPNAKRWLIEGCIAIAV
FT                   GILSAVITFNILNHEKKTLAVSEENAATPVQEQSGDENIEAGSSMEEKEEQDYGDVVIE
FT                   VVDPGVYVGDIANWSQEEIAAAVSERAHYLDGNKYWSAVDSYWQTKGISGDARFCTYLF
FT                   DTSSKVYSASDFEGLSPEVIHIAKNELYARHGYSFRDEDLSNYFMGQIWYSPSVMPADF
FT                   SEKTFTETEVKNLDMLNSIDKM"
FT   CDS             complement(372401..372550)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73376"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT7"
FT                   /protein_id="CBK73376.1"
FT                   /translation="MKTIALYDDDSFATEFSAEVIFCEKLEDGYKVVLDKTLFFQSRVV
FT                   RPVM"
FT   CDS             complement(372556..373560)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04320"
FT                   /product="asparaginase"
FT                   /function="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73377"
FT                   /db_xref="GOA:D4IZT8"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT8"
FT                   /protein_id="CBK73377.1"
FT                   /translation="MKKILMIGTGGTIASKQTDAGLTPGLTAEDILAYIPAVKNVCQVE
FT                   TMQVMNIDSSNMTPVMWKDIVNAIEENYASYDGFVVCHGTDTLAYTAAALSYMIQNSAK
FT                   PIVVTGSQKPISKDVTDAKTNLLDSFIYASDDESQNVSIVFDGKVICGTRAKKERAKSY
FT                   NAFSSINFPYLAVIQDGVIIRYIPEVPVRGIPSFYYEMSDKVTLLKLYPGMKPDVLSYL
FT                   FENYDIIVIESFGVGGMPQTLMDTFYEEMEKWKGTDKLAVMTTQVANEGSNMTIYEVGR
FT                   QVKQDFHMIESYDMTLEATMTKLMWLRGLNYSNKRLREAFYTEINRDILFRKN"
FT   CDS             complement(373563..373982)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73378"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZT9"
FT                   /protein_id="CBK73378.1"
FT                   /translation="MNYNVDKIFEDVAYLSKVHSKNEYEGNTRRFKLDRYEELSDLVHA
FT                   DDVETEAKRFCEDIFLSFKKFGKVRGTDQMNLNYFMIYYVFPTILCEEQEGKVICDTLR
FT                   DTWNTYFKCNINYTDYNTLYEGFQTKIFGIPIGKN"
FT   CDS             complement(374058..374120)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73379"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU0"
FT                   /protein_id="CBK73379.1"
FT                   /translation="MLVIKQGLILSGQLMVMVNQ"
FT   CDS             complement(374111..374641)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04350"
FT                   /product="Predicted phosphatases"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73380"
FT                   /db_xref="GOA:D4IZU1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU1"
FT                   /protein_id="CBK73380.1"
FT                   /translation="MGKIKTDGIIFDMDGTIWDNIPVFADSWTRAAKEMGYEIVFTGDM
FT                   LMGLFGKTMTDIADASIPDPDPAKRYKTLELCEEYEMADLAVSDKDTTYPGLEDVLKEL
FT                   SQRTNLYIVSNCQAGYIETYLERTGHGKYFTDFICYGDNGLGKADNIKGLVEKNKIQHP
FT                   VYLGDIQGGQGCL"
FT   CDS             374763..375185
FT                   /transl_table=11
FT                   /locus_tag="CIY_04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73381"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU2"
FT                   /protein_id="CBK73381.1"
FT                   /translation="MNDDEQLLYKRLIELSNRAYQNNIYTFSDFLSLSQQEVMYQAARD
FT                   KGFAPISYDLFGGYENCERKMVRFGSEADFGYDVDFPIKCIKVEPLAKKFAKEYTHRDY
FT                   LGSLMSLGIDRKNSATSSWMAWTLTSMPTNLPPITY"
FT   CDS             375137..375529
FT                   /transl_table=11
FT                   /locus_tag="CIY_04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73382"
FT                   /db_xref="GOA:D4IZU3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU3"
FT                   /protein_id="CBK73382.1"
FT                   /translation="MDAYIYADESTADYLLENFVSVGRNSVKCSISELPESYKRAALKE
FT                   ATIQVASPRADAVIAKVYNLSRKDTIPYFTEKKVSVNGHIVENNDKLLAAGDSISVRGF
FT                   GKFNIVEEGGLSRKGKLNLVVEIFGK"
FT   CDS             378376..379125
FT                   /transl_table=11
FT                   /locus_tag="CIY_04400"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73383"
FT                   /db_xref="GOA:D4IZU4"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU4"
FT                   /protein_id="CBK73383.1"
FT                   /translation="MREFDVEKQTKQLIQYTREWFNKFGDNSRAVIGISGGKDSSVTAA
FT                   VLKEALGADRVVGIIMPNGEMSDLDDAKLLVDFLGIPNEIVPITDYYNAAIATFEKADK
FT                   FEVTKDLKINLAPRLRMSTLYAVAQGQPVTSFVVNTCNASEDYVGYSTKYGDAAGDVSL
FT                   LQDFTVTEVLQIGEYLGLPQQLVHKTPSDGLSGMSDEDKLGFKYAQLDEYISDENADIP
FT                   ADVRASIDRKHVANLHKLQLMPAYHRH"
FT   CDS             complement(381946..382947)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04440"
FT                   /product="Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73384"
FT                   /db_xref="GOA:D4IZU5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU5"
FT                   /protein_id="CBK73384.1"
FT                   /translation="MIELGNTGLNFFARGYIGVEFFFLVSGYLLAASAYAKREQSTEFI
FT                   GTETALMMKKKFWNVFPYHLFATLLTIIVNAYFLEHTALDRYHYVIDSWASIFFLQVFG
FT                   FDSTWVNKLTWYLDVWFMVTFIFYPLLRKYYDVFVKIICPLLALFILGYMAHEYDGIAG
FT                   VDAWTGMFYKCFLRGTSEMALGCCTYSLTRQFNRYDFSKAGRRILGILEVLCYVLVFKY
FT                   ACTEMDVNYSYPVVFVMWVAVILSFSEINPCNEFFDKPIFAWLGRISLTIYLNQFYAIR
FT                   LVQELLDDASFPVKAVACTVVTFLGAFICDKTIGWLKKNKPFSRLIFNSRGE"
FT   CDS             complement(382944..383042)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73385"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU6"
FT                   /protein_id="CBK73385.1"
FT                   /translation="MTKKMDGWSFYVLFLLWQYCSFTFTKDLLMGG"
FT   CDS             complement(383082..383858)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04460"
FT                   /product="Beta-propeller domains of methanol dehydrogenase
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73386"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU7"
FT                   /protein_id="CBK73386.1"
FT                   /translation="MREIRKYLLGLFVIALLMLPMTANAAASNIAITDDASLLSQEEIQ
FT                   KIDSYLQTLNPETNYVVATSDSDDYGFDADSKLEHYYTAAFSNYDDGVAFLIDMENREI
FT                   YISGYGKYEKSISDADALDITDNIYRYASNRDYYTCIIKAFEQADVLTNKGFILRPMRV
FT                   IVALLLSIVIGFLITFFIAMEQRASAKAAFKNSDAMVIMAGASIVGSAAVYDTKRVRRA
FT                   SDNGGGHSGGFSGGGFSGGGGGGFSGGGHSGGGHSF"
FT   CDS             complement(383845..385449)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73387"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU8"
FT                   /protein_id="CBK73387.1"
FT                   /translation="MATMFPCPNCGGQLRFSAEKQQMKCVSCGELTDVDSYKPDDSVGM
FT                   DSVNTKIYQCPNCAGEIQLIDNDGMEFCPFCGTQATMQEHFSDEGVPKFILPFQINKKQ
FT                   AREKYRKLTEKILFAPDGLGDDENIDKLVGMYVPYHLYEYSINDEIIYKGETTRSTADY
FT                   YITDYANVDVKVDVDSLKVPYDASQTLDDCIAAKLEPFPMDKLKSFNPNYLAGFFVENS
FT                   TVDNDLYKDESLDKALSHLMTEVQQRSHGYTPSQGALYDVQTKLTNDLRYDETSGAYLP
FT                   MYFLTTRYNDRVAYSMVNGASGNSYIDMPIEKRKMFSFAIKFSGALFLLILFASFILDF
FT                   SFKVKELCSYGALISSIIGYVGAVLANKTYRADNHLDDKGYFVSLENVKEQSKKKKVKI
FT                   KSQKSMSLNGTLSLALFVLIALSIFVGVMQDAGQFISILPVVLYPASFVLVIMSLFAVK
FT                   KGNKKVMLLGLIGWVYSVGIRVINPPNDIYYYGALIIAFIIILISVNAIIDEYNRFATH
FT                   PSPQFLKKGGRLENARD"
FT   CDS             complement(385472..386596)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04480"
FT                   /product="Putative virion core protein (lumpy skin disease
FT                   virus)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73388"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZU9"
FT                   /protein_id="CBK73388.1"
FT                   /translation="MGLIQAFKGSVSGELANQWKEFFVCDSVSNDVLLKRATHKVSGRS
FT                   SNTKGDQDVITKDSVVIVNEGQCALLVDSGKIIDVAAEAGAYTWEENGSASIFAGNFAE
FT                   VFKEFGRRFTFGGEKPVQQRVYFVNTKDITGLKFGTPTPIPFRVLDANIGLDMDTTLKC
FT                   NGNYSLKVSDPTALYTNLAGNVKDEYTIEDIQDQLRATFVQGLQPALGKLSGMGIRPSA
FT                   IPNYTKEISDAMAEELNYEWTDKYGLSITSVQILATVIPDEDAATLKELQKTGAFRNQA
FT                   MAGATLVQAQAEAMKAAAGNANGAAMGFFGMNMAMQAGGANANDLLNQGALQSQQNPQQ
FT                   GMQMGQPQAGRWFCPNCGNENYGNFCVNCGTKRP"
FT   CDS             complement(386698..387120)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73389"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV0"
FT                   /protein_id="CBK73389.1"
FT                   /translation="MTRRKLFIGCRIVDLLEIIFFTLVAFAFLKAIGVSMILKVAVTLY
FT                   GIYMWVEGIAGNSVVRYGKIAYWVYYFVFLFACIALPRLGYFIPSFGTPLAVLWDFFIN
FT                   PFFNQGIVWTAILVFDLLGLIVNWLTFRKIPVNYSA"
FT   CDS             complement(387146..387367)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73390"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV1"
FT                   /protein_id="CBK73390.1"
FT                   /translation="MSRDIKAILHIKKYNELFNIFMVAIIVAAMLLMIVFFSTDTSFET
FT                   DSLSMMLAGGIIGGYVGTSMFLRFFHCR"
FT   CDS             complement(387380..388030)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73391"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV2"
FT                   /protein_id="CBK73391.1"
FT                   /translation="MNSLSARTRKYYFLAGLKLFGYVAAVQLLLVVEWIFFGAEEADIV
FT                   GYVSQNIITFNAMFMVLFNMMFAIYGPNWYDSMVLSMGARRRDVFWGQLIKQCTYVGLS
FT                   TILSIVLCVVFKHENFMGYTIVAVAAAMILGALGLAIGYKVKKYGKIVIFILLIIVGVQ
FT                   AGIWGFVLAAGIKLPISSLNSYIMLSIIGVGAVVVFTLLELWAYKLNQKCMVN"
FT   CDS             complement(388032..388910)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04520"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73392"
FT                   /db_xref="GOA:D4IZV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV3"
FT                   /protein_id="CBK73392.1"
FT                   /translation="MGTLSGKNIVKKYGKDTVLKNVDIDIETGKIYGLIGRNGAGKTTL
FT                   LSILTAQNPATEGTVTLDGKPVWENEEALSHICYSREIPQVTMFGPNTLKVKDYLKTAK
FT                   VFYKYWDEEYAKELVKLFNLDAKKKVSKLSKGMLSSLTIIIALASKADITILDEPVAGL
FT                   DVVAREQFYKLVIDEYAQTGRTFIISTHIIEEAASLFEEVIMLDEGQIVLKENTEELLS
FT                   RAYRVSGETEAVDTAVEGYKVYHPESIGRNKVVTVLADEPIEGFDGDVQVEPVALQNLF
FT                   YAMCVDGRKEA"
FT   CDS             complement(389481..390440)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73393"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV4"
FT                   /protein_id="CBK73393.1"
FT                   /translation="MSYSEYVAHYFEMPQCIIFFLLTSVLLAVVYVIFYLYAKNTTKQD
FT                   DFFEQKFFSLSERYYELIFSGGSIIGFMAVYFLINLFLGPGELKNIWDSYKDYLLLIFM
FT                   IISILLNSFCDHVLVRLKHLDRDDMASIRLTGMAYMILILCYLKFIYESNNYDTLIAYF
FT                   LTLMIGRFVYFDASFKDFLNCIKNAAANIPIMIMALANLAILCAYGYSTEYLLKHNGVI
FT                   TNIFFVHLYIIVAIFLWHFIPARLVAKKKVKNLDKPKTPDRKRRREERETERTHRARED
FT                   RELERTHRNRRPHNQERFPDYEEDYSQEEEIDIEIIDL"
FT   CDS             390650..392035
FT                   /transl_table=11
FT                   /locus_tag="CIY_04550"
FT                   /product="Predicted Zn-dependent proteases and their
FT                   inactivated homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73394"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV5"
FT                   /protein_id="CBK73394.1"
FT                   /translation="MLEDILGKSKSLFETGAQSVLRGQENRLRSVVINQGVLVVNTRSE
FT                   ESGVCAKVYKNGVNGFASMAEYSEAAAEQVIKAATTNANYLRKYAQTQKGVLPSISSQI
FT                   INSKRFIIDFEQKRIIDICQDIDAYIVKHCPKITSRMVNYREDTMEKFIYTSDACDGHV
FT                   AYPRCRILFILKMEALDGSTVELHEIAGGFGHIEDHFQNLDYVYRKVDETYKRLCDKAE
FT                   GVYAEAGEKTVILHPDVAGMIAHEAIGHTVEADLVLGGSVAGQNLNKKVASDIVNIVDF
FT                   ANTYQGEQAPLPVYIDDEGIPAKDAVLVKDGVLTGFMHNRESALHFGVEPLGNARGHVF
FT                   SDEPLIRMRNTTVLPGKDKLEDMIASIDDGYYLLNTGNGEADLTGEFMFGITCGYEIKH
FT                   GKLGKAILDTTVSGIAFDLLKTVDMLSDEVTWCPSGTCGKKQLMPVSMGGPAVKCKINI
FT                   GGR"
FT   CDS             392037..393344
FT                   /transl_table=11
FT                   /locus_tag="CIY_04560"
FT                   /product="Predicted Zn-dependent proteases and their
FT                   inactivated homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73395"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV6"
FT                   /protein_id="CBK73395.1"
FT                   /translation="MSDMTKITKAADYLSGLLKEKQNLKAQFEISEITTTEITVENGDF
FT                   SLLRTMFDKDVAIKVLVDQKPGTTSINSFEEADIKDALENAITSSASAVADDCFNLAPA
FT                   IKGEEFTRGPLEPDMDTLMSRTAELKEAIAKEYPNILLMMGIVEHVRTDSMYRNTNGTE
FT                   DVVHSGVYNIYLEFAGNDGNNTSGISGSSISIETLDTPFIELGRIRKDLEDAEKSVAPT
FT                   SVDGKFEGKIIFTPECFKNALNTYMQIALSDIVIVDNSSLWRNKIGQKVAADSFTFSVK
FT                   PWDKRIIDHEYHTADGFRSEDYTIIENGVLKSFATSLYGANKAKVERAGNTSAAYVVEP
FT                   GTTSLDDMIKNIDRGLIVGAISAGAPGVNGEIAGVAKNAFYIENGKIVNAVTETMISFN
FT                   VVNVLNNIVDISKEVLCNGDFVIPYICVDGITISGK"
FT   CDS             complement(393385..393765)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04570"
FT                   /product="Bacterial membrane flanked domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73396"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV7"
FT                   /protein_id="CBK73396.1"
FT                   /translation="MADILWHDRKRHFGLPLSFTKYSMSEDRLFVETGFLNLTQNEVRL
FT                   YRILDLQLKRSLGQRIFGVGSIFVSSSDKNLGTFEIRNIKHSANVKEMLSVQVEQQRES
FT                   KRVVGREYMGGDVDFDDDDEMH"
FT   CDS             complement(393809..394099)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04580"
FT                   /product="addiction module antidote protein, HigA family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73397"
FT                   /db_xref="GOA:D4IZV8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV8"
FT                   /protein_id="CBK73397.1"
FT                   /translation="MAVTIQTPTIGEILKEEFMDPLGISAYRLAHEIFVPVSRIQDIIH
FT                   GRRQITVDTSLRLGKFFGVSDNYFLKMQDDINLRNARIELEDELSKIQMYK"
FT   CDS             complement(394126..394407)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04590"
FT                   /product="Plasmid maintenance system killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73398"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZV9"
FT                   /protein_id="CBK73398.1"
FT                   /translation="MISEFKNIATQRVYEQHFVKSIPNNVARIALRKLIMIDNANCIND
FT                   LRVPPGNRLEKLSGDREGQYSIRINDQFRICFKEENGDFFDVEITDYH"
FT   CDS             complement(394462..396486)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04600"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73399"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW0"
FT                   /protein_id="CBK73399.1"
FT                   /translation="MESKAVPFFSLIPAGISFLMLRINDKLSDFAWAVLLAVVLRIIFV
FT                   YLPSREIIIRYGSFILACIAVFMCIYWNSFWGDSILDKLVFIALAVLVFSSLQQIIWGR
FT                   KDGGFPFEYFALLGVLLIVIPIKQEPLDWTRLEEYFGNAADATGYYFSSVFSGSEYTTG
FT                   YGSLNVTGGTISRSDKLQLVLESVEKPYFVYTDSETGKKMKMRRTLYLSGGRGVDGKAL
FT                   VEWLQFLKDNGVDKEEANVFSQISKLELEYVYLSTADEIAPAGALVIKNDEGYVTEGKG
FT                   DSKHKKGYKLKVKYLDIDYGSPYLQALYEHPAGALVDRDRMTYAETSDYFKELYNQDLF
FT                   DVMNEKEYIGYCDNSIINELYSETTGASERMRELAEKITAGVDNDYDKAKLIEKYLRKY
FT                   EYSIYAAGGHNPDSDMSTAEGMADIADRFLFETEQGYCVHYTSSMVMLLRLAGIPARVA
FT                   NGYRYSFPFDVQENYVVEANCAHVWPEAFIENVGWVPFEPTSAYTTAAEYTWHRKGEKE
FT                   LEAEILKQELENQDVPEIPEAEETQIETTYRTASYQLLKIIGVVVLSIALLIILIMVFA
FT                   EMYRRIHYKLASPEEKIRIDVGLIKEQLCKRAEGKISDRGLISDYLKLVPEEKKEVLQK
FT                   VFDVFYRVEYGDLENHPVTVEENDLVMNERIILNARSKK"
FT   CDS             complement(396649..397677)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04610"
FT                   /product="Uncharacterized conserved protein (some members
FT                   contain a von Willebrand factor type A (vWA) domain)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73400"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW1"
FT                   /protein_id="CBK73400.1"
FT                   /translation="MGLVCSVIFASFYGGPVSYVWLYGMLLIIPFSCFYTLLNYKFLNI
FT                   FQEIEVHKVTRGEEHRYRVLFENAGILPIHRMGIFTLSDRCNLYEIEDGQEISLAGHEK
FT                   QEIFSGISCRYAGAYNIGIDRIALSDPFYIYTIELDVPYSFRAIVRPQITDVATKFLDI
FT                   ENLINNTGLKSNRLFEEIPGSDIRAYQKGDSINTINWKVSARLGDLVVRTPDRMEKRTV
FT                   TILMEAAKQPDNQEDLEFLKQRDIFLEFVVSAAWHFGQQGVPVRLIYPSGDVKESIVDS
FT                   GESFLDFYSVVADDIFYGSEKTFKEIQRLSSERRMSSYDNETWIIIKESPMEGESNCLI
FT                   CD"
FT   CDS             complement(397746..398681)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04620"
FT                   /product="MoxR-like ATPases"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73401"
FT                   /db_xref="GOA:D4IZW2"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR016366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW2"
FT                   /protein_id="CBK73401.1"
FT                   /translation="MNEKVVRLKAAIEQRIVGKGDVIDKLIAAFLAEGHVLLEDVPGVG
FT                   KTSLAKSLADSVALSFARIQCTPDTMPSDITGVSIFNSKDQSFQVVPGPVVNNIVLVDE
FT                   LNRTSPKTQSALLQVMEENQVTIDGKEISVPNPFMVIGTQNPMEMAGTYPLPEAQLDRF
FT                   MMKLSVGYPNADASNDMVSRFLEGQLHQETKPVLSGDDINEMRTQVKAVTIKDNLRDYA
FT                   VNIVEATRNNSEVACGASPRALLSLLRCAQAIAFMADRDYCIPEDIAEAAKLTLPHRII
FT                   LTSEAKLSRTTKEFLITSILQQVKCGQATN"
FT   CDS             398932..400314
FT                   /transl_table=11
FT                   /locus_tag="CIY_04630"
FT                   /product="Condensation domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73402"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW3"
FT                   /protein_id="CBK73402.1"
FT                   /translation="MKKYPLTPAQKIHYNWIRKYGTQQVSGLSIVASLQANLDFDLLKK
FT                   CIQLEIKRYGCMRVRFTKPDKNGDILQYLSEDENYDIPLKDLSEMTMDKADETMQSWAY
FT                   NTFDGDDIPMFEIFLMKLPDGYNGFFLHMDHRLIDSCGVTVLTNDIMSLYTHFRFDAPM
FT                   PADLADYETVLQNDLKKISNEKRFLKDKKFWDDLLDKWGEPIYSDIAGPAALENSRLTH
FT                   NNSALNCADIELKNLFVEVKNYKLEEAGAKQLFDFCQNHLLSMTNLLLLGIRTYLSKVN
FT                   NGQKDISIQNFISRRSTHDEWTSGGSRTIMFPCRTVIEDDTDFLEAAYQIQNMQNQIYM
FT                   HSNYDPDLIYEEIEKRYGTPQNTTYESCYLTYQPLPVKMENPYLKDIPMYCKWFANGAA
FT                   TKKMYLTVSHTEDGGMNFSYHYQVADLTEKQVELFNYYLMRIIFRGVEQPNLTIGEIIN
FT                   IV"
FT   CDS             400335..400574
FT                   /transl_table=11
FT                   /locus_tag="CIY_04640"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73403"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW4"
FT                   /protein_id="CBK73403.1"
FT                   /translation="MSMEKQFKELVSQYCQVSPDNLKGDSRFREDLDFSSLDFMSFLGE
FT                   LEDEFDIELQQERIVNIRTIDEALSVIQDLQEAS"
FT   CDS             400574..401521
FT                   /transl_table=11
FT                   /locus_tag="CIY_04650"
FT                   /product="Long-chain acyl-CoA synthetases (AMP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73404"
FT                   /db_xref="GOA:D4IZW5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW5"
FT                   /protein_id="CBK73404.1"
FT                   /translation="MDNLRTLWENAAKSYKPLTAIRYLDKKEIKEVTYDSLDKMIRLIR
FT                   GGLAKTGISSDHVALIGETSVQWVASYLAIVTGDNVAVPLDALLPAEDLIDLLNRSHTK
FT                   VLFLSPKLIGLANQILKQCPNLKQIWLLNDSYDQFVQNGQIGALAELMNLGNTSVDVKA
FT                   SAPNDLTTIIFTSGTTGKSKGVMLTQKNLFDNVANVHYQVDPGCVMMSVLPIHHAYCLV
FT                   MDWLKGFSLGAIVCINDSFMHMIRNMSIFRPEVILMVPLMIESIYKRLSANPDVPVEAV
FT                   KENVFGGNLRIVFTGGAHLDPFYIEEFKNMILIY"
FT   CDS             401533..402129
FT                   /transl_table=11
FT                   /locus_tag="CIY_04660"
FT                   /product="Long-chain acyl-CoA synthetases (AMP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73405"
FT                   /db_xref="GOA:D4IZW6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW6"
FT                   /protein_id="CBK73405.1"
FT                   /translation="MSECSPVITTNTPEFHKPGSIGKPLDNVEIKIENDEIMVRGTSVM
FT                   KGYFEMPSETRAVFTDGWLHTGDKGYIDEDGYLFINGRVKNLIIMSNGENISPEEIENK
FT                   IALNPLVSEVIISGNNTGLTAHIYPDMDYAQRQLLNSVDINNELQDFIDKYNKAQPSYR
FT                   HITSLVIRTEPFIRNTTGKIKRKDPSILYEGQNAV"
FT   CDS             complement(402518..402673)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73406"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW7"
FT                   /protein_id="CBK73406.1"
FT                   /translation="MNELDERYTTSEEAIIDSFFILSSEKEFEKITVSDVVKKIRCCSQ
FT                   YLLQSL"
FT   CDS             complement(402752..404434)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04690"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73407"
FT                   /db_xref="GOA:D4IZW8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW8"
FT                   /protein_id="CBK73407.1"
FT                   /translation="MYMKDYERWLAADLEDCDLKPELTKINGNEEEIKDRFAVALAFGT
FT                   AGLRGVLGAGTNRMNIYVVRQATQGLANWVKTQGGNQTVAISYDSRLKSDVFAKTAAGV
FT                   LAANGINVRIYDALMPVPALSFATRYYKCNAGIMVTASHNPAKYNGYKAYGPDGCQMTD
FT                   DAAAIVYAEIQKTDVLTGAKVMSFAEGVEKGLIKFVGDDCKDAFYAAIEERQVRPGLCK
FT                   TAGLKLVYSPLNGSGLVPVTRVLNDIGITDITIVPEQEYPNGYFTTCSYPNPEIFDALK
FT                   LGLELAKAEGADLMLATDPDADRVGIAMKCPDGSYELVSGNEVGVLLLDYIAAGRIEKG
FT                   TMPKNPVAVKSIVSTPLADAVAENYGVELRSVLTGFKWIGDQIAGLEADGEVDRFIFGF
FT                   EESYGYLAGPYVRDKDAVIGSMLICEMAAYYRSIGSSLKQRLEEIYAEYGRYLNKVDSF
FT                   EFPGLSGMDTMAGIMSSLRENAPAEFAGIKVTKVTDYKNTAETGLPSANVLIYGLENGC
FT                   TVVVRPSGTEPKIKTYFTTKGKDLAEAEAMKDKLADALKPIFK"
FT   CDS             complement(404571..406706)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04700"
FT                   /product="Phosphoketolase"
FT                   /EC_number="4.1.2.22"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73408"
FT                   /db_xref="GOA:D4IZW9"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZW9"
FT                   /protein_id="CBK73408.1"
FT                   /translation="MILISGPGHGGNFFVANTYLEGSYSEVYPNVSRDVAGMQKLCKQF
FT                   SFPGGISSHVAPENPGSIHEGGELGYSIAHSFGAVFDNPDLIAACVVGDGEAETGPLAT
FT                   SWQSNKFLNPITDGAVLPILHLNGFKISNPTILARMSHEELVSFFTGMGWEPHFVEGDD
FT                   PKEMHKKMAETLDVCMDKIKANQKHARETGDATRPVWPMIILRTPKGWTGPKVVDGNKI
FT                   EGSFAAHQVPVMMDKPEHMEILEKWLKSYHPEELFDENGRLIPELEELAPKGDRRMGAN
FT                   PHANGGKLLHDLRLPDFRDYAIDVPAPGAVEKQDMIELGGYIRDVFKLNEEQKNFRIFG
FT                   PDETMSNRLNKVFEVTNRDWNSPIEEGTDQFLAKDGRVMDSMLSEHMCEGWLEGYLLTG
FT                   RHGFFASYEAFIRIIDSMAAQHAKWLKVCNSLPWRRPIASLNLLLTSNVWQQDHNGFTH
FT                   QDPGFLDHIANKKADVVRLYLPPDANCLLSTMDHCLKSKNYVNAIVASKHPRPQWLTME
FT                   QAVKHCTQGIGIWDWASTDKGQEPDIVLACCGDTPTLEALAAVDILHKEMPDIKVRFVN
FT                   VVDLMKMEPSNKHPHGLSDVEYDSIFTKDKPIIFAFHGYPTLIHELTYTRHNRNIHVYG
FT                   YHEEGTITTPFDMRVQNKIDRFNLVIAMLNNMPEMENKGAFLKQKMRDKLVEHKTYIHD
FT                   IGVDMPEIAEWKWTGLK"
FT   CDS             complement(406784..406936)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04710"
FT                   /product="Phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73409"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX0"
FT                   /protein_id="CBK73409.1"
FT                   /translation="MNHNEITEEYLAKMDAYWRATNYLAAAQLYLLDNPLLREPLKREQ
FT                   VKKKS"
FT   CDS             complement(407154..407840)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04720"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73410"
FT                   /db_xref="GOA:D4IZX1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX1"
FT                   /protein_id="CBK73410.1"
FT                   /translation="MTLGIIGAMQMEIENLKPSIKNPVLETISGATFIKGQINGIDVVA
FT                   AVSGVGKVFAAVCTEIMVLHFGVDHIINIGVAGTLVKDLKVLDVAVAESAVQHDMNTSA
FT                   LGDPIGLISGINVVNFESDKKLTQIVCDVLKDKGINYQTGVIASGDMFVDTDKQRDRIR
FT                   QSFNAIACEMEGGSIAHVCYINNVPFTLIRSISDGDGSAMDYNTFAGKAAEQSISIVLD
FT                   VIKRLK"
FT   CDS             complement(407983..408444)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04730"
FT                   /product="LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /EC_number="4.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73411"
FT                   /db_xref="GOA:D4IZX2"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX2"
FT                   /protein_id="CBK73411.1"
FT                   /translation="MERIKSFTINHNILTPGFYISRVDDGDIITYDLRTRKPNAGDYMD
FT                   NATMHSVEHMIATYIRNSEIADHVIYFGPMGCQTGFYLVVKGVDSKKTFEVVKKVFEQT
FT                   VNHDGEVFGKSAIECGHYENLDISLAKKECQRYLEVLNSWTNMEFTYPE"
FT   CDS             complement(408538..409620)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04740"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73412"
FT                   /db_xref="GOA:D4IZX3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX3"
FT                   /protein_id="CBK73412.1"
FT                   /translation="MIVTDIIRAIVVAAVASLFLVDLLQPWMLVISTLIISTVEAFRGP
FT                   ASTSLTPMVLADELYEFGMSLSSSLSQIVQLIGLGCAAGIIALVGISGALYIDMATFIM
FT                   SAAIILFVNSHETKKEKVVFKFSEYTKDFIDGVKYVSKEAIIVFFLLYTVCLNAVLVPI
FT                   NGLQAPMAEQLLHSGVEVLSIFSITITVGMLLGSFVYPFIAQRITTKILYWGEMVAIFA
FT                   FYVGIVVAEPLYSSKIFTYVIVSVLSILLGMGVSIGNSMISVIFMRNVNKEYIARAAAI
FT                   ATSVSVMSMPVVSFIVSGVVTFVSVQTVFIVSGIVVLVADVALSKFLYLFDEKSEEQSE
FT                   QFTESIQSEDDNEPQEAIEA"
FT   CDS             complement(409620..409862)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73413"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX4"
FT                   /protein_id="CBK73413.1"
FT                   /translation="MDKKHSYKDVFSQTEYVKIMFAALINRFGDSIDAIASTWIVYQIT
FT                   GSAAWSALIFGINNLPTVVVTPLAGPWVEGKTKSE"
FT   CDS             complement(409901..410458)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04760"
FT                   /product="DJ-1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73414"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX5"
FT                   /protein_id="CBK73414.1"
FT                   /translation="MSKVLIFMAEGHEEIEALTVVDLLRRAGIEIETVSITSNRMVPGS
FT                   HGIVTVCDQLIEEVDFNSADMLVLPGGMPGTLNLELCQPLMEQVHKFNNAGKNIAAICA
FT                   APTVFGKAGLLKGKKATCYPGMEGDLDGAKFSTDEVCHDGNIITSRGLGTAIPFALEIV
FT                   RTFQGDGAADRLSKAIVYKSAL"
FT   CDS             complement(410663..411001)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73415"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX6"
FT                   /protein_id="CBK73415.1"
FT                   /translation="MKDICTIEAQAKQFGEMMEHTVSAIRDDTINNKKATLALLDEKRA
FT                   KLLVEKYEELHRLMEELEAQSLRENNIKDLRNYTLIGAISEYDCKYNRGEEHKGLEEKN
FT                   WIFSMGME"
FT   CDS             411189..411341
FT                   /transl_table=11
FT                   /locus_tag="CIY_04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73416"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX7"
FT                   /protein_id="CBK73416.1"
FT                   /translation="MKKINTFLLIFGVILSTVVMPAVQVTTGTQAQGQFITAEPNSNLE
FT                   VEYVL"
FT   CDS             complement(411512..411754)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX8"
FT                   /protein_id="CBK73417.1"
FT                   /translation="MTMVTDTYKNIVLLDFFKELFDKNNCNNLGKESRAILLRWMSDRY
FT                   EKIGDFYFLIDMLECHYRWIWKIINSGLHTNVCMI"
FT   CDS             complement(413190..414020)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04820"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73418"
FT                   /db_xref="GOA:D4IZX9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZX9"
FT                   /protein_id="CBK73418.1"
FT                   /translation="MKKRFLSIGDYSKKVGVSPEFLKFYEKKGLVSPAWKDDRSYRYYG
FT                   DYQVTHFLEYQQLSRMGVSLDDAKEIKEHANLKDRLEIYKKACDEKRQELEQMELFLKQ
FT                   IEDTSFAMENIINKRGWRIAEVPIAYFVYPKSFDNSESLKNPVWKDNFSMNITQYVKLK
FT                   DRNCDRLEAGNFERYWGAVQPFSNIIYKEAISNPNNGITVIGGAKCFVYEYAIPTDYDE
FT                   EGKLSDKVWDLSEPLRILKEHGLKNKGVVWQKRLCVSHEADGEFLQVQTIIPIE"
FT   CDS             414165..415868
FT                   /transl_table=11
FT                   /locus_tag="CIY_04830"
FT                   /product="Carboxylesterase type B"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73419"
FT                   /db_xref="GOA:D4IZY0"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY0"
FT                   /protein_id="CBK73419.1"
FT                   /translation="MKKRLSKIMALSLAIAMVSSSSLTVLAAPEATTNVSVENNVAATS
FT                   LVKQTQYGAVKGTSTDTCNVWYSIPYAAAPTGDLRWAAPTAPASWATPLDCSKLGNKAI
FT                   QSGTDYATGKTVVSGSEDCLNLDVYAPANANNLPVMVYIHGGNNQTGSSTEIDGTQITV
FT                   DENCIYVSLNYRLGILGFNALPAFHTTEDSTGNYAMLDIAMALDWVRNNIAQFGGNPNN
FT                   ITVSGFSAGGRDVMTMLISPLFEGKFDKAVVYSGGMTVADEEESAEIMAKAVAPLVVED
FT                   GLFADTETAKSWLLSNDPAVVKYMKGIDADRLCQLMSNAGIRMSVFPHLYADDVVIPSE
FT                   GFKTTKFNNVPVLMLTGETEFSLFSAYDGYFSGADMKALDAKTQNLAKSYAIEYGSEMY
FT                   RIFNAQCSAEEMYGKYKNNMYLCQVRYGSNDSATRIPLMGSFHGIFVPMLTNNHSYGSF
FT                   ADFSNAGYQNMAHVFDQYLTNFMVTGNPNGEGLNKWSNWTSANPVSLVLDADSEKAIVS
FT                   LENVSSSYGKIIGQMSSDDIVSENVKDLMGKNVLNGRWFSSTLDNYYKNK"
FT   CDS             complement(415940..417400)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04840"
FT                   /product="Carbon starvation protein, predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73420"
FT                   /db_xref="GOA:D4IZY1"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY1"
FT                   /protein_id="CBK73420.1"
FT                   /translation="MISFLVCLAVLIGGYFVYGRIVEGIYGPDDRETPAVRINDGVDFV
FT                   VMPKWKLFLIQLLNIAGLGPIYGALAGAQWGTSVFLWITLGTILAGGVHDFSVGFMSMR
FT                   HDGASVSELTGIYLGNIMKTIMRIFSVVLLVMVGTVFAVGPAGLISLLIGNHGGSGLLT
FT                   NTYFWLAIILIYYFIATFIPIDKIIGKLYPVFGICLLVMAVGVGIGIVTHGYTIPEIQL
FT                   SNLHPANTPIWPMMFVSVACGAISGFHATQSPLMARCCKTEKESHMVFYGAMVCEGVIA
FT                   LIWAAAGSAVYARTGGLTVGLTEMLANGQATCVYDICTKTMGGVGIILAMLGVIACPIT
FT                   SGDTAFRSARLVIADWFKIEQKHYRNRLYICVPLLAAGALISQLNYGVIWRYFSWSNQT
FT                   LAMIALWTASMYLYKNAKNYWITVVPATFMSAVSVTYFFCAPECLHLSTTIAYPIGLIA
FT                   ALIFLGLFFHATVEHHEFFKHFHLHHHA"
FT   CDS             complement(417564..419618)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04850"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73421"
FT                   /db_xref="GOA:D4IZY2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY2"
FT                   /protein_id="CBK73421.1"
FT                   /translation="MRFKKLSVRITFYIIIATAIGIIVQNLIASFSMYNMMRDNAEKTL
FT                   TGFVEQITARLDAYTQKQYAYLDGFMISKEMASLKEYPEDSAIQETAEIYTKEYMKAIP
FT                   NSKSLFYVEYNGKVLTHTNSDMIGYQNDPDRIKMIQGLYYNDEGKTVYNSVTAVSPATN
FT                   EISIIFARSSYKNNGQPAGYCSVEIDTTEFYEILEKGIHLAENQDVILTGVRNPTVYYS
FT                   SNPDEITLAPENPAVLSVMEKISTGTDETIEGVVRYDQVGTGRPMYGYYEYLPENDWLL
FT                   FVGTDTNEFYGQAYAATNKMVINGLIIIILIGLLLVLIIGHMIKPISKIQEALSKVAAL
FT                   DLSDSNEIVGFEKRADEIGKLAADTKRVIFSLRGAVSVFKEYSNVMDGSAGDLDDASKV
FT                   LADITSENKSIADNLAVKINETNDAIETVHAEIENIVSLVAEVSTKVEEGQSDSEDLIK
FT                   SASEINEKINDEIQKNMATLQETMASMQEALESLKAVEQINELAEDIMSITSQTNLLSL
FT                   NASIEAARAGEAGRGFAVVAGEIGALADQSKETAMNITEIVAASNESVVNVRNQVSNLI
FT                   DFIKNDVIASFEVFSAQSEHYDEGISTIKQAVADIGDVMNNLSASVDEIAKQIESVNDA
FT                   SVENTEGVASILGKNTQTDELSQGIENLAKETKNNANDLKVAINQFNVD"
FT   CDS             complement(419773..420036)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73422"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY3"
FT                   /protein_id="CBK73422.1"
FT                   /translation="MALAPINGINSYSQVASVQQYPNANVKTESIEKEQLIDPTAMLEQ
FT                   RRKTANAFNEIASQFKTANTGYSKAGIGNSYGMAGNRFDAFA"
FT   CDS             complement(420192..421115)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04870"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73423"
FT                   /db_xref="GOA:D4IZY4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY4"
FT                   /protein_id="CBK73423.1"
FT                   /translation="MALDAIQKNILHEVADLDSIPQGAYNIRANGASAGRNTTANIDIV
FT                   SKEDKPGIDIIVKAGTKGESVHIPVVLSESGLKDMVYNDFYIGEDADVTIVAGCGIHNC
FT                   GDQDSQHDGIHTFHVGKNAKVKYVEKHYGEGDGKGARILNPVTEVYQEEGSYVEMEMVQ
FT                   IKGVDSTVRTNLAELKEGATLLIHEALMTHGSQTATSDYKVALNGEGSSADVVSRSVAK
FT                   DDSEQIFEVSIEGNTACNGHAACDAIIMGNAHVVAIPKLDAKNVDAALIHEAAIGKIAG
FT                   DQLIKLMSLGLTEEEAEEQIVAGFLR"
FT   CDS             complement(421115..421855)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04880"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73424"
FT                   /db_xref="GOA:D4IZY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY5"
FT                   /protein_id="CBK73424.1"
FT                   /translation="MLEIKNLTYRVDDEGDTTKEIIDGLNLTVDDGKFIVITGPNGGGK
FT                   STLAKLIMGVNQLTSGQIILDGVDISDKNITERAKMGISFAFQAPVHFKGIRVIDLLRL
FT                   AAGENISVAAACEYLSKVGLCAKDYVEREVNSSLSGGELKRIEIATVLARGTKLSIFDE
FT                   PEAGIDLWSFQNLIKVFENMRKTINGTIIVISHQERILNIADEIVVIENGKVKKQGPKD
FT                   EILPGLLGTDSAASIACEKLGGDE"
FT   CDS             complement(422039..422755)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73425"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY6"
FT                   /protein_id="CBK73425.1"
FT                   /translation="MSNKKKFLRTVTVIMLFVLCLVPLQNAEAQESVETIETVEQQDDI
FT                   VLQQQIAQVTAEQATRQLVIIGDSRTVGMKSAVGKNANVWSAKVGMGLSWMKKTGVPAV
FT                   ESAINANTDVVILMGVNDVRSLSYTGKYTEYINEKAAAWTALGANVYYVSVNPMAFETK
FT                   AYPGITNDLIESWNTRMQQGLSENVKYIDTYSTMLGNVQSKDGIHYNKTTYQTIYTLIN
FT                   QGIINDKVTEKMAELC"
FT   CDS             423856..424629
FT                   /transl_table=11
FT                   /locus_tag="CIY_04910"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73426"
FT                   /db_xref="GOA:D4IZY7"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY7"
FT                   /protein_id="CBK73426.1"
FT                   /translation="MLANYHTHTVRCNHAIGTEREYIEEAIKNGFKILGFSDHTPQPYP
FT                   EDFYSRIRMKMSEVEDYTSTLVKLREEYKNDIQILIGYEVEYTHEYFDKLIEYLRQYPL
FT                   DYIIQGQHFAPNEIDGFYSGSETTDEAKVKEYVDLTIEGMQTGLFSYLAHPDLMNYVGP
FT                   DKVYQHHMKRIVQASIDLDIPLEINMQGFFLNRNYPSDRFFSIASAMGARFVIGCDAHH
FT                   PEDVMQPWQMDGLMEFLERNNIEFGDNVIELRPVK"
FT   CDS             complement(424643..425275)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04920"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73427"
FT                   /db_xref="GOA:D4IZY8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY8"
FT                   /protein_id="CBK73427.1"
FT                   /translation="MKRILLIDDDELITMSLEMIINAEEGFEVIGKGNSGREGVKLYDE
FT                   LQPDLLLMDIRMADMNGLEAAEEILAKHKDAIILFLTTFSDDEYIVKALKLGVRGYLLK
FT                   QDYKSLPAALHAAMDGQSVFGGAIVDKLPALMNSATEEDSGFDYQSKDISEKEYEVIQL
FT                   VAEGFSNKEIAQKLFLSEGTVRNYLSTILEKLELRDRTQLAIFYLKN"
FT   CDS             complement(426150..426260)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73428"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZY9"
FT                   /protein_id="CBK73428.1"
FT                   /translation="MLFDVIIRVLAALGLTVLINASGITTLSVVMSICVF"
FT   CDS             complement(426250..427413)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04950"
FT                   /product="ABC-2 type transporter."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73429"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ0"
FT                   /protein_id="CBK73429.1"
FT                   /translation="MSVFNAIIKSLKANITTIIVYLAIFTVFGNMQAKATVSTQETTFE
FT                   EAIIRVAVTDNDKSQLSKAVVDYLAETQEVVDPKTDDPQVMNDNVRFLIYDYALIIPEG
FT                   FEEQIKSGNAEDALTYIVPGTTMSQYLLTQKLNDYMQDIVIYLNSGYSEEEAIDLTHEQ
FT                   MVELSKTQATVIDEQEENHRSFFTGMFTFNGYTMMMLLCICGACTLTFMKDRDVSNRIS
FT                   VSGMHFFTRNLATIAAVFFIGFVITTVVIIVIQLMGLEYANDKLLYYAIDTYTLMFVGL
FT                   GMAYFICSITSNENLINMVANMFVLSMSFLCGVFVDTEYLSESIVKAAHFMPLYWYTTT
FT                   IKFINDTPINNIWSRQFGTYLMIEILFAAAFFMAGMIISRKKEQYAI"
FT   CDS             complement(427400..428545)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73430"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ1"
FT                   /protein_id="CBK73430.1"
FT                   /translation="MFGRIFVYKFKEIIRNRYMVGWNFLFPIVLATVFYMGFGNLIKDD
FT                   PDNFHTIEAGYVNTNQEESNFEKVLEDLEEETDGNVPILSLRKYDTRQAAMDAMNSDEV
FT                   FGFYVEDGDEIETIVPKNGYHATIMNQIVREYDNKKNVVETIAKDHPEKIQAAMDMVTD
FT                   NITIMKEHDFGNNTSPYVQYFFALIAMSSLFSSWISTAILEGICANMTERGKRFECSPT
FT                   SKLMTILAGICAAMVMQSVSNAVVVIYVQEILKISLGAPLWNIILITTLGSAVGVSSGV
FT                   LIGSLIKNEKLLIVVPLCFTMTCSFFSGLMWHQIRQYIESRVPIFNRINPASLLVDCLY
FT                   TRATYGKTSMYYQDIITMSCMVIGCLIISAFLLRRRKYVSL"
FT   CDS             complement(428545..429486)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04970"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73431"
FT                   /db_xref="GOA:D4IZZ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ2"
FT                   /protein_id="CBK73431.1"
FT                   /translation="MSQCVVEIENLVKRYGDKVAVDHFSLNVNEGEILGLLGPNGSGKT
FT                   TTINCLLSLLQYDKGTVTIFDKEMKPEAYDIKSQIGVVMQNVAVIDTLNVYENVDFFCG
FT                   LYIRDKATRKQYVEEALEFTGLTEYKKYKPKKLSGGLLRRLNIACGIAHKPKLIIFDEP
FT                   TVAVDPQSRNAILEGIKKMNKDGATIIYTSHYMEEVEELCSRVVIMDHGKNIANGTTSE
FT                   LKSSLMNRETIRVNLPNKNDEVIKGLKEINHVYKIKEDGDDLVIKCDGGDHNLVHVLSY
FT                   LTDNNIPFGHVSTELPTLNDVFLEITGKELRD"
FT   CDS             complement(429611..431176)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04980"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73432"
FT                   /db_xref="GOA:D4IZZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ3"
FT                   /protein_id="CBK73432.1"
FT                   /translation="MSILNVEHLSHGFGDRAIFEDVSFRLLKGEHIGLVGANGEGKSTF
FT                   MNIITGKLQPDEGKIEWSKKVRVGYLDQHTVLEKGMTIGSVLHSAFDFLYDMEQEMNDI
FT                   YASLGDVTDDDEMNKRMEEAGTIADLLTMHDFYMIDAKVEEVARALGVLDLGLDKDVTE
FT                   LSGGQRTKVLMAKLLLEKPDILLLDEPTNYLDVEHIEWLKRYLNDYENAFILISHDVPF
FT                   LNSVINLIYHMDNKQLNRYVGDYDKFQEVYAMKQSQLQAAYNRQQKEIAELKDFVARNK
FT                   ANVATRNMAMSRQKKLDKMDMIELAAEKPKPEFYFKEARTPSRVIFSTKELVIGYDKNE
FT                   PLSIPLNLEMQRKQKIVLTGANGIGKTTLLKSILGLIPPLSGTVYQGEFLEIGYFEQEM
FT                   DQHISTTCIEEIWNEFPSYNQNEVRAALAKCGLTTKHIESLCRVLSGGEQAKVRLCKLL
FT                   NRETNLLLLDEPTNHLDVDAKDELKRALKEYNGSILMVCHEPEFYEGLATDVWDCSKWT
FT                   TKTI"
FT   CDS             complement(431210..432073)
FT                   /transl_table=11
FT                   /locus_tag="CIY_04990"
FT                   /product="Predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73433"
FT                   /db_xref="GOA:D4IZZ4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ4"
FT                   /protein_id="CBK73433.1"
FT                   /translation="MKKGLVMEGGAMRGIFTCGVIDVLMENGIEFDSAVGVSAGATFGL
FT                   NFKSKQIGRPLRYNKIYCNDKRYCSVRSLFKTGDLYNVPFCYGTLPYELDVWDVDTFYN
FT                   NPMDFFCVATDINTGKAVYHNCNNRDESRDGIDIKWIRASASMPMFSRPVEIDGGLYLD
FT                   GGMSDSIPLRFMEDQKCDRILVIETQPADYVKKPQKYMGLVKLMLGKYPNMIKVMKDRY
FT                   IMYNQEKAYIREKEQAGEVFVIRPSVAPNIHPTEKNPEELQRVYEMGRAEAIRSLEGLK
FT                   QYLAQA"
FT   CDS             complement(432138..432860)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05000"
FT                   /product="Predicted membrane protein (DUF2154)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73434"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ5"
FT                   /protein_id="CBK73434.1"
FT                   /translation="MTKSKIRNIIRGLALIAFAVCLLLSRSNYFTEFPMVKMAVCIIMV
FT                   VVFVEQLVERSFLGMSIPLGVMTCLFQSELGLGDIHFAIIMLAFVLIGAGLSLIFGKKS
FT                   HHINIVSNGDSHTVDVSGKAEYWEDEGNFDLDNSLGSRTQYIKINDMKKGSIDNALGQL
FT                   TVYFNGTTVDQNGAILDIDNGMGSLSIYFPRDFRVSFNCDNGMGKINMHGECSQDMSQP
FT                   LIKANVDNGMGTIDFYFE"
FT   CDS             complement(432857..433318)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05010"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73435"
FT                   /db_xref="GOA:D4IZZ6"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ6"
FT                   /protein_id="CBK73435.1"
FT                   /translation="MKINIDVDDSLQQDMITIHCKEITEEILELQRLLSSRQMGAQKIS
FT                   AYIDDTEYYVEVKSIIFVEADGNYISIHTGKSIYRVRQKLYELEEILPREFTRVSKSSI
FT                   VNTDLISSIKKNITGASEISFRNSTKKAYASRNYIKALIEIMDEKRIKR"
FT   CDS             complement(433469..434488)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05020"
FT                   /product="Uncharacterized membrane protein (DUF2298)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73436"
FT                   /db_xref="InterPro:IPR018746"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ7"
FT                   /protein_id="CBK73436.1"
FT                   /translation="MVIANVVILPFKLNFTKMEGGIFLCENHTLFHQLLVLWLLPVATA
FT                   IVCIVYAIKDYLKDEDRNTNKNINVLGRIILNANIADLMVMLFACCSIGLIIIPEIIYV
FT                   KDIYNIDYARANTTFKLTYQSCIMLGIITGYALISLFCYKPKKSKRIWGWVILVPTLVC
FT                   MSYFFVSCHSWFGNIADTTRPRTLNALAFMDNNPQFFEDKEVVDYLNNLDYEKPPVVLE
FT                   NYGDAYSDAGRMSVASGCPTVLGWYAHEWLWRFSQEAVEERATDIREIYTGYDVETTKE
FT                   LLKKYNIQYIYIGAFEYEKYDFAGTPINLYKLLQLGDVELQLESSVYGGYHNYLIKVK"
FT   CDS             complement(435890..437422)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05040"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73437"
FT                   /db_xref="GOA:D4IZZ8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ8"
FT                   /protein_id="CBK73437.1"
FT                   /translation="METLLSVITAVCGKIQVVSDLFWDFPTNFDWYANIPILGNFSLAI
FT                   ILLIGSGIYFSIRLRFIQVRKFKRGIEVLKNSKAKTGISPLASFFLSTAMRVGPGNILG
FT                   VTGAVSVGGPGALLWMWISAFFGMSTAFVESTLSQIFKEKKDDEYIGGMAFYGRRLLKN
FT                   SAIVGVVLSLMYIIYALLCFPAQGFNTVSAMGQIASIISGTELPTTHAVYWIGFVIVII
FT                   ATVAVSFGGTKKISHVTDILVPVMAIVYVLTVLVLIVINITRIPWFFYAVFTEAFKPEA
FT                   VFGGAFGIALMQGVKRGLMSNEAGQGTITMPAAASDADHPCDQGCVQAIGVFLDTIVIC
FT                   TLTGFVVIMGRVWLTDNGAAWFELGKLPKYLASAAELTPGTAFNNVVTLLISLCFGLFA
FT                   FTCLLGFMSFSEICANRINRSKAFINVVRVLDIIVICFGMLTSIVGMDLGALWDLSDFA
FT                   NILIAYCNIPLLYIGFKYVKKAQMHYELEDGTPFTSKVVGIDVSVWDDKANQ"
FT   CDS             complement(437541..438026)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05050"
FT                   /product="ybaK/ebsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73438"
FT                   /db_xref="GOA:D4IZZ9"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IZZ9"
FT                   /protein_id="CBK73438.1"
FT                   /translation="MKSKDKTNVMRVLDSKKIKYESHTYEADSTLTGEQIAGILGEDAK
FT                   KVFKTLVTQGKSGGYYVFVVPVEAELDLKKAAKAAGEKSISMIKQKDLLGLTGYVHGGC
FT                   SPIGMKKQFPTFIHETAGSYEMMFVSAGKVGAQIELSPEDLLKVSNGKLADLVSIEC"
FT   CDS             complement(438048..438674)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05060"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73439"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:D4J000"
FT                   /protein_id="CBK73439.1"
FT                   /translation="MLMAAVSLFVNGFGVYLTIQANIGASPWDVLNLGLSNTFGILYGT
FT                   AAIIVSFSILGIDILMKEPIGIAMIIDSIVVGKTVDLFNRINLVEKCDSIFLAIPMMIL
FT                   GLFIMGYTQFTYMSASLGCGPRDTLLIGLTRRTKHVSIGLVSIMLLATATVVGWLLGGP
FT                   VGIGTIICAFGMGPIMQFAFFTVKFNATEIRHQTIIETLKVMNPC"
FT   CDS             complement(438777..439406)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05070"
FT                   /product="Uncharacterised ACR, YkgG family COG1556."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73440"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="UniProtKB/TrEMBL:D4J001"
FT                   /protein_id="CBK73440.1"
FT                   /translation="MNENITKRNQLLAQKVIKGLESRNMKGYYAADKEEALKIALELIP
FT                   ENSSISMGGAMSAHEIGLVDALKNGNYNFIDRDAAEDKRAAMLEGYDADYFLTSANAMT
FT                   EDGVMVNIDGNSNRVSAIAQGPKHVLVIVGMNKICDDVDGAMKRARNVAAPINAQRFGL
FT                   STPCAKTGSCMNCKSPDTICCQFLITRYSRHTDRIHVILVNDTLGF"
FT   CDS             complement(439424..439798)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05080"
FT                   /product="Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73441"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4J002"
FT                   /protein_id="CBK73441.1"
FT                   /translation="MKLRNILIVVKDIEKSKKFYHDLFGLDMLLDNDGNMILTEGLVLQ
FT                   DEAIWKKFLGKDIKYQNNATELYFEERNIEEFVEKLERLYPDIKYVNRLMTHSWGQKVI
FT                   RFYDLDGNLIEVGTPMSEKI"
FT   CDS             complement(439841..441229)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73442"
FT                   /db_xref="UniProtKB/TrEMBL:D4J003"
FT                   /protein_id="CBK73442.1"
FT                   /translation="MFKNRLKNDKGDIYVRRKYLIIIPLILLVCVAGVLIFLKSRITFY
FT                   EDSYKRNYTYSGVFDTITADYNGCKYNFESNIVEEKEAKKLVKDFDESRKQIIRSSDKV
FT                   TQEKLNIYVVADDRIVGPVVEDDALFLSKKYLDEYDYRYWFVQLMLKKGLCKESFDEYK
FT                   NIFNVESAEQPVIFSTTGFSEEQLETVDETELFINGDNNCIFKTDGSEFIINSNLIDDS
FT                   TYEKIIDLIQVESITKENLKKLLKDINIDQSMYGGNVDDITYHIENKGGRSYTSIDSDG
FT                   KIDITLNNLTIRTLEHELMHGFFVDYSDLNKYWIEEGFCEFVAYILYPDNKLVEGISKM
FT                   SVDDSYEDGDFKRYLQSKNYDDNDIVRLYFDYVVNRLYQGKDVSDYPKLKEKVATNFGP
FT                   NEQSKYYGLDLSYTEAMSFTAYLIDLKGLDGLFDFMASDKSYEEFFGKSYVELENSWKQ
FT                   SVSE"
FT   CDS             complement(441229..441585)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73443"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J004"
FT                   /protein_id="CBK73443.1"
FT                   /translation="MDNRSLILKEHIESNEEYVRATNIIFSIVNVNDLADAIIELISNN
FT                   YTGIINISEDEPISHYAFNKALCKMYGWDDSCIVPNIEKENIYYLNNSLRKTILKTKIG
FT                   NLIEAEDFDFKRGR"
FT   CDS             complement(441591..442055)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05110"
FT                   /product="NAD dependent epimerase/dehydratase family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73444"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J005"
FT                   /protein_id="CBK73444.1"
FT                   /translation="MKILILGASGFLGGTIYFKLKNVGNDVLGTCNKNTNNTNLIEQDV
FT                   FDVDSLLHLVNSYKPDVIIWSIMNHQQEEEIAENVMPILCEAIGDIRFIFISTSVAYEP
FT                   NMSEDVKPLLRDETSYNHHYFNGKIKSEENIKNSQIIVLFAQEVFTVSIL"
FT   CDS             complement(442160..442657)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73445"
FT                   /db_xref="UniProtKB/TrEMBL:D4J006"
FT                   /protein_id="CBK73445.1"
FT                   /translation="MKRKIIFLDIDGVLNSNDFKEELNKEYSIDADKVKMLASIVEKTN
FT                   AEIVLHSAWRFWFDEKFNPIEKGGEILSQAFLTNNLRISGVTPDLSTEEIRKTKKFSKV
FT                   KANEIKNWLIKNQDVDNWIVIDDLNLNDEDIRRCQIRPDSKIGLTEDDIGVAIKLLLDN
FT                   EE"
FT   CDS             complement(443278..443922)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73446"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J007"
FT                   /protein_id="CBK73446.1"
FT                   /translation="MVFQDNIIKEYLSNVYFITGTPCGGKTTVSRALGKKYGLPVYDID
FT                   EMFPTHQGIADEAHQPNMLKEFRDADEFFGRSVEEYKAWLMGNLREQLDFIILDLIKLS
FT                   QTGKVICDCHFTMDQIKRFSDSSRVAFMITDPSDLVETYCDRADHQDFSDFIHSATDYE
FT                   KAKRLCTQTLYELNMEPYTDIKNSEFFWLERETLGSVNDTVAIVEKHFGWK"
FT   CDS             complement(444820..445806)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73447"
FT                   /db_xref="UniProtKB/TrEMBL:D4J008"
FT                   /protein_id="CBK73447.1"
FT                   /translation="MRIGESNVNSYSSRQYSKTYGGGVAQGASFGGFVESRVEKEQTNY
FT                   GAEGKVKTQDGREIDVDLKMEMARTKKHDTFIQMSSPLDALCDPLIINIDAKSASLSDS
FT                   KFKFDLDADGKDDEISCLGKGSGFLALDKNGDGHINDGTELFGVKSGDGFKDLAEYDKD
FT                   NNGWIDEDDEIFNDLKVWYRDENGIDRLIDLKEAGVGAIYLCSESTEFTMEGNDEALDG
FT                   KLRRTGFFLKENGEAGTIQHVDLAIKGRENELLTVEEQMEQVLDNIKSNQSRSRRNNNN
FT                   AQREAKARAQKAAKRKADLKKHYEKQEEYRKMVKEWHESKPNQNLLN"
FT   CDS             complement(445903..446613)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73448"
FT                   /db_xref="UniProtKB/TrEMBL:D4J009"
FT                   /protein_id="CBK73448.1"
FT                   /translation="MNFGMDYFSLLTGGINSSTNSILNQYGKQKVGKNSKGNGIQKSYG
FT                   AFSTIDNSKVFGSLYKMASKTNDKILNGASKADTAGRQLSNKSIYQDGNRDSLYSNAKN
FT                   LIDGYNEIVEGTSNSSSVQISNRASVMKRIALTNKADLEKVGISYDFKTGALSMDEEKL
FT                   KSADAGDLQRVFGTNGSFGQNVRASAVVTQNTAASSMYQQNGLAGLYNSYGMNGKYSAL
FT                   NNYGLSSFFGSWFI"
FT   CDS             complement(446716..447396)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05170"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73449"
FT                   /db_xref="GOA:D4J010"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="UniProtKB/TrEMBL:D4J010"
FT                   /protein_id="CBK73449.1"
FT                   /translation="MAGVPKVKEQELENQKIIASTNYAKKYIEDLDSYHTKIRILRHDM
FT                   AGKLTTLRGLIESHSNEEVIEYLSQMGIELNSTMHRFNTGNALIDVIVNEKSALAEEKG
FT                   ILFESDFLWSNAISILPYDIGVIMTNLLDNAITECMEYNHERRIILRGIKKDSFFIVEV
FT                   KNTFTGTITKFDDGLPVTTKSGEHGLGLKSVKQIAEKYLGGITIENKDGWYSAMVMLQN
FT                   LDQL"
FT   CDS             complement(447342..447710)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73450"
FT                   /db_xref="UniProtKB/TrEMBL:D4J011"
FT                   /protein_id="CBK73450.1"
FT                   /translation="MESVYNQLTIWIVIMAFIYVVCVTFELVIVKRIVRKKYLMTVKQA
FT                   CLLSVYSVVALLMMYMLSEISIIPLDKEVFIFSEQDISIRIKLPVMGVLLFLGQLSGVV
FT                   LWQEFQKLKNKNLKIRKL"
FT   CDS             complement(447740..448102)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73451"
FT                   /db_xref="UniProtKB/TrEMBL:D4J012"
FT                   /protein_id="CBK73451.1"
FT                   /translation="MTEATFQIIQKIYELTLILIQLGIIVSLFFIFVPNEGITIRKRNL
FT                   FIATISVERLLICFVTAETKGVFLVISAVTVLLFFIREIGKCCHCWYFFISYGIVFLVF
FT                   ALFLQGFYLIVFLIFF"
FT   CDS             complement(448486..448860)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05210"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73452"
FT                   /db_xref="GOA:D4J013"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4J013"
FT                   /protein_id="CBK73452.1"
FT                   /translation="MVVGICDDEIIVRESLEKYVSELLGTAKCVQFSSGDEILHYYLCP
FT                   DKPEIDILLLDLAMAEMDGMVVAETIQAKIKEKEQSVRITKPLIIFVTGIQDRMAEAFN
FT                   VNAFDYIVKPINKDKFKIQY"
FT   CDS             complement(448972..449817)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73453"
FT                   /db_xref="UniProtKB/TrEMBL:D4J014"
FT                   /protein_id="CBK73453.1"
FT                   /translation="MYGMSVQQAIFNYSSSVIQGMQKYTKINSSNSSFSETLSKIDSAK
FT                   SSGRKRIQPEESTVDKYISKHKDRKADVDKMVSAGENVIKQYLGENYNPDDLTLEEYKS
FT                   LINDVISKIPYDSSQLNDVEYINITEYGYKQMKSDPKYEAWVLGYFKIDRAVHFPIGAQ
FT                   GHYHAEHFGASIEEHHGEGYPLEFADSKDDESWWEKRQKRHDMLMELMEKYYEKRHMER
FT                   EAATKKNAERMIASDTFSLFGAKGVDNVFSETSYLGGEISAAAEFFMMMFTGTGNGAAQ
FT                   "
FT   CDS             complement(449986..451386)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73454"
FT                   /db_xref="GOA:D4J015"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D4J015"
FT                   /protein_id="CBK73454.1"
FT                   /translation="MTDFLTENSLYYQSSSFSSSYFFTNQNYKNYDFKNAIETSTNETL
FT                   NDVDASFEDDSKGKTSYTRIVSVSVMTSQMSAIASSDGGTAYSYQGVMQKFEIRIDVNG
FT                   DERKYTATGTDKDGKEFSKEIDPYNVDPTDADFTEFVALCSYIRDTENLADETMKFVDN
FT                   VAADDIFERMNYLSAFSAEVGKFEFAGLSNLAAEKLMPHINRLMEVLINSGIGNIEGAR
FT                   INVVPTGSIISSTGIISSLNLEYDVDLSESEPKDNKVQEKDLGMGFVLTPGMGHGMTAT
FT                   QLINEDNDDVIVRVNISNGSSYDVNLSEVDPRNATAIEMFAYCQYADENGTGIAGNHFG
FT                   SWSALKSFMDPLGGLEFSSVEEAATKKLNWVQAISEADVSFKRESTGEVMDVQDVLKML
FT                   IETYSKLESKNEEDDWRGMSGEEWEKLLDRVDNDINAMIELIREEAEKAKETHQKEDEL
FT                   DEQVAEEI"
FT   CDS             complement(451824..452741)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05240"
FT                   /product="Abi-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73455"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D4J016"
FT                   /protein_id="CBK73455.1"
FT                   /translation="MKKLLSPDQLIEHMKKKGIKFSIVDETDAKIFLVNNNYYMKLAAY
FT                   RTNYEKQKADCDTKGQYINLEFAYLKELSTIDMHLRYKIIEMCLDIEHNMKLALLNGVE
FT                   NAGDDGYKLVADFIAQNDKVLKVIHGHRASEYCRGLIEKYYPKFPIWVFVELISFGDLT
FT                   YLCDFYFKTYGEEIEDRKFLNIVRDLRNASAHSNCLINRLSDEIKGAPDKRIIDFVKSL
FT                   NAVGKSSISNNLKHSFVYNFVVLLYVYNNIVKNDVMKQRRFEDIKEMFDNRFTRNKDYF
FT                   SKNNLIKSQYEFLTKIIDSLNKVG"
FT   CDS             complement(453843..455030)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05260"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /function="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73456"
FT                   /db_xref="GOA:D4J017"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J017"
FT                   /protein_id="CBK73456.1"
FT                   /translation="MAKEHFDRTKPHCNIGTIGHVDHGKTTLTAAITKVLAERVAGNAK
FT                   VDFENIDKAPEERERGITISTAHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVAATDGVMAQTKEHILLSRQVGVPYIVVFLNKCDMVDDEELIELVEMEVTEQLEEYD
FT                   FNDCPIIKGSALKALEDPNGEWGDKIMELMDTVDSYIPDPQRETDKPFLMPVEDVFTIT
FT                   GRGTVATGRVERGVLHLNDELEIIGIKEDTQKTVVTGIEMFRKLLDEAQAGDNIGALLR
FT                   GVNRDQIQRGQVLAKPGTVTCHTKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTDVT
FT                   GVCELPAGTEMCMPGDNVEMTIELIHPIAMEQGLTFAIREGGRTVGSGRVATIIE"
FT   CDS             complement(457893..458312)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05290"
FT                   /product="SSU ribosomal protein S12P"
FT                   /function="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73457"
FT                   /db_xref="GOA:D4J018"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4J018"
FT                   /protein_id="CBK73457.1"
FT                   /translation="MPTFNQLVRKGRQTSVKKSTAPALQRGYNSLQKKPTNTSSPQKRG
FT                   VCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLP
FT                   GTRYHVIRGTLDTAGVANRKQGRSKYGAKRPKDAK"
FT   CDS             complement(458477..462151)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05300"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /function="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73458"
FT                   /db_xref="GOA:D4J019"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="UniProtKB/TrEMBL:D4J019"
FT                   /protein_id="CBK73458.1"
FT                   /translation="MPENKEATYQPIAFDAIQIGLASPEKIRQWSRGEVKKPETINYRT
FT                   LKPEKDGLFCEKIFGPSKDWECHCGKYKKIRYKGVVCDRCGVEITKASVRRERMGHIEL
FT                   AAPVSHIWYFKGIPSRMGLILDLSPKTLEKVLYFASYIVLDAGETALMYKQVLTEAEYQ
FT                   EAREQYGNGFRVGMGAEAIQELLRDIDLDEEATKLQIELDNATGQKRSRIIKRLEVVEA
FT                   FRESGNRPEWMIMTVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRIINRNNRLRRLLEL
FT                   GAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKSGRFRQNLLG
FT                   KRVDYSGRSVIVVGPELKIYQCGLPKEMALELFKPFVMKELVGNGMAHNIKYAKKMVEK
FT                   FEPEVWDILEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGRAIKLHPLVCTAFNADFD
FT                   GDQMAVHLPLTQEAQAECRFMLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTQERGTTV
FT                   GDETPAVGEGKVFKNLNEAILAYENNALTMHARITVRMSKTMADGSVVTGDVSSTLGRL
FT                   LFNEIIPQDLGYVDRTNPENDLVPEVDFHVGKKQLKQILEKVINTHGATKTAEVLDDIK
FT                   AMGYHYSTIAAMTVSISDMTVPPQKPELISQAEETVDKITRQYKRGLITEEERYREVVD
FT                   TWKETDDQLTRDLLDGLDKYNNIFMMADSGARGSEKQIKQLAGMRGLMADTTGKTIELP
FT                   IKSNFREGLDVLEYFMSAHGARKGLSDTALRTADSGYLTRRMVDVAQELIIRESDCVAG
FT                   TNREIPGMWVYAFMDGREEIESLKDRITGRFSCYSIYDAKGEMIVKANHMITPKRAAAI
FT                   IERGVDDKGEPIKKVKIRNVLNCRSHVGVCAKCYGANMASGRAVQVGEAIGIIAAQSIG
FT                   EPGTQLTMRTFHTGGVAGNDITQGLPRVEELFEARKPKGLAIITEIAGTVSIEEDSKTK
FT                   KREVVVTNSSTGDVEKYLIPYGSRIKVLSGQELEAGDELTEGSVNPHDILAIKGKAAVQ
FT                   DYLIREVQRVYRLQGVDINDKHIEVLCRQMLKRIRIDEAGDTGFMPGSLVDWLDFEEAN
FT                   EQMEAEGKEVATGTQELLGITKAALATNSFLSAASFQETTKVLTDAAIKGKVDPLNGLK
FT                   ENVIIGRLIPAGTGMKRYSNIPLSTDNDLANVEIPEDFEGLAGESEGLVSDDLVEIEE"
FT   CDS             complement(462171..466076)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05310"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /function="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73459"
FT                   /db_xref="GOA:D4J020"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="UniProtKB/TrEMBL:D4J020"
FT                   /protein_id="CBK73459.1"
FT                   /translation="MEKNRIRPVKAGKNLRMSYSRQKEVLEMPNLIEVQKDSYDWFVKD
FT                   GLKEAFADISPIQDRGNQLELHFVDFTLCKDEVKYTIPQCKERDATYAAPLKVKVRLVN
FT                   KESGDMQEHEIFMGDLPLMTDTGTFVINGAERVIVSQLVRSPGIYYAIGHDKIGKELYS
FT                   CTVIPNRGAWLEYETDSNDVFYVRVDRNRKVPVTVLIRALGLGTNQEIIDVFGEEPKIL
FT                   ATFAKDPAITEKNPQGSYEGGLLELYRRLRPGEPLAKDSAESLIHGMFFDPRRYDLAKV
FT                   GRYKFNKKLMLKNRITGHVLAEDVIDTTTGEIIAKAGDKVTLEMAEEIQNAAVTHVFIQ
FT                   TETRNVKVLSNMMVDITKFVDCDAKALGITELVYYPVLERILEENTTKEDIEDAIARSV
FT                   ADLIPKHITVEDIFASINYNMHLEYGIGKEDDIDHLGNRRIRAVGELLQNQYRIGLSRL
FT                   EKVVRERMTTRDLEDISPQNLINIKPVTAAIKEFFGSSQLSQFMVQNNPLSELTHKRRL
FT                   SALGPGGLSRDRAGFEVRDVHYSHYGRMCPIETPEGPNIGLINSLASYARINEYGFVEA
FT                   PYRRIDKSDPQNPRVTDEVVYMTADEEDNYHVAQANVKLDEEGHFMRKNVSGRFREETQ
FT                   EYDKTMFDYMDVSPKMVFSVATASIPFLQNDDPTRALMGSNMQRQAVPLLTTEAPVVGT
FT                   GMEPKTAVDSGVCVVAKRAGIVEMSETNRIIVKADEDGTRDEYTLFKFTRSNQSNCYNQ
FT                   RPIVFKGDHVEAGEVIADGPSTKNGELALGKNPLIGFMTWEGYNYEDAVLLSERLVQDD
FT                   VYTSIHIEEYEIDARDTKLGPEEITRDVAGVGDDALKDLDESGIIRIGAEVRAGDILVG
FT                   KVTPKGETERTPEERLLLAIFGEKAREVRDTSLRVPHGAYGIVVDAKVFTRENGDELSP
FT                   GVNKSVRIYIAQKRKIGVGDKMAGRHGNKGVVSRVLPVEDMPYLPNGRPLDIVLNPLGV
FT                   PSRMNIGQVLEIHLSLAAKALGFDIETPVFDGAKEIDIQDTLELANDYVNMPFDKEEAE
FT                   NGEETFYDKYVDILREDVMEYLSTNRAHRALWKGVPISRDGKVQLRDGRTGQPFDGPVT
FT                   IGHMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASY
FT                   TLQEILTMKSDDVIGRVKTYEAIIKGENIPEPGIPESFKVLLKELQSLGLDVRVLDENR
FT                   EEVELMETSEYGNTDLNAIIAGSDRNFAFEDDNSFAQAGFSTKKFDTEGELVDDEEEQF
FT                   EDEEDDFSDIPTDFDEE"
FT   CDS             complement(466318..466692)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05320"
FT                   /product="LSU ribosomal protein L12P"
FT                   /function="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73460"
FT                   /db_xref="GOA:D4J021"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:D4J021"
FT                   /protein_id="CBK73460.1"
FT                   /translation="MAKMTTEEFIAAIKELSVLELNDLVKACEEEFGVSAAAGVVVAAA
FT                   AGDAAAAEEKDEFDVELTEVGSEKVKVIKVVREATGLGLKEAKELVDGAPKLIKEAADK
FT                   ATAESIKAQLEEIGAKVTLK"
FT   CDS             complement(467520..468215)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05340"
FT                   /product="ribosomal protein L1, bacterial/chloroplast"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73461"
FT                   /db_xref="GOA:D4J022"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D4J022"
FT                   /protein_id="CBK73461.1"
FT                   /translation="MKRGKKYVAAAQSYDKSVAYDPAEAIAQVKKNATAKFDETIEAHI
FT                   RTGCDGRHAEQQIRGAVVLPHGTGKTVRVLVFAKGAKLDEAQAAGADFVGGEELIPKIQ
FT                   NEGWSDFDSVVATPDMMGVVGRLGRVLGPRGLMPNPKAGTVTMDVAKAVEEIKAGKIEY
FT                   RLDKTNIIHVPIGKASFSEEQLADNFQTLMDAINKAKPASLKGQYIKSISLAPTMGPGV
FT                   KLNVAKVSN"
FT   CDS             complement(468298..468723)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05350"
FT                   /product="LSU ribosomal protein L11P"
FT                   /function="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73462"
FT                   /db_xref="GOA:D4J023"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="UniProtKB/TrEMBL:D4J023"
FT                   /protein_id="CBK73462.1"
FT                   /translation="MAKKIEGYIKLQIPAGKATPAPPVGPALGQHGVNIVEFTKQFNAK
FT                   TADMGDTIVPTIITVYADRSFSFITKTPPAAVLIKKACKIDKASGTPNKTKVAKITKAQ
FT                   VQEIAETKMPDLNAASLEAAMSMIEGTCRSMGVEVVE"
FT   CDS             complement(468781..469311)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05360"
FT                   /product="transcription antitermination protein nusG"
FT                   /function="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73463"
FT                   /db_xref="GOA:D4J024"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="UniProtKB/TrEMBL:D4J024"
FT                   /protein_id="CBK73463.1"
FT                   /translation="MAEAKWYVVHTYSGYENKVKTNIEKAIETQKLEEQILDVRVPMVE
FT                   VTETKDGVKKQVSKKMYPGYVLIEMIMNDETWYVVRNTRGVTGFVGPGSKPVPLSEAEV
FT                   KAYLLGDNTEKVNVEVDFEVGDTLSVIDGTWKDTVGVVKSINAKKQTVTISVEMFGRET
FT                   PVEIDFTDVRKMD"
FT   CDS             complement(469326..469523)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05370"
FT                   /product="preprotein translocase, SecE subunit, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73464"
FT                   /db_xref="GOA:D4J025"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="UniProtKB/TrEMBL:D4J025"
FT                   /protein_id="CBK73464.1"
FT                   /translation="MAEDKKTKSGRFTGLKAEFNKIVWADPKDVSKQTTAVVAVSVVVA
FT                   VIIIVLDAVINKGVNILVNL"
FT   CDS             complement(469860..470738)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05390"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73465"
FT                   /db_xref="GOA:D4J026"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J026"
FT                   /protein_id="CBK73465.1"
FT                   /translation="MDMAANTTIAGKQDTGASVHARRVVSYVVLILISFLCLFWFYVLF
FT                   INATRSNSELSLGFSAVPSTHFVENWTNLKNGTLPILNGLINSLVIAFLTAGLATYFSA
FT                   MTAYAIHAYDFKGKKFMFTFILMIMMIPTQVTVLGFLQLIGKMGLDNNPAALIVPAIAS
FT                   PAVFFYMKQYMDSTLPLSLVEAARIDGSGEFRTFNQIVVPLMKPAIAVQAIFSFVNSWN
FT                   NYFTPALVLHDDTKKTLPILIAQLRSADWLKFDMGQVYMMIAFSIFPVIIVYLILSKHI
FT                   VGGVTLGGVKG"
FT   CDS             complement(470776..471648)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05400"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73466"
FT                   /db_xref="GOA:D4J027"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J027"
FT                   /protein_id="CBK73466.1"
FT                   /translation="MGLHILNSIYCNLLIFQLVPLATTIYNSFFENYRSGLTQIGPNFV
FT                   GLQNYGTIISNGDLPTYFINTMIMWLMGFIPQILLSLLLGAWFTDPSLRLKCQTFFKTV
FT                   IYLPNLIMASAFAMLFFTLFSDSGPINSMLMQMGVFKSAYQFMSHVWTVRTLVATMNCL
FT                   MWFGNTTILLMAGMLGIDPSLFEAAQVDGATSTQIFYKITLPLLRPILIFVMITSLIGG
FT                   LQMFDVPQILTNGTGDPMRSSMTLIMYLNKHLFSKNYGLAGALSVFLFVITGILSLIVF
FT                   KFTNSDKVK"
FT   CDS             complement(471777..473171)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05410"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73467"
FT                   /db_xref="UniProtKB/TrEMBL:D4J028"
FT                   /protein_id="CBK73467.1"
FT                   /translation="MKRRIVSLLALTTMTATMFAGCGGAASNDAEPATDTAATETEATE
FT                   AAAELPADTGKVLNIQCWNDEFQSRLKAHYPGYEEVDATHGKIGDVDVVWTITPSTDNA
FT                   YQNNLDEALLAQESAAADDKVDLFLVEADYALKYVDTDYAMALSDLGITDADLADQYKY
FT                   TQSIVTDSNGKLKGSSWQACSAGLIYNREAAKEVLGTDDPDEVQAAVADWGKYNETAAK
FT                   VAEAGYTMCSAYDTFRVYSNNVSGKWVQDNKVVIDKNIDKWIDDSKELVDAKAEDTDDL
FT                   WGDDWAKGKNPEGKVFCYFGPAWFFNFCLNADDPASIAGQGGWGYCVGPQSYYWGGTWI
FT                   CAATGTDNANLVKDIILKMTTDKGILKDIAQQDADCVNSKTVLSELAADDSGNLDLLGG
FT                   QNPYKQLAEGAEKVDLSNISAYDQGCNEELQKAIKNYFQGNATKEEALDMFKKAVVEKY
FT                   PELTAE"
FT   CDS             complement(473322..474272)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05420"
FT                   /product="transcriptional regulator, LacI family"
FT                   /function="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73468"
FT                   /db_xref="GOA:D4J029"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J029"
FT                   /protein_id="CBK73468.1"
FT                   /translation="MVSLKDIASECGVSIATVSKALNDHSDIGADTKIRIRKAAKDMGY
FT                   VPNAAAKSMKTNRTHNIGVLFMDDANSGLTHDFFAGVLESFKKEVEKEGYDITFISNDR
FT                   SRPGRASYLEHARYRRFDGVIIANVHFDDPEVVELVKSNIPVVTIDHIYNETTTILSDN
FT                   VDGMSDLVDFVVQNGHRKIAYIHGAESATTNLRLVTFNRKLEEYGIEIPEEYIKESPYR
FT                   DTHGAYEKTLELLKLRTRPTCIFYPDDYATYGGMRAIAERGLKVPDDISVVGFDGIKVA
FT                   RHIRPRLTTYRQNTEEMGILAAQSLVALIEKPKPL"
FT   CDS             474607..477042
FT                   /transl_table=11
FT                   /locus_tag="CIY_05430"
FT                   /product="cellobiose phosphorylase"
FT                   /function="cellobiose phosphorylase"
FT                   /EC_number="2.4.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73469"
FT                   /db_xref="GOA:D4J030"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR010403"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D4J030"
FT                   /protein_id="CBK73469.1"
FT                   /translation="MKYGFFDDNNKEYVITTPKTPLPWINYLGCKDFFTLLSNTCGGYT
FT                   FYKDAKLLRMTRYRYNDTTPDTNGKYFYIKDGDTIWNPGWQPTKTELDSYECRHGIGYS
FT                   KFTGTKNDVEAALVTFVPVNDSVELTKVTLTNKGTAKKDIQLFSYVEWCLWNADDDMKN
FT                   FQRNLSIGEVEVVDSTIYHKTEYRERRNHYAVYSVNSKIDGFETSRDEFRGAYNGPDKP
FT                   AAVIEGKLHNTIASGWYPIASHQINVSLNPGESKTFVFALGYIENAEDDKWEAPSVINK
FT                   KKATALLSKYQTVEAFDSALAELCSYWDGLLAKFHIESKDEHVNRMVNIWNQYQCMVTF
FT                   NMSRSASYYESGIGRGMGFRDSCQDLLGFVHLIPDRARERIIDIASTQFQDGSAYHQYQ
FT                   PLTKKGNSDIGSGFNDDPLWLIAGTSAYIRETGDTSILNETVPYDNDMSVATSLMEHLK
FT                   RSFDYIVNHKGPHDLPLIGRADWNDCLNLNCFSEHPGESFQCFGPSEGPVAESVFIAGM
FT                   FVKYGREYADLCKLMGDNAEADRALAEVDKMIKAIEKDGWDGEWFVRAYDAYSHKVGSK
FT                   ECEEGQIYIEPQGMCVMAGVGIDDGNAVKALNSVKEKLDTKYGVMILQPAYTRYHLELG
FT                   EISSYPPGYKENAGIFCHNNPWISIAETCIGRGDRAFEVYKKTCPSYIEDISEIHRTEP
FT                   YVYSQMVAGADAKFHGEAKNSWLTGTAAWTFTNISQYILGIYPTLEGLSVNPCTPAEFG
FT                   DFNVTRVYRGVTYNIEIKNPNKVQKGVASLLVDGKEVEGNIIPFDGSKKTVSVVATMK"
FT   CDS             477134..478021
FT                   /transl_table=11
FT                   /locus_tag="CIY_05440"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73470"
FT                   /db_xref="GOA:D4J031"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4J031"
FT                   /protein_id="CBK73470.1"
FT                   /translation="MNRTLTYIISTEYDGFQIDKFLKTQGYSSANITAIKKMPNNVVID
FT                   GEWVHMNRKLSAGELLTVNISEEDSSEKIPAVKMDLDIVYEDEDIIVINKPAGLPIHPS
FT                   LNHYEDSLANGLAYYYEQQGKPFIFRCANRLDKNTSGLTVISKHLVSANILSTMVKNRE
FT                   FHREYYAIVRGTLEQPEGTIDAPIGRVDDSIITRQVDFENGERAVTHYKVMDEKNGHSL
FT                   VSIHLETGRTHQIRVHFKYIGHPLIGDHLYNPDFEYMQRQALHSHRIEFVHPITKKQWS
FT                   LWLHCLMICKEYFK"
FT   CDS             complement(478024..478488)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05450"
FT                   /product="DnaJ domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73471"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniProtKB/TrEMBL:D4J032"
FT                   /protein_id="CBK73471.1"
FT                   /translation="MAKERTCQGKIDMQALEDRQLELEKAWNDLLKEKREVDARIRTLE
FT                   QQEKQFEMKWEMLIRETQQLADDKKQFERKKKFYEHVQSNVQEEYSYGVTTTDNVVQGE
FT                   MFFSGVSDKKALKKRYKDLIKIYHPDGDAGDTATVAEINREYEDLKAQMN"
FT   CDS             complement(478605..480638)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05460"
FT                   /product="Glycosidases"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73472"
FT                   /db_xref="GOA:D4J033"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4J033"
FT                   /protein_id="CBK73472.1"
FT                   /translation="MNIRAIYSDGTAEYRYPMEPEENSLVTISIRVYHQEDIQVFLMSK
FT                   TDNLNIRMHLDRTRGEFDFYSCTVQLGKKEFRYHFELVGGLDHYFYDRVGLWRDYREHY
FT                   EFSIMPGFSTPAWSKGAVMYQILVDRFCNGDPTNDVQTNEYHYVCGPVEGVKDWSSMPA
FT                   NLDIGRFYGGDLEGVRQKLHYLRSLGVEVIYFNPLFVSPSNHKYDTADYDYIDPHLTVI
FT                   KNDGGECLNPDDYDNSHASKYKIRVTNKENLEASNKFFADFVNEAHQKGIRVIIDGVFN
FT                   HCGSFNKWLNREKIYSKEEGYAPGAYESKDSPYNSFFKFYEDAWPDNKSYDGWWSHDTL
FT                   PKLNYEDSPELYQYIMNIGKKWVSEPYNCDGWRLDVAADLGHSEEFNHKFWADFRKAVK
FT                   SANPNAIILAEHYGNPSEWLKGDQWDTIMNYDAFMEPLTYFLTGMEKHSDEFQPSALGD
FT                   GERFKNTMLHFMARLKTPSLYCAMNQLSNHDHSRFLTRTNHMVGRIETKGTQAAEYGVS
FT                   IPVMKLAEMVQFTWPGAPTLYYGDEAGVCGFTDPDSRRTYPWGNANYDLVDYTRDIIMI
FT                   HKQSQAIKEGSFVFLNCGQGFISYGRFTGNEQIIVIINSNGNEIEVDVPVWIAGVPLNC
FT                   QLERLILSNEVGYSIMPTDITVEGGNLHTTVGAYSGIVYKRI"
FT   CDS             complement(480852..482399)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05470"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73473"
FT                   /db_xref="GOA:D4J034"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J034"
FT                   /protein_id="CBK73473.1"
FT                   /translation="MLIVLGAVFILFMILMNAQSAGGGANAKMMNFGKSRAKMSTKEDI
FT                   HTRFEDVAGLDEEKEEVEELVDFLRDPKKYTKLGARIPKGVILVGPPGTGKTLLAKAIA
FT                   GEAGVPFFSISGSDFVEMFVGVGASRVRDLFAEAKQNAPCIVFIDEIDAVARRRGTGMG
FT                   GGHDEREQTLNQLLVEMDGFGVNEGIIVMAATNRVDILDHAIMRPGRFDRKVYVGRPDV
FT                   KGREEILKVHAANKMLGSDVDLHQIAQTTVGFTGADLENLLNEAAILAAGQDRQYIVHD
FT                   DIKKSFVKVGIGKEKKSRVISDKEKKITAYHESGHAILFHVLPDVGPVYSVSIIPTGAS
FT                   AAGYTMPINENDEMFNTKGKMLQDIIVSLGGRVAEELIFDDVTTGASQDIKQATQTARN
FT                   MVTKYGFSKNIGMINYGEDEEEVFIGRDLAHTKGYSEATAKAIDDEVKAIIDECYEKAV
FT                   KLLKENESILHKCANLLLEKEKIGKDEFEALFGDAPKQENTEEILDGVAVEGINWGE"
FT   CDS             complement(482741..483265)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05490"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73474"
FT                   /db_xref="GOA:D4J035"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4J035"
FT                   /protein_id="CBK73474.1"
FT                   /translation="MSENIRVLLPEDELAARIAELGAQISKDYEGETVFLVCILKGASF
FT                   FACELAKRITVPVIIDFMATSSYDGGTVSSGVVKVKKDLDLDPAGQNVIIVEDIIDSGN
FT                   TLNYLGQLFKDRGAKSVKMVTMLDKPDRREVDVHVDYTGFTIPDQFVVGYGLDYDQKYR
FT                   NLPYIGVVELD"
FT   CDS             complement(483258..484505)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05500"
FT                   /product="tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain/tRNA(Ile)-lysidine synthetase, C-terminal domain"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73475"
FT                   /db_xref="GOA:D4J036"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D4J036"
FT                   /protein_id="CBK73475.1"
FT                   /translation="MPFFMLLGLREEYNLDIHALHVNHCIRGEDADEDQAYVESICRDY
FT                   QVPLKVVRVDIPALVKETGRSEEEEARMARYEAFEAYADELSKESQADNVKIAIAHNAD
FT                   DNAETVIFHMARGTGLDGMCGIAPTRGRIIRPLLEVPKAEIMEFIQENEISYCVDETNS
FT                   MVCYDRNRIRHNILPELSEINSKALEHIADMCNRLTEVADYISIEAHGLLEISREDGNK
FT                   LRKRAFVTAPKVIASQALKEYLSSFMPNQKDVSAVHIESILGLLQEDGERQVQLPYKKT
FT                   LIISYEHLYVQDEASEEETQGTFSYREFDLEPGMKYPTESYTKWFDCDKISDNIVIRTR
FT                   AEGDYLTIDSAGNHKSIQDYFVDEKIPRHKRDSIMLVCDGSHVMWVVGYRISEYYKISN
FT                   NTTRVLEIVYGGNGNE"
FT   CDS             complement(484900..485139)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05520"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73476"
FT                   /db_xref="GOA:D4J037"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:D4J037"
FT                   /protein_id="CBK73476.1"
FT                   /translation="MRLDKYLKVSRLIKRRTVANEACDSGRVQINGKIAKASTDVKVGD
FT                   IIEIAFGNKNVKVEVLDIQDTTKKDAAADLFKYL"
FT   CDS             complement(485329..485601)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05530"
FT                   /product="Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73477"
FT                   /db_xref="GOA:D4J038"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D4J038"
FT                   /protein_id="CBK73477.1"
FT                   /translation="MNKTELVAAIASKANISKKDAEASVKAFTEVVAEELKKGEKIQLV
FT                   GFGTFEVSKRAARTGRNPQTGAEMKIPASKAPKFKAGKALKDSIN"
FT   CDS             complement(485828..486598)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73478"
FT                   /db_xref="UniProtKB/TrEMBL:D4J039"
FT                   /protein_id="CBK73478.1"
FT                   /translation="MVIDGHKYKITDKTKVYSDHMKILVDSIGEDDAITVIGKDKEIIS
FT                   IAITTGHGYISLVNTAVFDGSMAFIGDKIVTMVNGNETIEVPEGTYLLTVANNGWGGSQ
FT                   EITVHRDENVLVNLDSMKGEGPSYCLLTFLVTVPDTFVYLDGKSVDVTEPQKVQYGAHQ
FT                   LVVKCAGYKAWKKILVVNSESAEITLEMEAEDGSGTTSTVEENYDNATPNENVTDESEN
FT                   GAEEETAGSSIKNDYDYEVDYLSTISDLISNLMN"
FT   CDS             complement(486616..487074)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73479"
FT                   /db_xref="UniProtKB/TrEMBL:D4J040"
FT                   /protein_id="CBK73479.1"
FT                   /translation="MSGDFTKKWSNLILLSVICVAAFCGCSHANNATVTNYTGSAIQNA
FT                   GKETGEVEETDNQAEAETEQVDLYIVENLDMVDETIALYSLSEDQQIRYSYNMTTKFLN
FT                   KYGGNDTWAEFTTGSVVSIGELLPASGALSQVQKSADVWMYEDIKNMP"
FT   CDS             complement(487095..488423)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05560"
FT                   /product="uncharacterized domain HDIG"
FT                   /EC_number="2.7.7.21"
FT                   /EC_number="3.1.4.-"
FT                   /EC_number="2.7.7.25"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73480"
FT                   /db_xref="GOA:D4J041"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:D4J041"
FT                   /protein_id="CBK73480.1"
FT                   /translation="MNLPADVSKIINILESNGHEAYAVGGCVRDCILGKNPHDWDITTS
FT                   ALPETVKSLFDRTFDTGIEHGTVTVLMHGVGYEVTTYRVDGKYEDGRHPKEVTFTASLE
FT                   EDLKRRDFTINAMAYNESKGLVDLFGGEADLQAGIIKAVGNPTERFTEDALRMLRALRF
FT                   SAQLGFEIEPATYQAIKELAPTLERISAERIQVEMVKLVTSPHPERIRDVYETGLTKIF
FT                   FPEFDTMMECDQVNKHHMYTVGEHTIVAMGLIPEDKVLRLAMMLHDVAKPVCKTTDENG
FT                   QNHFKMHPVKGADLAREILRRLKFDNDTVAKVCNLVKNHDDRPEISQRNVRRMIIRVGQ
FT                   ENFDDLLAVKRADTLAQSMYHREEKLAYIDELQRVYNEIVAAGDCLRIKDLKINGKDLI
FT                   AMGVPQGQQIGAILNAIFDEVVENPSLNDRETLLNKARSMVNC"
FT   CDS             complement(488425..489864)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05570"
FT                   /product="prolyl-tRNA synthetase, family I"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73481"
FT                   /db_xref="GOA:D4J042"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniProtKB/TrEMBL:D4J042"
FT                   /protein_id="CBK73481.1"
FT                   /translation="MAQEKKLVEAITSMSEDFAQWYTDVVVKADLIAYSSVKGCMIIKP
FT                   DGYAIWENIQHELDRRFKETGVQNVYMPMFIPESLLQVEKDHVEGFAPEVAWVTHGGLN
FT                   PLQERLCVRPTSETLFCDFYKDIIHSHRDLPKVYNQWCSVVRWEKETRPFLRSREFLWQ
FT                   EGHTAHATAEEAEERTVQMLNLYADFCEEVLAMPVVRGQKTDKEKFAGAEATYTIEALM
FT                   HDGKALQSGTSHNFGQNFSKPFGIQYTDKNNQLQYVHQTSWGMTTRLIGAIIMVHGDDS
FT                   GLVLPPRIAPTQVVVIPIQQKKEGVLEKAGEVCEKLGKTMRAKLDDSDKSPGWKFSEAE
FT                   MRGIPVRVELGPKDIEAGKCVLVRRDTREKIECPLDQVETKVAELLETIQKDMFERAKA
FT                   HRDSHIWDAHNYAEFTEIANNKPGFIRAMWCGDVACENKIKEDLAVTSRCMPFNDQEHI
FT                   SDVCACCGKPAKKLVYWGKAY"
FT   CDS             complement(489969..490328)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05580"
FT                   /product="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73482"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D4J043"
FT                   /protein_id="CBK73482.1"
FT                   /translation="MTEKERQIDILSSLKEYGFLIEIDDFGSGYSSLNMLKEVPADILK
FT                   MDMAFLTMDKNINRGRKIVNTIITLAKALGMMVVIEGVENEDQLNYLKGTGADYLQGYY
FT                   FNKPLPVKKFEELYL"
FT   CDS             complement(490370..492136)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05590"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73483"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4J044"
FT                   /protein_id="CBK73483.1"
FT                   /translation="MQLLTVGIFACLSYSRAISANNTREAEFAYAFYFMAIDWILITFM
FT                   FYARQYTKIWAEQYASTVITTTIAVLDNVSLFFNYKWHHGFYLVDNSLDGDHFYGFIIN
FT                   DYYVVHLVFCYILVAMIIMIFIQKSYLTSGFHRNRYLSILVIFVGIILLDIAYLFFGYP
FT                   VDISICLYSIAALFVSYYTLLYNPKTFVEYMLTTITERMECALISFDENDNCIYSNQQA
FT                   NRIFSPSGDKKMIENRFKMWREGRETNSISNTNWSEIYNFNGEEYRFDVHFNKVYDKRG
FT                   FYCGCYFSFYDVTGDFLAYEEEKYRSTHDALTGALNRDSFYEEARRILDENPEIDYVMV
FT                   CCNIKGFKLINDVFGVDKGDELLVRCADTIRDKITNGAAFARLEADRFAVLLPKSRYSE
FT                   ELFMTGMNQISHSLDNSQYRMVILAGVYDIFDRDVPIVGMCDGAFLAIDSIKDSFKNSI
FT                   AYYGDMLRREYMSEQKILAEFETALQTGQFAMFLQPVVTVDGRTTLCEALVRWIHPDKG
FT                   IIAPPSFIPLLEKTGYIYKLDQYIWEQAVRRLAYWSTLDHEELSISVNISVKDFYYIDI
FT                   YETLVSYVENIM"
FT   CDS             complement(492272..492928)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05600"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /function="ribosomal large subunit pseudouridine synthase
FT                   D"
FT                   /EC_number="5.4.99.12"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73484"
FT                   /db_xref="GOA:D4J045"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4J045"
FT                   /protein_id="CBK73484.1"
FT                   /translation="MEVLYEDDSIVVVYKPAGLATQTRNIGEKDMESELSNYLKSKGES
FT                   PEIHVVHRLDQPVEGVMVFAKTKEAANNLTRQIADHSFKKHYYAIITRESFPEEGDLVD
FT                   YLVKDNRTNLSKVVKESDPRAKKASLKYHTVDEWDDRKLLDIELFTGRHHQIRIQLASR
FT                   TAPILGDVKYGGVSTGHNLALCSYSIGFTHPTSGKPVTFQVKPKGEDFHDSKIAG"
FT   CDS             complement(492963..493652)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05610"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73485"
FT                   /db_xref="GOA:D4J046"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4J046"
FT                   /protein_id="CBK73485.1"
FT                   /translation="MSRILIIEDEEAIAELEKDYLELSNFEVDIEADGEKGLQKALAGN
FT                   YDMYILDLMLPGIDGFELCKRIREVKNVPILMVTAKKEEIDKIRGLGLGADDYITKPFS
FT                   PSELVARVKAHLARYERLVQSPNIQKDEISIRGLRIDKASRRVWINGEEKTFTAKEFDL
FT                   LTFLAENPNVIYSKEQLFETLWGEESIGDISTVTVHVNKIREKIELNTSKPQYIETIWG
FT                   VGYRFKV"
FT   CDS             complement(493645..494799)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05620"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase./HAMP
FT                   domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73486"
FT                   /db_xref="GOA:D4J047"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J047"
FT                   /protein_id="CBK73486.1"
FT                   /translation="MKLKNRLIISFLIITIVPVAIFSSLMLGLKGIVKEATEEQILTNE
FT                   IIHSVKNYMDDSGKFDQLVINFCIAEFVILLLTAVIMIAWIYRGIAPQLKILKVAANNI
FT                   KEGNLDFSIESTGTDEMSDLCNSFEDMRVRLKNNAKDRLEDEAEQRALISNIAHDLKTP
FT                   ITAIKGYAEGMLDGVADTPEKQEKYIRTIYNKANEMNTLINELTLYSNIDTNKIPYNFQ
FT                   KLNLSSYFTDCIEELGMDLENQHIRLDYSNFVDPEVLIIADPEQLGRIIHNIVSNSVKY
FT                   MRADVPSRIGIIVKDVGDFVQIEISDNGKGIATQDLPYVFDRFYRADTSRNSAAGGSGI
FT                   GLSIVKKIVEDHGGKIWVTSKENQGTTMYFVIRKFIENEEVINE"
FT   CDS             complement(494910..496091)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05630"
FT                   /product="methionine adenosyltransferase"
FT                   /function="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73487"
FT                   /db_xref="GOA:D4J048"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D4J048"
FT                   /protein_id="CBK73487.1"
FT                   /translation="MEKLLFTSESVTEGHPDKVCDAVSDAILDACLAEDPMSRVACETA
FT                   SCTGFVLVTGEITTKAQLDVPAIVRKTLLEIGYDDGKKGIDGNSCAVMVALDQQSADIA
FT                   MGVDKALEAKEGSLTDDLDTGAGDQGMMFGYATNETEELMPYPISLAHRLALQLANVRK
FT                   DGTLSYLRPDGKTQVSVEYDEAGKPVRLEAVVLSTQHDEDVTQEQIHEDIKKYVFDPVL
FT                   PKDMIDAKTKFYINPTGRFVIGGPHGDAGLTGRKIIVDTYGGYARHGGGAFSGKDCTKV
FT                   DRSGAYAARYVAKNIVAAGLAEKCEIQLSYAIGVAEPTSVMVDTFGTGKLSDEKIIEIV
FT                   RENFDLRPAGIIKMLDLRRPIYRPTAAYGHFGRTDVKLPWEQTDKAEALKKYL"
FT   CDS             496322..497509
FT                   /transl_table=11
FT                   /locus_tag="CIY_05640"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73488"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D4J049"
FT                   /protein_id="CBK73488.1"
FT                   /translation="MITLTVDKLEPNMIVAEPVVTKRGQTLIKAQEKLSPQMIAKLSFY
FT                   KIESVTVEDIAEEAPEEAPIEEAPAPAAEPEKPKKTLKEKKKEASEAKEKQDRASQQIP
FT                   YTQRLKASPTFQKFQSDYAINIAFLQKNFDDILAGADASCTDEMLKNCESLFKSKTTIE
FT                   LLNMLSNMRNLEDPLYSHSLNVGLISRAIGKWLKMPLEDVNVLTLAGLLHDIGKTQIPK
FT                   EILNKPGKYTEAEFEIMKTHPVQGKKILNDKGFDPRILYAALQHHERADGSGYPRGLEE
FT                   DEIDDFASIVAIADVYDAMTTARAHRDPLCSFQVISEFEKEGLHTFNTKFILTFLERIA
FT                   NTYNNSRVMLNNAKTGRVVYINKSSLSRPVIQLDNGEIINLADNAFSDIYIKSIL"
FT   CDS             complement(497570..499744)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05650"
FT                   /product="helicase, putative, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73489"
FT                   /db_xref="GOA:D4J050"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="UniProtKB/TrEMBL:D4J050"
FT                   /protein_id="CBK73489.1"
FT                   /translation="MIEPMEEITGYVENIIYRNADNGYTVLDFVVDEFLITCTGLFPTV
FT                   GEGENLLLRGDYVDHPTYGKQFKAVSYEAVAPTDAASMERYLGSGAIRGIGPKLAARVV
FT                   KLFGDDTFRIIEEEPERLAEVKGISLNKAMEISDQIVGAKDIRNAMIFLDRFGLHGNKA
FT                   IKIYNRFGNDIYNVIQSNPYKLADEVAGIGFKTADEIASQVGIKVDSEFRIKGGIMYVL
FT                   TQGASYGHTYLPIEKLVEMSVDLLKVDQESVEAQIMNLAMEKKLIIKRDVDGNRQIYSR
FT                   TFYRMEEAIAGMLKELNLTYKVDKADLEKVIRRIEKDGDFQLDELQKDAVIAAMEKGLF
FT                   VLTGGPGTGKTTTITTMIHIFEEEGYSIFLGAPTGRAAKRMSEATGYEARTIHRMLEVN
FT                   GRMGDDDDDVTSFAKFERNEDNPLECDVIIIDEMSMVDVSLMYALLKAIAPGTRLILVG
FT                   DEHQLPSVGPGNVLKDILASGKFPSVTLEKIFRQAQESDIVMNAHKIHQGEHVVLDNKS
FT                   KDFFFLKRDDADTIINVMLTLVRDKMPKYVDAGISEIQVLTPTRKGLIGVERLNTILQR
FT                   FLNPEAPGKNEWKGDTRLFREGDKVMQIRNDYQLEWEVKGNYNITIEKGLGVFNGDVGI
FT                   IKEINDWSKSVTVEFEEGRQVVYPFASLDELELAYAITIHKSQGSEYPAVVMPIMDGPK
FT                   MLMNRNILYTAITRAKKCVTMVGDADVFIQ"
FT   CDS             complement(499826..500278)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73490"
FT                   /db_xref="UniProtKB/TrEMBL:D4J051"
FT                   /protein_id="CBK73490.1"
FT                   /translation="MDVTGMSTYLQTQYANQGRAAAESTTKSVGAISKDSSREEITKAV
FT                   KDFETYMLEKVMKEMKKTMTMEQEEDNTMGMYKDLYLDQAITEIASQLVDDLGGSVTDD
FT                   FVDQIMRNYGITGTSSQMQENGGLDPERVSDDIAKQNGTTVTGVQA"
FT   CDS             complement(500359..501177)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05670"
FT                   /product="fagellar hook-basal body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73491"
FT                   /db_xref="GOA:D4J052"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:D4J052"
FT                   /protein_id="CBK73491.1"
FT                   /translation="MVRSLWSGASGMKGQQVQVDTIANNLANVNTMAYKSQSAQFKTLL
FT                   YQTLEAESTNAQGETKPTSAQVGLGTRVASLNANFTQGPQMANDSKTAMCIIGEGFFAV
FT                   QDGEETHYTRNGNFTWAIGPTGDKVLTTSDGYQVLDQAGRPITLPRTAGELGFAVNIDD
FT                   GSCSYKDQAGNIIRTGQSIALYQFTNRVGLNKIGENLYDESDASGEPISEWNTAGVTRS
FT                   QIAQGYLEGSNVNVADEMVNLIIAQRAYEMNSKAITTSDTMLEQANNLKR"
FT   CDS             complement(501196..501999)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05680"
FT                   /product="fagellar hook-basal body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73492"
FT                   /db_xref="GOA:D4J053"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:D4J053"
FT                   /protein_id="CBK73492.1"
FT                   /translation="MVKGLYTAYTGMVNEQKRMDVMTNNLANSATTGYKKEAMIAQAFD
FT                   ERLAIKIKDTSSWHNAPEGIGYISLGAKVGETYTNWDQGAFQITDKDSDVALAGRGFFA
FT                   IEFTNKAGETSIKYTRDGAFVVDRDGYLRTVDGDYVLTQEGAMNSQGGEDNYVQIDPNL
FT                   KYVIATDGSIRQNGEEVTTIGVIDIDNYDYINKYGENLYDLIPGGNIVESEAVVQQGML
FT                   EASNVNVIDEMVSMITIARAYEAGQKMIQAEDSTLEKTANQIGRV"
FT   CDS             complement(502125..503105)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05690"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73493"
FT                   /db_xref="GOA:D4J054"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D4J054"
FT                   /protein_id="CBK73493.1"
FT                   /translation="MAGSDIGIDLGTASVLVYAKGKGVVLKEPSVVAFDRDTNKIKEIG
FT                   EEARLMIGRTPGNIVAVRPLRQGVISDYTVTEKMIKYFVQKAMGKKSYRKPRIAVCVPS
FT                   GATEVEKRAVEDAAFAAGAREVSIIEEPIAAAIGAGIDISLPMGNMIVDIGGGTADIAV
FT                   ISLGSSVVSTSIKVAGDDFDEAIVRYMRKKHNLLIGERTAEDIKIKIGRCFPLGEAETM
FT                   DVRGRNLVSGLPKTITVSSEETEEALKEATMQIVEAIHSVLERTPPELAADVADRGIVL
FT                   TGGGALLRGLEELIEDRTGINTMTADEAMTCVAIGTGRYVELLSD"
FT   CDS             complement(503263..505035)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05700"
FT                   /product="excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73494"
FT                   /db_xref="GOA:D4J055"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J055"
FT                   /protein_id="CBK73494.1"
FT                   /translation="MFIHGFDRSVDVHYEGQRGRGVYPTVFEGLIENINRRYKETFSEN
FT                   QKREYEEYMFYSECPCCHGQRLKKESLAVTISDKNIFEMTQYPVHELYDFIDNLELTEQ
FT                   QKKIGAVVLKEIRNRLKFMVDVGLDYLTLARATATLSGGEAQRIRLATQIGSGLVGVAY
FT                   ILDEPSIGLHQKDNDKLLASLKGLRDLGNTLIVVEHDADTMKAADYLVDIGPRAGKDGG
FT                   QVVAAGTPAEIMANPDSITGQYLSGKLCIPVPSERREPKGWLTIKGAREHNLKNIDVDI
FT                   PLGIMTVVTGVSGSGKSSLINEILYKDLAKRLNRARKISGKHDDIIGTEALDKVIDIDQ
FT                   SPIGRTPRSNPATYTGVFDLIRDLFAGTTEAKERGYNKGRFSFNVKGGRCEACSGDGII
FT                   KIEMHFLPDVYVPCEVCGGKRYNRETLEVHYKGKTIYDVLDMTVEEACEFFKNVPSIYN
FT                   KIQCLYDVGLGYIKLGQPSTTLSGGEAQRIKLATELSRRATGKTIYILDEPTTGLHFDD
FT                   VNKLVEIMRKLSDSGNTVVVIEHNLDVIKCADYIIDMGPDGGDRGGTVIAKGTPEEIVK
FT                   VKKSYTGHYLKEYL"
FT   CDS             complement(504945..506084)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73495"
FT                   /db_xref="GOA:D4J056"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J056"
FT                   /protein_id="CBK73495.1"
FT                   /translation="MKERKYIKIKGANEHNLKNISIDIPRDEFVVLTGLSGSGKSSLAF
FT                   DTIFAEGQRRYMESLSSYARQFLGQMEKPNVEHMEGMPPAISIDQKSTNHNPRSTVGTV
FT                   TEIYDYMRLLYARCGIPHCPNCGKPISKQTVDQMVDAVMALPERTKIQLLAPVVRGRKG
FT                   THEKLFEKAKKSGYVRVNVDGSVYDLSEEISLDKNIKHNIEIVVDRLVIKEGIEKRLTD
FT                   SIEAVLKLADGLMIVDVIDGEPIRFSEGFSCPDCGISIDEVEPRSFSFNNPFGACPECF
FT                   GLGYKMEFDEDLMIPDKSLSFNGGAVQVMGWQSSNKKEALPMLCWRHWQQSTISHSILH
FT                   IRSFQRIFVICSSMALTVQWMFTMRDREAEVYILQFSRA"
FT   CDS             complement(506081..508078)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05720"
FT                   /product="excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73496"
FT                   /db_xref="GOA:D4J057"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J057"
FT                   /protein_id="CBK73496.1"
FT                   /translation="MNSGVDMDFKLHSEYKPTGDQPQAIEDLVRGFKEGNQMQTLLGVT
FT                   GSGKTFTMANVIEKLNKPTLIIAHNKTLAGQLYSEFKEFFPENAVEYFVSYYDYYQPEA
FT                   YVPSTDTYIAKDSSINDEIDKLRLSATASLSERRDVIIVSSVSCIYGIGEPDDFQNMMV
FT                   SLRPGDFKDRDDVIHELINIQYMRNDMDFDRGTFRVRGDVLEVIPANVSDYGIRIEFFG
FT                   DEIDRICETDIMTGQVKRELEHVAIFPASHYVIPQDKINSACASIEAELEERVKFFKSE
FT                   DKLIEAQRIAERTNFDIEMLRETGFCSGIENYSRHMTNQQPGEPPKCLIDYFDDDFLII
FT                   IDESHITLPQIRGMFAGDQARKRTLVEYGFRLPSALDNRPLNFGEFESKIDQIMFVSAT
FT                   PGDYEEEHEMLRTEQVIRPTGLLDPEVEVRPVEGQIDDLFNEIKKETAKKNKVMITTLT
FT                   KRMAEDLTDYLAELGVRVKYMHSDIDTMERAEIIRDLRLDVFDVLVGINLLREGLDIPE
FT                   ITLVAILDADKEGFLRSERSLIQTIGRAARNSEGHVIMYADTMTESMEKAISETERRRE
FT                   IQMAYNEAHGITPKTIQKSVRELISISKDIAKKEMQFKKDPEEMNKQELEKLIEDIQKK
FT                   MKKAASELNFEAAAEYRDKMVELKNMLREL"
FT   CDS             complement(508183..509658)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05730"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73497"
FT                   /db_xref="GOA:D4J058"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D4J058"
FT                   /protein_id="CBK73497.1"
FT                   /translation="MELKDRHIYERNKLAFKLGSIIQFFQLIATVAYADQRVGFMNTTI
FT                   MVVLQIICACLFVYSYLKYSHRNRGKYLMMMSGLSSYLVVMLGSVHITYMWAFGPGLLI
FT                   LVLLFADPILTYATSIAVMAINLLYVPLFYKYSVEVKDRHWAVITDVIFALLLGLMAIC
FT                   YVHLHSRHNNETVEELEEGAKKQEEAAKVVQEIGIQIASKLEDANEAMEGLAGKVTSSA
FT                   ESAQQISESVTLTAEAIQTQTEMNANITESLDNIAHQSRAMRKNADEVTENITDGNSLV
FT                   KELRQKSEEASQINAETAEMTAELQKSADLVKDIVGTILDISGQTNLLALNASIEAARA
FT                   GEAGKGFAVVADEIRALSEHTKESAEEISSTIDDLIGKVNVASENMKRSVDSANQQGEM
FT                   IVETGEKFTVIMEKVSELTHRAGDITDNVESCVDANTKVMDAISNLSATSEEVAASAES
FT                   SITISEECETDMKATEEILHDILKISRASQNKV"
FT   CDS             complement(509749..510486)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05740"
FT                   /product="alpha/beta hydrolase fold."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73498"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D4J059"
FT                   /protein_id="CBK73498.1"
FT                   /translation="MRKFFNWAIIRKAFIVILLWIVLIVKITLVFQTAYKATDRALEYI
FT                   NHPAEGVTVVDKTRYIEFTPENPKAGFIFYPGGLVEPDAYAPLMERLAEHGVKCFIVRM
FT                   PHYMAFLDANGARGIKAKYPEIDNWYLGGHSLGGAMVSLYAARHSDEYEGVVFLASYTT
FT                   DDMSSDDIDAILIRGDQDGVMNMKKYNECIKNLPEGYEEVVIPGGCHAYFGDYGPQRGD
FT                   GQPTITVEEQTEITVEKLVDFME"
FT   CDS             complement(510490..511149)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05750"
FT                   /product="NCAIR mutase (PurE)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73499"
FT                   /db_xref="GOA:D4J060"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniProtKB/TrEMBL:D4J060"
FT                   /protein_id="CBK73499.1"
FT                   /translation="MDFANLDFDRKNRTGFPEVIFCQGKPDDYLVDIYKQMYERDGRVF
FT                   GTRATEHQYDIVNAVLENVTYDKISKILKVNPKVAPKEELIGNIAVVTAGTADIPVAEE
FT                   AAQTAEYFGGKVNRVYDVGVSGIHRVLSSVDVLNEANCVVAVAGMEGALASVVGGLVKV
FT                   PVIAVPTSVGYGASFGGLSALLTMINSCANGISVVNIDNGYGAGYIATQINRLAER"
FT   CDS             complement(511287..511547)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05760"
FT                   /product="Protein of unknown function (DUF1292)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73500"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D4J061"
FT                   /protein_id="CBK73500.1"
FT                   /translation="MNNEFKEYITFVVKTKDGNEVEMAVIDQFEFENKGYVAAALVDGD
FT                   TVSDEGCFIYRVKVGEEDFKVEKITNQIDYNRVAEAYMEMI"
FT   CDS             complement(511805..512647)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05770"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73501"
FT                   /db_xref="GOA:D4J062"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J062"
FT                   /protein_id="CBK73501.1"
FT                   /translation="MKKTWKIVGRHVFLAVLAFIWLIPVFWLVVTTFGVEKGINTNHFF
FT                   PAHWTLANYHQLFFEPDAAANFPAWFKNSMIIGVFSCLISSIFVIMTAYAFSFIEFKGR
FT                   KKLMSFSLILGMFPGVLSMIAMYFILKMLGLTDSVVGLIILYSGASGLGYLILKGFFDT
FT                   IPTSLHEAAKLEGASEATIFAKIVVPLSKPMIVYTVINSFLNPWMDFVMVRLMIKSKNA
FT                   ADWTMALGLFNLLQRALVNQYFAYFCCGGLMIAVPISILFIIMQKFYVEGVTGGAVKG"
FT   CDS             complement(512647..514059)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05780"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73502"
FT                   /db_xref="GOA:D4J063"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J063"
FT                   /protein_id="CBK73502.1"
FT                   /translation="MKKIGNYFKDFGHAIAHGDIWVKLSLIIMGAGYFGRKQLMRGILM
FT                   TLLQVGVLASIFGVFAPYMSKLNTLGTVQREEIFDIVTMKKTVNNYDNSLLILLYGIIG
FT                   ILVIIAFIALYIGNIKATYRLQKMQENGEKLNTFMDDIVSFKNERFHITLLTLPSLGVI
FT                   LINIIPILFMVCIAFTNYDENHQPPTYLFTWVGIKNFVNLFTTSQTITFGYAFVRVLIW
FT                   TLIWAVLATATTFLGGILLAQFINHEDTKFKGMWRTLFVITIGIPQFVTLLLISKMFGD
FT                   NGIVNTFCSNVGILDFFKNIGLLNAGDSFIPFLSRPGWAHATIILVNIWVGIPYQMLVA
FT                   TGILMNIPSDQIESAKIDGANKFQIFWKITMPYVMFITGPSLIQSVIANINNFNVIYLL
FT                   TYNYKTTNMAMANSHANEVDLLITWLFRLTNEYSNFKMASVIGIVTFVVCAALSLLTFS
FT                   RMIGGDKEGVYR"
FT   CDS             complement(514208..515488)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05790"
FT                   /product="Maltose-binding periplasmic proteins/domains"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73503"
FT                   /db_xref="UniProtKB/TrEMBL:D4J064"
FT                   /protein_id="CBK73503.1"
FT                   /translation="MKRKLVSALLVSTMAVSAFVGCGAAAEETTEPATEATEETAEAST
FT                   DDAIANLIAATEGTVNIDLWCSETEEYQTVMKKLCDDFAAQYPDVDFNITLGAVSEADM
FT                   KDRVLEDVEAAADVFVFPDDQLEALVKAGALNEVAAQYTYDMNETDTPATVEAAQYDGK
FT                   QYGYPFTASNGYFLYYDKNQLSDEDVASWEALTAKAEELGKEVGCETANGWYLYGFFKG
FT                   AGCNLTENEDQSNNCDWNNETGLAAAESLQKIASSKAYKSYGNDDLLANLNDGKVVAYV
FT                   SGTWNVNAFSEAYGDGYAATKLPTFEVNGEAKQMASYSGYKFVGVNAYAENTGWSMLLA
FT                   EYLTNATSQEAVYEATGEGPSNTEALAKASSPALDALAAQSEFAELQRVGGNYWTPAES
FT                   LGKNILEGKVSQQVLDDAVAGITQPVE"
FT   CDS             complement(515639..516628)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05800"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73504"
FT                   /db_xref="GOA:D4J065"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J065"
FT                   /protein_id="CBK73504.1"
FT                   /translation="MGHTLDSIAKELGLSKTTVSRAISGKGRISEETRQKVNDYIKKIN
FT                   YRPSAVARSLAANRTFNVGLVVPADSALGEMPYFQTLMTGVCERAMDYDYDVLILLADN
FT                   DGISPLKHAVQNRKIDAVIVSRCERDSKVINFLKESNIPYIVVGNPMDDDVLYVDHDNR
FT                   GAAARMIETLIDRGIHRMALIGGGENINVTHSRLQGFRDGFKNKGLKVDESLIFLNMHK
FT                   SARMDSVLRQVISEGAECIVCMDDMLCNSALNCLHNDGISVPEDVKLCSFYDSNLLSTS
FT                   KPAITSLYFDAKKLGAECLEMLMRNLDGESVTNVIVTDFNIQMRDSTT"
FT   CDS             complement(516802..518256)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05810"
FT                   /product="Cache domain./HAMP domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73505"
FT                   /db_xref="GOA:D4J066"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="UniProtKB/TrEMBL:D4J066"
FT                   /protein_id="CBK73505.1"
FT                   /translation="MKKNKRTTVKSRITRHVVIAIAITITVMTIVNLVYLSRRIIEQQE
FT                   MKLELATQMCAGEVESWIDDMATVTEDMASTLTALGDLNETTVRAVVDRVALNHPEFYY
FT                   VYFSDKLGNATMARGVQFAEGVDPRERVWYKTAEALGHTVVIDPYVSASRPDIMMVTVA
FT                   TPVYWGTMLVGVVAVDADIASVQDFINSIDFEEGSYGFLLDSNNNIIAHPNADFSPKNG
FT                   DITSAMDVMPELDDILSTSTQDEYVTAKDYTGTRMVYSAKRLAGSKWTIAVAYPESNFL
FT                   SHVDRGIRISIFVALVCAFLAVGDIAVTVRRVLKPLDKINPAMQRIVEGDFSTNLNFAE
FT                   ANDEIGDLQNELAVVLSSLSKVINKQNYVLSEMEKGNLVVEDIENFPGELNQIATSVNS
FT                   IKDTFNDIISDIQFSAINLQSYAMGINETTDMDEMKMIFEELSAEANALMEKTSRFITM
FT                   PGGPKPVDYTNNVSEDSGLDDYRDDF"
FT   CDS             complement(519072..520574)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05830"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73506"
FT                   /db_xref="GOA:D4J067"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="UniProtKB/TrEMBL:D4J067"
FT                   /protein_id="CBK73506.1"
FT                   /translation="MKQTQDKERNLTMMMDEYELTMANAYFNDPTIDPNTKVSFDVFYR
FT                   VNPDGGGFAIFAGLQQIKDYLLNMHFTDEDIAYLRSVGHFTEDFLEYLKNFKFTGDVDA
FT                   FPEGTIMYPNEPIITVTAPIIEAQLVETEILAQVNHQSLIATKASRIVRAAAGRAVSDF
FT                   GARRAHNNDAAIYGARAAYIGGAAGTATVSAGQYFNIPIGGTMAHSYVMYFTSDDNDYR
FT                   TSELAAFRSFAKSYPNNCILLVDTYNVLKSGVPNAIKVFQEMKDAGIQSKSFGIRIDSG
FT                   DLAYLTKKSRKMLDDAGFPDAKIIVSNSLDEYTITSILQQGGQVNSFGVGERLITAKSE
FT                   PVFGAVYKLCAVTDAKTGETIPKIKISETVEKITNPGLKDVYRIKDEHGRAVADMLAIK
FT                   GEKVDMNVPGGYRFVDPEQPWKSTHVFENCTAELLQKPLIRGGKAACEDEDMQTIRARV
FT                   QTQLQTSVWPEEQRFENPHKHYLDMTPDYYNMKMELLRKEDK"
FT   CDS             complement(520603..521742)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05840"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73507"
FT                   /db_xref="GOA:D4J068"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:D4J068"
FT                   /protein_id="CBK73507.1"
FT                   /translation="MKNTNMNVAKAVDNRNQVIVRTSIIGIVANLLLAGFKALVGFLSG
FT                   SIAIILDAVNNLSDALSSVVTIIGTKLGAKMPDKEHPLGHGRAEYLSALLVAAIIIYAG
FT                   LTSLNESILKIIHPTEVEYETLTLVVLVAAIIVKFFLGRYVKATGEKVNSSALIASGAD
FT                   ASFDAIISASVLASAIIYLAFGLSLEAWVGVLISVIIVKAGWEMMSDTLDDILGRRPDR
FT                   ELTVGIKRLICEEPEVRGAYDLVLNNYGPNKFLGSVHVELPDVMTVEDVDNLTRRIQEK
FT                   VYNETGVVLTGVGVYSYNTKDDEAARIRNRALEIVKQHDWALQLHGFYVNTSTKEMRFD
FT                   VVLSFEINHTEGTEIIYKEVLSEYPDYDIQIAADVDVTD"
FT   CDS             complement(521835..523538)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05850"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /function="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73508"
FT                   /db_xref="GOA:D4J069"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:D4J069"
FT                   /protein_id="CBK73508.1"
FT                   /translation="MYKGIEASRGIGIGSICLIVERDLSFESKHIDDTDAEKARFNSAI
FT                   DKFKAETAEMAENIRKNIGPKEAEIMEGHLAMINDPTMAGEMTKMIEAGQCAEAAVTAV
FT                   CDMFIGMFSKMEDDMMRQRASDISDIKISLLKILLGVEDVDISKVAPGTVLVAHDLTPS
FT                   MTSQIVKENVVGIITEVGGKTSHSAILARALEIPAVLSVPGITELVKDKDTAIVDGTEG
FT                   DVYINPDGDVVSKYVIKREEFIRAQAELKNFFGKETVTADGDRVELFCNIGTPKDAKKA
FT                   VECDGEGIGLFRSEFLFMDKPHLPTEDEQFEAYKEAVETMAGKTVIIRTLDIGGDKDIP
FT                   YLGLEKEENPFLGYRAVRYCLANKDIYKTQLRGLLRASAYGKVKIMVPLVTCVDEVRAV
FT                   KALVEECKNELKAEGIKYDENIEVGCMVETAAASLIADLLAKEADFFSIGTNDLTQYTM
FT                   SVDRGNANVAYLYSAFQPAVLRSIKNIIKAGNEAGIPVGMCGEAAADPLMIPLLMSFGL
FT                   DEYSVNPVLVLTARSIISKWSKAEADALAEKVLSLTTEAEVVALLKASAK"
FT   CDS             complement(523587..523850)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05860"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73509"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D4J070"
FT                   /protein_id="CBK73509.1"
FT                   /translation="MVSKVVKVTNEQGMHMRPATVFSAAVTPFESDVKIGYNGMQYDGK
FT                   SVMMLMAACIKCGAEIEIICNGSDEEAALAKAVELVESGLGD"
FT   CDS             complement(524054..525958)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05870"
FT                   /product="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)/PTS system
FT                   D-fructose-specific IIB component (F1P-forming), Frc family
FT                   (TC 4.A.2.1.4)/PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /function="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /function="PTS system D-fructose-specific IIB component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /function="PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73510"
FT                   /db_xref="GOA:D4J071"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4J071"
FT                   /protein_id="CBK73510.1"
FT                   /translation="MKISEFIDPKGIKLQVACADQNEAIDQLISLHSSVGNLNDEAGFK
FT                   EAILAREAKGSTAIGNGIAVPHGKSSAVSKAGVTAITCPAGVDYKALDGNPTNLLFMIA
FT                   APEGAADTHLEVLSKLMTILMDAAFCKSLVQAKTVEEFIGLIDKKEEERYAGTPAEKAA
FT                   TGNKKIVAVTACPTGIAHTFMAAEALEQKAKELGIAFRVEKDGSAGAKDPLTSSEIAEA
FT                   DAVIVACDKNIDMSVFDGKKVVLASTKDAIHTPEKLFEKAETAAVYHHTGAVTKRSDDS
FT                   NETLGRQLYKHLMNGVSHMLPFVIGGGILIAIAFLLDDYSIDPSNFGTNTPVAAWFKTI
FT                   GGAAFGFMLPILAGFIAQSIADRPGLAVGFVGGALAASGATFANPGGAIPSAFLGALVA
FT                   GFAAGYFMKWLEKVCDKLPQSLEGIKPVLIYPLCGITVIGIVMCAINPIVGALNAWISG
FT                   VLTGMGTTSLIPLGIILGAMMATDMGGPLNKAAYVFGTAALAEQNEVGWMIMAAVMVGG
FT                   MVPPIAIALATLIFPKKFTVAERKAGPVNFIMGFCFITEGAIPYAAADPLHVIPSLMVG
FT                   SGVAGALSMAFKCTLMAPHGGIFVFPVVGNAVLYLVALAIGSAVSCLLLGLLKKTVED"
FT   CDS             complement(526003..526908)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05880"
FT                   /product="fructose-1-phosphate kinase"
FT                   /function="fructose-1-phosphate kinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73511"
FT                   /db_xref="GOA:D4J072"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4J072"
FT                   /protein_id="CBK73511.1"
FT                   /translation="MVYTVTFNPALDYVVRMDGDLLPGMTNRSASEEYYFGGKGINVSM
FT                   VLAELGVKSTALGFVAGFTGRAIEDGVQEAGIDTDFIHLKDGISRINVKLKGTEETEIN
FT                   AQGPKIDEQSQKELFDKLSKLVEGDVLILAGSIPNSLPDDVYEKILSMLDGKGIKFVVD
FT                   ATKDLLTNVLKYHPFLIKPNNFELGEIVGKVLKTDDEIYEGALKLQEMGARNVLISMAG
FT                   AGAMLVDENGERYRIGVPKGQVRNSVGAGDSMVAGFVAGYMKTQNYDTALKMGTAAGSA
FT                   TAFSDGLAKAADIDTLFKTL"
FT   CDS             complement(526926..527678)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05890"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73512"
FT                   /db_xref="GOA:D4J073"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D4J073"
FT                   /protein_id="CBK73512.1"
FT                   /translation="MLTEERRARIIEIVNEKKAVSVNELVELLDTSAATIRRDITELNR
FT                   AKKLIKVFGGATSISGRDVITKEDAVKQKAQKNVNEKVNISRYAAGLIQDSDFVYIDAG
FT                   TTTLAMLEYINNHKAKYITNGVVHAKILMDKGLEVIMIGGRLKASTEAVVGPDCIDFIR
FT                   KYHFTKAFMGTNGISVHAGFTTPDADEAMIKTAAIRHAYKSYILADHTKFDEINSVTFA
FT                   DINDCIIITDKTPSKEYVSNTTVKVCDD"
FT   CDS             complement(530295..530876)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05920"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73513"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4J074"
FT                   /protein_id="CBK73513.1"
FT                   /translation="MGDFREVRMSTDELTGLLDKQTFFVCAQNLIDTAHYGQEYAFIFF
FT                   DVENFKIFNANYGYEIGDELLVSIAYILKDEFEGQLLAHFTGDHFVACVNTIQVIQTIK
FT                   SVRERIKLIRKSASIELKAGIYIYDGEEKDVIKCCDKARMACISIKKNTMLVIVFTIRN
FT                   WEEVFSVSRIYWIDWMRPLRSDISRSIISR"
FT   CDS             complement(531251..531529)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05930"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73514"
FT                   /db_xref="GOA:D4J075"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J075"
FT                   /protein_id="CBK73514.1"
FT                   /translation="MTQKEFSALTGISESTISDWKHKKFNPGADKIPAICRVLNISSSE
FT                   LFELDETEKGEGKYRYYLSEEESQVVELFRAADKENKNIYCPMLSFC"
FT   CDS             complement(532215..532631)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05950"
FT                   /product="conserved hypothetical protein TIGR00305"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73515"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="UniProtKB/TrEMBL:D4J076"
FT                   /protein_id="CBK73515.1"
FT                   /translation="MNKYYAVIDTNVVVSALLKMNSIPGTMVELVFTGKIVPIYNNQII
FT                   TEYEEVLRRPKFGIYEYEIENIVKGIKDYGIELSGKPVDDYFVDPKDIVFYEVTMKARE
FT                   EFDAKLVTGNIKHFPEKRYVLTPRQMIDMIANEM"
FT   CDS             complement(532628..532915)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05960"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73516"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:D4J077"
FT                   /protein_id="CBK73516.1"
FT                   /translation="MASTLIQFRADDIEKIEAIKICEKLGINLQAYLRMCLSRLISENG
FT                   IPFSMNVDEIEENKALRTMRDISRRAEENGIADMSLEEINAEIQEVRRNK"
FT   CDS             complement(532986..533522)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05970"
FT                   /product="HipA-like C-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73517"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:D4J078"
FT                   /protein_id="CBK73517.1"
FT                   /translation="MLNLAVLDCLIGNVDRHTRNFGLFYNSLNGEYQIPLIFDNGMGLF
FT                   EHDYYRDNYRTFEAAMAEVRLINNLKGILYYIDTPLIDFEIKERELIKAEDLSKGQLYP
FT                   WELAKLGVSYGSFNQFFQRRTMREGCMFYREHLRALGMDKMDFDLYIRKNNGNNHLDNY
FT                   WVQFEDFGAKCFAEV"
FT   CDS             complement(533563..534648)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05980"
FT                   /product="Archaea bacterial proteins of unknown function."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73518"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J079"
FT                   /protein_id="CBK73518.1"
FT                   /translation="MDTQNSDLMVALENFWNGWASARRDVVLIVCASATSWMLSKVVHN
FT                   KGGLYNRLTEQIHLESFSLAECEEYVKSKGMAFTRNQILHYYMVFGGIPFYWGFLEKGL
FT                   SIQQNIDQILFAKNAPLVDEFKYLYASIFKNPENYIKIISALATKKVGMTREEIIKNSG
FT                   LANSGELTTRLEELESCGFIRKYDAYGMKKKNAVYQLIDNYTLFYYQFLSSKPTDEHFW
FT                   TNQINTPSINTWQGLAFERVCLEHVNQMKQKLGISGVQTEVNSWYCKADADKGIKGAQI
FT                   DLLIVRKDQVINLCEMKYSNTDYTVTAEVDSDIREKIQDFQKATKTKYAIYPTLVTTYG
FT                   MVNNSYSGNIQAVITLDDLFI"
FT   CDS             complement(534711..534980)
FT                   /transl_table=11
FT                   /locus_tag="CIY_05990"
FT                   /product="Archaeal ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73519"
FT                   /db_xref="GOA:D4J080"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J080"
FT                   /protein_id="CBK73519.1"
FT                   /translation="MIIGRKQEIDILNSTIQDDYSHFVAIYGRRRIGKTFLIREVFNYR
FT                   FTFQHSGLSEGGLKEQLFAFEASIRDAGGNPTKNVRIGLKLLKI"
FT   CDS             complement(535189..537051)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73520"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4J081"
FT                   /protein_id="CBK73520.1"
FT                   /translation="MQQAVDSKVEAIIVVARPGSCKVIAKRIKEVCQANGILVYDVRGN
FT                   NLLAETKVSYDFRNINVYTKSDLLAKVEESDVISFDLFDTLVARKVLYYTDIFELIDAK
FT                   LREQKIYIPEFSKLRLAAEKELSKTAAPKLSNIYDWVISQHPECNLSSNELAEIEWQID
FT                   KSIMYTRDGMKDLLSEIATLGKRIVVTTDTYYSKQQIEELLSLMGYEHIDKVYVSSEYN
FT                   VSKANELFEIVTNDNRDKSILHIGDDEYVDVEKASEYGLNNYRIYGVKDIFDEVDAFGL
FT                   SSNINSYSDNVKVGLALSKFFSNPFQFETLNKKISINNAKDIGYFICGPMVLDFAFWFE
FT                   DKIKQIGAENALLCARDGYLLKKIFERIDSEVHSVYFLTSRTSAIRAGIENEDDIAYVD
FT                   SMKFFGSQEESLLARFGISLNEGEDRNAAIINKAKFQRLNYQKYISKLNLSDGTTAVFD
FT                   FVAKGTTQLFLQKIMKQQLKGLYFLQLEPEFMADKGVEIESFYTEEERDRSVIFDNYYI
FT                   LETILTSPMPSVDEFDECGNPVYAKETRSPENIKCAQKMQQGIIEYVEDYLEIVPKELR
FT                   IINKQLDEGLLSLIGKIQIDDEDFKRLVIEDTFFGRMTDIKDVL"
FT   CDS             537050..537172
FT                   /transl_table=11
FT                   /locus_tag="CIY_06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73521"
FT                   /db_xref="UniProtKB/TrEMBL:D4J082"
FT                   /protein_id="CBK73521.1"
FT                   /translation="MVMIGYPKASPDFLKPSKSPTILGPLLHWEMSLSVSVPRP"
FT   CDS             complement(537215..537727)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06020"
FT                   /product="histidinol-phosphate phosphatase family
FT                   domain/HAD-superfamily hydrolase, subfamily IIIA"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73522"
FT                   /db_xref="GOA:D4J083"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4J083"
FT                   /protein_id="CBK73522.1"
FT                   /translation="MNKAIFLDRDGTINIDKDYLYKIEDFEYISGVVEALKQLQDMGYL
FT                   LIVISNQSGIARGFYSEDDYLIIDRWMKDDLKSRGVNITASYYCPHHPKALVKKYRCEC
FT                   NCRKPNTGLFWQAQKDFDIDMSKSIAIGDKERDIAICKEAPVRGILIDCNKKWSNVISD
FT                   IRNKHKD"
FT   CDS             complement(537720..538289)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06030"
FT                   /product="phosphoheptose isomerase"
FT                   /function="phosphoheptose isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73523"
FT                   /db_xref="GOA:D4J084"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J084"
FT                   /protein_id="CBK73523.1"
FT                   /translation="MGIVEDRIIESIKVKENILNDTTLIELINKAGQKVKKTFENGGNV
FT                   FLCGNGGSASDSIHIAAELSGRFQKERKSLPALSLNADIAALTAISNDYSYEQVFERIL
FT                   SGIVHERDALIGISTSGNSENVYRAFVEAKRHGATTIGLLGKDGGKINEVADIAIVVPG
FT                   NNTARIQESHIMIGHIICEIAEEDYE"
FT   CDS             complement(541128..541916)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06060"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73524"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J085"
FT                   /protein_id="CBK73524.1"
FT                   /translation="MPPSVINDVYFDRIIIAICNGWALNEIVEQLDKMGVPESKIVYSY
FT                   DPATFRYCETALDEFFIIPKVEYDIPFKKNAVTPRLECKGETSKARDRREREGFFENFC
FT                   QGDGLDIGCGGDPVVSGVSGWDILNGDAQYLRGIEDETFDFVYSSHCLEHMRDVRVALC
FT                   NWFRVVRPGGFLIICVPDRDLFEKKKTLPSRWNGDHKHFFLLGKAEEPDTLDILEEIEN
FT                   SIASYKIIYAKECKEGHTITEPLKQSDGEYQIEIVVQKTV"
FT   CDS             complement(541928..542053)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73525"
FT                   /db_xref="UniProtKB/TrEMBL:D4J086"
FT                   /protein_id="CBK73525.1"
FT                   /translation="MKIIVFGVGKVSKKILDYTIKPNIELLFFATIINHFGIQQF"
FT   CDS             complement(542060..543154)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06080"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73526"
FT                   /db_xref="GOA:D4J087"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D4J087"
FT                   /protein_id="CBK73526.1"
FT                   /translation="MVWSTAFIRELRRNIPNTKIDIIINNNHKELFKECSYVDTVFGYE
FT                   CNDLDKPVDEKVLIKAKEYYNNRIKIKYDAVFLPRLLPSGLADAWENVILALESGAKIR
FT                   YAHSYYVSDRDCAIVDSVECYFTNISKHLFGQSEVRSKLDLITDNRGIVLDEKMELWLS
FT                   NVDKEYANKIIEPNGIKVAVGLVGSNPNRCWSPCRYTEVIKRINDKYKDKDIKFVLMGG
FT                   DDAIDASKIILENIDINLINLVNKTSLSRAISVVNMCDIYLGSDTGLMHVAAAFKKYVI
FT                   ELSAASEETPSYWGSSPERTGPWKTKFQILKAEKPLPGCGCYCSMPVPHCINQITVDDV
FT                   VAALENALLEKLYKRSTCPLRIQE"
FT   CDS             complement(543184..543585)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73527"
FT                   /db_xref="UniProtKB/TrEMBL:D4J088"
FT                   /protein_id="CBK73527.1"
FT                   /translation="MVEDKIRDFCSNKNNIYVYGTGLYAKTVQLFLEMEGIAIAGFITS
FT                   TGMDTLDKYPVFSIKNINLYPKDGVILAVNEKYCSEILRTVKIVCKYLQLADLEYALLE
FT                   QSHIFNRLKIFNENVAKKGSVLIKIGIEF"
FT   CDS             complement(543592..544611)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06100"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73528"
FT                   /db_xref="GOA:D4J089"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D4J089"
FT                   /protein_id="CBK73528.1"
FT                   /translation="MGDFLIGKNWMYHLINEFNLINDTWEVFIDKVAYNRGKDIFEIST
FT                   YVDSVNCGYELLDDTNQYDVIIHFCIVPYIQYFAGEIVYYNNIEFGKYILRLMDFGFEN
FT                   YCMGFCRNPKFYSTIRKLMEKFPERKYHNLCDLFGNLGIQDEYSFSLSIEKDENEYLSS
FT                   LGLLNNSFITINTGLNRDYNAVSSTRAWSIANWDRLAQLLKAKRSDIQIVQVGEKMQDD
FT                   CVIKADINLNGKTSIDEARILMKKALIHVDYDGGLVHVRHILNGGPSVILFGPTNVFRH
FT                   SYKENIGIRTSDCPEDCEWLTDKWLFECPKGYDKAICMESINPEYVCERIIDILDNIN"
FT   CDS             complement(544945..546180)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06120"
FT                   /product="Radical SAM superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73529"
FT                   /db_xref="GOA:D4J090"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4J090"
FT                   /protein_id="CBK73529.1"
FT                   /translation="MKKLFQMFRRIDAVSNNGGEIYIRCGGMFGKQACSSLQDMGVKVN
FT                   AFLDNKYAEIQEINGIPVLSPDVAFEKKENDKFIVIAVDDDKIYNDIVDEYLRNGLKKG
FT                   LDFGDYSAKACERMQDFMDIYHDKDIKTKFEEIAVKRLQEMKEIDSSFATELPNVYNLI
FT                   PNLDVVLTTYCSLSCECCSHCIPYANPPKHYESKNIIKSLDKLLEVSYVACIGIMGGEP
FT                   FVYPKLAEFFREYKKMKNLNNIGFTRVITNGTVVPSDDFFIEYKDVSNAYVYISNYGKK
FT                   SNKLSEIVEKCAEYGIKTYICPETEDWLHLGAVNYKRNYTAEEIKHLYAVCESHSCVQL
FT                   INGRVYACGRVPILNEYNIIPFSKEDYCDVDRNDENLKQELHKYLFEKDYLNGCYYCDG
FT                   QHMFSRRIKRGL"
FT   CDS             complement(546184..546585)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73530"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J091"
FT                   /protein_id="CBK73530.1"
FT                   /translation="MTDVPGLNSFKRDNITYNEQLVERDTGKQEKYEIRKVQNIRIRKL
FT                   PDIIDEYCNGEWPDFLSIDIEGMEYESLEICDLTNGPKLMAVEVNFNGDLFVELLDKKG
FT                   YFPYLWYRENILFVRKDMINLVHAHDERG"
FT   CDS             complement(546687..547202)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73531"
FT                   /db_xref="UniProtKB/TrEMBL:D4J092"
FT                   /protein_id="CBK73531.1"
FT                   /translation="MSELFLFPYGSVKAGSKVVLYGAGMIADDYMIQITENNYCEIMYI
FT                   AASDYKENPKNKKHWNIVNPESLKNYEDYDYVVLATIMPKFRDEMKYNLRNWGVPNEKI
FT                   VSDIHKVFHESNSYSQHGEDMIIYTAFTHMGYFRDGKLPTYIDIGAHHPYNISNTALFH
FT                   KKDVMVSI"
FT   CDS             complement(548021..548284)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73532"
FT                   /db_xref="UniProtKB/TrEMBL:D4J093"
FT                   /protein_id="CBK73532.1"
FT                   /translation="MSNPGVILLCEAQIGNQMLRVEDNIGEAIHLHINNIRIDFTVRDF
FT                   ILLVDGLKSIAEKMINVTGFSFDKYDAIWLKEIGNILIKLKK"
FT   CDS             complement(548281..548499)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73533"
FT                   /db_xref="UniProtKB/TrEMBL:D4J094"
FT                   /protein_id="CBK73533.1"
FT                   /translation="MGELLKKYGTINVGPKQCCVELNAPIDSESGGIVHIHYDDIRFDM
FT                   SQLEFYQMVTALNLASENLKRIKGDTL"
FT   CDS             complement(548515..548796)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73534"
FT                   /db_xref="UniProtKB/TrEMBL:D4J095"
FT                   /protein_id="CBK73534.1"
FT                   /translation="MWENRVWDKKNKWWTLDIDTEYVYLIVRSIFDKGEFTKLYKERIT
FT                   SLQVLIDKDIVYSLMREVFFKYTDRLFELLEAKKFDFIRSDYLSFNEY"
FT   CDS             complement(548841..549173)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73535"
FT                   /db_xref="UniProtKB/TrEMBL:D4J096"
FT                   /protein_id="CBK73535.1"
FT                   /translation="MEKYIRREEIYALIKMLNSAKIRYVLPKNIGEELPDRLKCGKDID
FT                   LIVHPDDKMLLEKIMMETYIIERHPCGVESGWSFLYGMQPPDFWSKKTINGVVYIDVFL
FT                   CCHAIA"
FT   gap             549199..551884
FT                   /estimated_length=2686
FT   CDS             complement(553208..553858)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73536"
FT                   /db_xref="UniProtKB/TrEMBL:D4J097"
FT                   /protein_id="CBK73536.1"
FT                   /translation="MLKFWIGKNGLSNGILILGESHYNDEGDVGKEVPDCYTCGVMDRY
FT                   FNQVDEYPFFDKIAASFGYSIREEVLDFYNNLCFGNYITRFCEKRHGAAANELIAKEKV
FT                   MYNNRLFEFVNTNNIKMLFCFSKRVYWNLPGANARDIDYGAERINGWQGRRIRTINKYK
FT                   YSKQVLHANCFVELENDLTVYGIAHPTGSYGYRPEEMYRFLEKEEGIRRYLTL"
FT   CDS             complement(554459..554851)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06220"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73537"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D4J098"
FT                   /protein_id="CBK73537.1"
FT                   /translation="MDDYINGRYSLLRNPILADVFLRLNLIEKFGTGIIRIKSLYADYV
FT                   AQPNFIVNEGSITVVLSTIDSVNLTDNEAIILKYIKENGPVSSGQVVSELGIERNKAID
FT                   TLNTLKNQGLIQVEGQGRATRYDVNR"
FT   CDS             complement(555039..555434)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06230"
FT                   /product="Uncharacterized conserved protein related to
FT                   C-terminal domain of eukaryotic chaperone, SACSIN"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73538"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D4J099"
FT                   /protein_id="CBK73538.1"
FT                   /translation="MEGSMIDLSKYRFDTAVDELDTSKELLKSQKYKASVNRSYYAIFH
FT                   TLRAVTALEDFDSSKHSGIIVFLTKLMLKKVYLTRKSLSLLTQHIDLEKRLIIRISMWY
FT                   HKNKQKNRLPKRKNNQYNKTIYRRKMD"
FT   CDS             complement(555419..555745)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06240"
FT                   /product="Nucleotidyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73539"
FT                   /db_xref="GOA:D4J0A0"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A0"
FT                   /protein_id="CBK73539.1"
FT                   /translation="MNTQMYNELVMGILNAVGIKTVSIILYGSTARGTASEDSDIDIAV
FT                   IVNGALDFQTEDALSDVVVDMNLKYDKVFSVIDIEDETIKKWENVVPFYQNVRKEGIVL
FT                   WKAA"
FT   CDS             complement(556118..556495)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73540"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A1"
FT                   /protein_id="CBK73540.1"
FT                   /translation="MDDDTVMELDLKKCIDEVPKLYTVLGNERLLSTLKVDAGGYGFSI
FT                   NDSISIEKRIIKKYGVIIPIYAQAFMDFASHCVVNTTEACSILGCSRQNLAHLIKTDVL
FT                   HPLKEGWRENVFLKGEITRGE"
FT   CDS             complement(556504..556926)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73541"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A2"
FT                   /protein_id="CBK73541.1"
FT                   /translation="MRVFTIRDDEIDKVNGIGYVLYFERDDSYVIELIETLNEWNAPLL
FT                   FAGLVKKGIYTIPKNIARLWVEERVIPSGRQNIGIILRNAKLMKYNEAKLLALSKGRSS
FT                   QDSCYLEEIKKKNFHRGLLIDKEIMFLSVFLLWTIV"
FT   CDS             complement(556951..557028)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73542"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A3"
FT                   /protein_id="CBK73542.1"
FT                   /translation="MKIAEMYYWMDWKILFQGNIWKKYG"
FT   CDS             complement(557029..557724)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73543"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A4"
FT                   /protein_id="CBK73543.1"
FT                   /translation="METRIISEKQDMRYLNWSHTRNSSGTAGTFLKSQETIDGRKIYYK
FT                   LSRFDSEKGIIGHECINEIVVDRLLTILGIEHLHYELIHADVEIDGKEYETWVCASEDF
FT                   KQPGETKATLENYYQINNVSGKTRYEFCKENGWVNYIDTMLAVDYLILNRDRHGANIEV
FT                   LRNARNKTLRIAPLFDHGLSLLCSCFNQKEIEEFDIDEDRPCQNFIGTRSTLENLSLIK
FT                   TRIQYLAVD"
FT   CDS             complement(558469..559515)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06310"
FT                   /product="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73544"
FT                   /db_xref="GOA:D4J0A5"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A5"
FT                   /protein_id="CBK73544.1"
FT                   /translation="MKALVLNEIGKIGIEDIKKPSPLEGEVLVAVKACGICGSDVPRAY
FT                   KDGAHNMPLVIGHEFAGIVEKLGSGVDAKWAGKPVGVFPLIPCGECDCCKNRKYEMCKN
FT                   YSYLGSRTNGGFAEFVTVPEWNLIELPESVSFEQAAMLEPMAVAVHAIRRISPTAEDSV
FT                   VVMGLGTIGLLITMMLLDMGINNVFTIGNKASQKNFVMDLGIPEGHYFDGSKDNPAEWI
FT                   IANTNYLGTDTFFECIGKNESLKVGINAAAPSGKICTVGNPQSDMELTRDEYWKILRNQ
FT                   LTVTGTWNSSFMHDIADDWNYVISRLQRGTIHPERFITHKFGMDEIVKGFEIMRDKREE
FT                   YVKVMGII"
FT   CDS             complement(559547..560248)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06320"
FT                   /product="4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73545"
FT                   /db_xref="GOA:D4J0A6"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A6"
FT                   /protein_id="CBK73545.1"
FT                   /translation="MIVAIVLSGGTGSRAGGEIPKQYIEVSGKPVILYCLETLHKSEHI
FT                   DKIQIVAEADWQDRIKGWLEDFGLSDKLLGFSLPGKSRQGSIYNALQDICDLAEDEDYV
FT                   FVCDAARPFLSEEMIEKCVEEMNGYDGVIPVLPMKDTVYLSKDGKSISSLLNRSEIFAG
FT                   QAPETFLYGKYCRANKKLFDAERLEEINGSTEPAVIAGMKMHMIPGDERNFKITTRADL
FT                   ERFNEIVKPDR"
FT   CDS             complement(560245..560907)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06330"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /function="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73546"
FT                   /db_xref="GOA:D4J0A7"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A7"
FT                   /protein_id="CBK73546.1"
FT                   /translation="MEFELNASMMCADYGHLSREVNELEEGGIDSFHIDIMDGRFVPNF
FT                   AMSLNDMRYIASVTFKPLDVHLMVEHPSNTIELFLSNLRKGDTVYIHPEAEYHPSTTLQ
FT                   KVIDAGMIPGIAINPGTSIETVKEMLKIVDKVLVMSVNPGNAGQMYLPYVGEKIEKLLK
FT                   LKERYGFKIYWDGACSGNKILEYAPKGVDGFILGTTLLFGRGRTYKDILEDVRNLRL"
FT   CDS             complement(560937..562298)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73547"
FT                   /db_xref="GOA:D4J0A8"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A8"
FT                   /protein_id="CBK73547.1"
FT                   /translation="MRKNRFKQVENYIALFRKICEGVYQELNNKEPGIDKACQYLEMAQ
FT                   QKAIDLGNLIEETEGEGHKTVSHLEEYCEVLFQIHEEIQSERGLSASSAKGRLDHCINV
FT                   IEKSAKEDIKLTKVVVFLPYKASMWDSLESVWMKARDDEDCEAYVIPIPYYEKNPDGSV
FT                   KEYHYEGQDYPDYVPVVDFQKFDFEGASPDEIYIHNPYDDSNYVTSVHPFFYSENLKKF
FT                   TDKLIYIPYFVLAEPNLDDVNLSANVLPYALTKGVINADEVIVQSENMKKAYVMTLVGR
FT                   FGEDTREYWERKIKGTGSPKFDKILRMKDEEQEIPEEWKKIITKPDGSKKKIVFYNTSV
FT                   VAMINKGAQMIDKIRDVLQVFKENADDVALLWRPHPLIEASLESMVPEVLEDYRQIVKN
FT                   YKEEGWGIYDDTPDMDRAIIISDAYYGDGSSIVQLYEKLEKPIMIQNPDVICAE"
FT   CDS             complement(562550..563737)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06350"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase,
FT                   prokaryotic"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73548"
FT                   /db_xref="GOA:D4J0A9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0A9"
FT                   /protein_id="CBK73548.1"
FT                   /translation="MLKGKCVVLGVTGSIAAYKIANLASALVKLGADVNVIMTKNATNF
FT                   INPITFETLTSNKCLVDTFDRDFQFNVEHVALAKRADIFMVAPASANVIGKMAHGIADD
FT                   MLTTTILAAKCKKLVSPAMNTNMFTNPIVQDNLETLKKYGFEIIQPASGYLACGDTGAG
FT                   KMPEPEVLLQYILKEIAFEHDLNGKKVMITAGPTQEAIDPVRYISNHSTGKMGYAIARA
FT                   AMLRGAEVTLVSGPVAIEPPMFVDVVNIKSAAEMADVVKSKAGEMDIIIKSAAVADYRP
FT                   ANVAAEKIKKKDGEAAAIELERTEDILSFLGANKKPGQFICGFSMETENMLENSKAKLK
FT                   KKNVDMIVANNLRTAGAGFGTDTNVVTLITAENARELPIMSKDDVAQAILDEIVK"
FT   CDS             complement(563803..564720)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06360"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73549"
FT                   /db_xref="GOA:D4J0B0"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B0"
FT                   /protein_id="CBK73549.1"
FT                   /translation="MQSNNSKTYELVLTALFVAIIVVMASTPLGYIPLVVINATTLHIP
FT                   VIIGSLFLGPKKGACLGGVFGITSFVKSSLTPTPSAFAFSPVAALTMLPHDTIGQAIAL
FT                   VFKSTFIAIVPRILIGVVPYFVYVGIKKAISSEKKLVYGSIINVIISFIMGFGVFAFFN
FT                   KMISEGKVGFSVTVAQVIGAVIGIVVFAAIEYLFMNKDAKALGFITAGISGAMTNTLLV
FT                   MGSIYAFYRIPYSEVLQIEPSALMGVIGGIISFNGVIEAIVGAVIVYLVGIVLDKIKPA
FT                   GVYSGKKNGKVKAVSDADAVKQMA"
FT   CDS             complement(564914..565981)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73550"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B1"
FT                   /protein_id="CBK73550.1"
FT                   /translation="MDNEAGTELSKSLKGAVKYNQTSSNMTNAYGLSIYFPYRQTNKVD
FT                   NMVSTYDEIGMDESYSNCIQKFASMAYYGQAAGQSTGNTNPASILLGSGNASSGSMDSA
FT                   QTIMQILNAVMTQKSTTDAFLNKGPSLEEAAEYIAENKFDASDLKWQMNANGDNVIALS
FT                   EAQWENVQQIEFSTFVDDGSGYIDLGLDTTFEWDEDNNLIANTDRSWIGIEGKIVAYHH
FT                   IDTTGDASNYTITGRVPVLLNGERADLILVFDSEHEDGYVAGATYDYKDGETEVIAKNL
FT                   TELQPGDTLEFICDYYSYNGEYYDSHLLEDGLTVTKSMDELKISNLVIEDKDILISYVF
FT                   TDIYGNSYYTEGLSE"
FT   CDS             complement(566065..567327)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06380"
FT                   /product="Clostripain family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73551"
FT                   /db_xref="InterPro:IPR005077"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B2"
FT                   /protein_id="CBK73551.1"
FT                   /translation="MADRPVSRKKNVTGSASVNRKGSGLGTGPVGGGNGGHIPGGGPGG
FT                   FGGNRDGGFGGGGGGLGKLIIIALIVLLGGGGGLGAFLGGGSGSTGTGSISGNSTTSTI
FT                   NTVGSLASLLLGSGGYTSTAQSGNASWSSKANTGVLDETVAEGAREKYTVLKGDGKDTT
FT                   TIMVYMCGTDLESRGAMASKDMQEMLDATVADNINLLVYTGGCAGWKNNFVSNRTNQIY
FT                   QIKNGNVNLLKDNIGDLPMTDPTTLSSFIKWSGQNYPADRYDLIFWDHGGGSVTGYGYD
FT                   EKHREAGSMNLAGINKALTDGGLKYDFVGFDACLMATVETGLMLDAHSDYMIASEETEP
FT                   GIGWYYTNWLTELSKNPSMTALATGKIIVDDFVAQCGKQCAGQKTTLSVVDLAELTATV
FT                   PEDLKGFADTTANLIDKKNTR"
FT   CDS             complement(567402..568100)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06390"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73552"
FT                   /db_xref="GOA:D4J0B3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B3"
FT                   /protein_id="CBK73552.1"
FT                   /translation="MIDDVSGRVENSVNEGVDLINQLKNQAEEVAKINLETASTTQALN
FT                   TSIQDVQAITETILGISSQTNLLALNASIEAARAGEAGKGFAVVADEIRALSESTREAT
FT                   EEISKIIERLTSDARSASAAMSKSAEYAQKQNDLIAETGTKLDAIKEGSDELRGGVVQV
FT                   KGSVKEVLSANTQIMDNITNLSATSEEVAAAADTVGAVSDDSMDALRNMNETLEVINRI
FT                   AREMEEMALK"
FT   CDS             complement(568139..568891)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73553"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B4"
FT                   /protein_id="CBK73553.1"
FT                   /translation="MPEREDTMDMKTKQMLEKNRLARYCGTITCIALIFCTVRSIWLDG
FT                   PNVLDGIRLFVAVLDIILFQILYKAYGEEYRYKYVITLSMVVQFILNIYAPTDKNMYIF
FT                   MYTIILIVMIYGEAGTVRIGCFIANFCLITSGYLELKKGNITGRELVTELVFSIIACTI
FT                   SVVVCKQQRRQTTETLDTIKEHAEDIKETSETIVNLAEELNKKFEEANEVSDRLNESMD
FT                   ATHSSVNEIVEGTKIQQRQLKIRQIRQL"
FT   CDS             complement(569026..569247)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73554"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B5"
FT                   /protein_id="CBK73554.1"
FT                   /translation="MDITENIEIHDCPICGGAGLLEEEDHGYYVACLDCGSYTGTVSFK
FT                   TEEGRLEAAEKSAMLWNTGKVINSAPGE"
FT   CDS             complement(569249..570544)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06420"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73555"
FT                   /db_xref="GOA:D4J0B6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B6"
FT                   /protein_id="CBK73555.1"
FT                   /translation="MEQYVIKGGTPLSGEVEISGAKNAALGILAGAIMTDETVTIENLP
FT                   NVKDINVLIGALEDIGASINRVDDHTVKINGSSISRLSVDYEYIKKIRASYYLMGALLG
FT                   KYKNAEVALPGGCLIGARPIDLHVKGLKALGANVDVSYGLWSARADRLVGNHIYLDKVS
FT                   VGATINIMLAAVLAEGKTTIENAAKEPHVVDVASFLNSMGANIRGAGTDVIRIVGVPAL
FT                   HGTTYAVIPDQIEAGTYMCAAAATHGDVLVKNVIPKHLEATSAKLIEAGCIIEEYDDAV
FT                   RVIAKGRKLTSTHVTTLPYPGFPTDMQPEITAVLGIAEGTSTVTESIFENRFKYVDELA
FT                   RMGANIKVESTVAIVTGVERYTGAQVCAPDLRAGAALIIAGLAADGITVIDDIKYIQRG
FT                   YESIVEKFNKLGAVMEEIDSERDLQKFKLKVS"
FT   CDS             complement(570604..572340)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06430"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73556"
FT                   /db_xref="GOA:D4J0B7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B7"
FT                   /protein_id="CBK73556.1"
FT                   /translation="MKNKPQSKILKRVLIELKAYYFDIIISILCALATVILTLRIPILT
FT                   GQAVDCIVGKGVIDYDRLISVLREISITVVATFFTQWIMNRVNNRITYNITKSLRDRAF
FT                   SKLQHIRLSVIDSHPHGDFVSRIVSDADTFSDGLLMGFTQLFTGVLTIFGTIYFMMRIS
FT                   WKIALIVIIATPFSLLLAKFISERTYKFFGEQAKLRGAETSYIEEIIVNKNIVRNNDYE
FT                   DDALEQFEIMNDQLADASMKATFYSSTVNPSTRLVNNLIYAAVGVFGAMMAISGGITVG
FT                   GLTSFLSYASSYGKPFNEISGVVTEFQNSLACAARLFEMIDAKEELNEGDKSIDGAKGK
FT                   IEFKDVSFSYDKDKKLIEHLNLTVEPGKRVAIVGPTGAGKSTIINLLMRFYDIDAGEIL
FT                   IDGVDIRDIDINNLRSNFGMVLQETWLKNATIKENLKMANPDATDEEIIAAAKATHAHS
FT                   FIKRMPYGYDTILSTDNGSLSQGQMQLLCITRVMLNIPPMLILDEATSSIDTRTEQKIQ
FT                   SAFNKMMEGRTTFVVAHRLSTIREADVILFVKDGQIVEQGNHSELLQKDGFYAKLYRSQ
FT                   IA"
FT   CDS             complement(572340..573404)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06440"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73557"
FT                   /db_xref="GOA:D4J0B8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B8"
FT                   /protein_id="CBK73557.1"
FT                   /translation="MQIGTGRISALLNPVTYVIVNIGIVGLIYIAMRRVDSGFILQGDV
FT                   VALVNYMGQILIELIKLANLIVLLMKAYPSAMRVQEIMEMKSDERCKEKIPDGDVIIGG
FT                   SHQLGSISVKNVSFSYNGGNEYDLEDISVEIPAGSTLGIIGGTGSGKSTLVKLLNHTYD
FT                   ATKGIIELDGQDVRKLKDDHLAWKFGIVPQHASLFHGTVRSNLTMKQNEASDDEIKSAL
FT                   KTAQALDFVEAKEGGIDCEVMGRGSNFSGGQRQRLTIARGLMGKPEILVLDDSASALDL
FT                   GTEAKLRRALSELSWNPTKIIVSQRASSVKDADQILVLDDGKCVGLGTHEELIETCETY
FT                   QEIYYCQFPREEAK"
FT   CDS             complement(574088..575218)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73558"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0B9"
FT                   /protein_id="CBK73558.1"
FT                   /translation="MIKRQVKTACIAALSATVLLAGCGKINPNETLVTIKNGDKTETIS
FT                   LGLANFAARYQQSMYDQFLLSYYGEGMWNSDMTGSGSTLQEETKDGVLTDLEDQYVAKK
FT                   HASDYNVSLSDEQEKAIDDAVDKFLADNDEESLKIMGATKDTVKEYLEYRTYYNLVGDA
FT                   AKKEADKDITEDDCWMRSFTYVLFKTTGNTDEDGKTVELTDEEITDLKANAKALSVAED
FT                   FDAEVEAQGLTTSTYSYLKGETEDSTMDISIIEAAEALKEGEVSSVIEVTDAGYYVIRL
FT                   DKDHDTEASDNKRTSLQTEKFNELVSSWKEEIEWTVDEKVWEKVKFDTLFKAVEKEDTK
FT                   ESTEEGTEEKTEETTEEPAEETEDTSAESGDDSDAN"
FT   CDS             complement(576643..578814)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06480"
FT                   /product="Transcription-repair coupling factor (superfamily
FT                   II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73559"
FT                   /db_xref="GOA:D4J0C0"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C0"
FT                   /protein_id="CBK73559.1"
FT                   /translation="MKAFLEPFESLTAVESLREALLKHGKIYDITGCADKAHLIYGIGY
FT                   DVKYKLIITSDELKARELYEEYRFFDNDVVYFPAKDFLFYQSDIRGNALTRERMKAIEA
FT                   VISNNSCTVITTIDALMNKLPALSYFEEGIVAVSDTDTVELEALRRKLVAMGYENVGTC
FT                   EHPGEFAVRGGIIDVYPLTAELPVRIELWGDEVDSIRTYDPSNQKSIENINAVLIFPAV
FT                   ELILSAEEVAAGLSKIEKERDERYEAYRKEMKTEEAFHLKTYADRVIEETREWGLSQEL
FT                   ETHLTYFCDKLGSFADFMPKGTYVFIDEIQKVINKAEVTETEFADAMTRRVEAGYMLKG
FT                   QMDMLYGMSEVFGKLEKYPITLMSVLDAKNKLLKSANHYSITVQGVNAYNGSFELLTKE
FT                   LLQYKKRKYKVLLVTSSATKGQRLAEDLLDEGLNAYYTSDLDHRINPGETMICVGNIKR
FT                   GFDYPDSAFVMLSDGDIFGHVRKKKKRVKKYEGESISSFSDLHVGDYVVHENYGLGVYK
FT                   GTEQMELDRVIRDYIKIEYAKGSNLYVLTNQLDQIQKYSGPDGKKPKLNSLGAGTQEWT
FT                   RTKQKVQSAVGVVAKELVDLYALRQNTDGFIYGPDTVWQKEFEESFPYEETEGQLSAID
FT                   AVKSDMESSKIMDRLICGDVGFGKTEVAMRAAFKAVQEGKQVAYLVPTTILAQQHYNNF
FT                   VQRMGGYPVNVGLLCRFRSAAEQKKQFKI"
FT   CDS             complement(578847..580496)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06490"
FT                   /product="Sulfate permease and related transporters (MFS
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73560"
FT                   /db_xref="GOA:D4J0C1"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR030402"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C1"
FT                   /protein_id="CBK73560.1"
FT                   /translation="MEHFKPMLFTCMKDYSKEQLVKDVISGIIVAIIALPLSIALALAS
FT                   GVGPEPGLYTAIVAGFLISFFGGSTVQIAGPTAAFATIVAGIIATDGMDGLIIATIMAG
FT                   IILIILGVVKAGALIKFIPYTITTGFTAGIAVTILIGQFKDFFGMDFHGEKPIETMDKL
FT                   KLFFVNIDTINWQAVLVGVVCLAILIIWPKFFSKIPASIIAVFAGILMVQGLGLKVNTI
FT                   GTLYPDLKAGLPSITVPHFSLSVMRKEMPNAFTIAILAAIESLLSAVVADGMVNSKHRS
FT                   NQELIGQGIGNIGSVLFGGIPATGAIARTAANIKNGGRTPIAGMVHSVTLLIILVVLMP
FT                   YAKFIPMPCIAAILFQVAYNMCQWRPFTRLVKYAPKSDIIVLVLTFVLTVVFDLVVAIE
FT                   WGMIVACILFIKRMSEETHVSGWTYLGDEEEFVDDLRPVAKEIRVFEITGPLFFGVSDM
FT                   LAESINVKDFTKVLIIRMRSVPAIDVTALRALRDLVERAEKKGVTVVFSHVNEQPRHMM
FT                   EKADFIKIVGEDNFQPNIDAAIERAEALLWLK"
FT   CDS             complement(580504..581610)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06500"
FT                   /product="pilus retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73561"
FT                   /db_xref="GOA:D4J0C2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C2"
FT                   /protein_id="CBK73561.1"
FT                   /translation="MAVDIVSYLTDAVNKYKASDVFIITGREVSFRVNDQVMTRSELEE
FT                   SAVEKSEADDGPIMPDKAEELVSQIYALAKRDIEPYKKNGDDDFSFAIKNVSRFRVNAF
FT                   KQRGSYAAVVRVITFSLPDYKQLGIPETVINLSNESKGLVLVTGPAGSGKSTTLSCIVD
FT                   KINKNYNKHIITLEDPVEYLHKHGKSIVSQREIHLDTENYVTALRASLRQSPDVILLGE
FT                   MRDAETISVAMTAAETGHLILSTLHTIGAANTIDRIIDVFPSEQQHQIALQLSMVIKAV
FT                   VSQQLVPALDGTLVPAFEVMTVTPAIRNMIRENKVPQIEGVIYSSDTEDMVSMDSSLYK
FT                   LVKDGRISKDTALEYAVNAEMLGRRLGV"
FT   CDS             complement(581620..581988)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73562"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C3"
FT                   /protein_id="CBK73562.1"
FT                   /translation="MEAQKKQTRSIINIGTSLMVVILIGLSFAVIAALTISSSHNNYSL
FT                   SQKQLEHTNEYYAASNEAQERIASTDWADQEFTVSINDSQDLSVKVSDGEIVRWKIVNS
FT                   GSWEAESTQPVITLDEGN"
FT   CDS             complement(582009..582254)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73563"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C4"
FT                   /protein_id="CBK73563.1"
FT                   /translation="MTGAVNVAANAAEEYLSNPYFEGYTQYFDDSWQQVPENGVYKATA
FT                   VITEPKNSKNCQSLRIVVATEDDQEIYSLIVEKALK"
FT   CDS             complement(582251..582388)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73564"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C5"
FT                   /protein_id="CBK73564.1"
FT                   /translation="MKTRNNGSRIFMTELMFSILFLSSYQLCVYSVLQLHLPEARMQRK
FT                   "
FT   CDS             complement(582930..583286)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73565"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C6"
FT                   /protein_id="CBK73565.1"
FT                   /translation="MAKTRFGSLDGIHQIRKKNVASTTLISAGLFILIFIGFLFAVSKA
FT                   SKGSVDEQRKNLEGAVDRAIMQCYVTEGRYPQSFDYLQKNYGIIYDDELFRVDYVIYGT
FT                   NMKPDVTIINIGGN"
FT   CDS             complement(583288..584340)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06560"
FT                   /product="Type II secretory pathway, component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73566"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C7"
FT                   /protein_id="CBK73566.1"
FT                   /translation="MSEKSRKKLTSEELYAFSDEMGMMISSGVSAIQGLAMMIDESEGG
FT                   EEKELLVEMEKVVGQTGSLSKAIEDAEVFPDYFVEMAKMGEQTGKMDSVLVNLAAHYSR
FT                   EMAISSAIRSAVTYPLMMVAMMLVIIIVLVTEIMPVFDRVFKQLGGTMDGLSAGFLTIG
FT                   KFLKSNGVIFLILLIAIVVYLIVINKTSWGKEHRNGILYKSRRFKSIHSKIATSRFASA
FT                   MAMTLSSGMDVMQSLDVSGRIVEAPDFENKVEKCKDSFAETMDIGKAFSNSGIFGGLYG
FT                   RMAILGAKTGNMETVLEKVASTYQEEADEEINDLIAVVEPTLVIILSVIVGIILLSVML
FT                   PLLNIMSGMI"
FT   CDS             complement(585355..585777)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73567"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C8"
FT                   /protein_id="CBK73567.1"
FT                   /translation="MAISGRMKRTPNCVGVCVDEAKSGFSGRIFNCFSKEPQTFTDITE
FT                   LFYIIDSVMDALSFPAIKTKHRSFKKTKSDFQPKPIDVENKVLETEELIPADEDAGFVI
FT                   MVTSRDNVTWQGKLYDKKKDVEYNFNSEVELIRLLK"
FT   CDS             complement(585778..587025)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06590"
FT                   /product="DNA-binding transcriptional activator of the SARP
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73568"
FT                   /db_xref="GOA:D4J0C9"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0C9"
FT                   /protein_id="CBK73568.1"
FT                   /translation="MVNQTIIIKARMLGNVEVSYEGKPFTIERNNTTKVNQLFQMLLYY
FT                   TNGLAREQVMYNLFHNEDIADESNSLRALVFRLRKALPKVGLPDEDYVHVKRGTYRISP
FT                   NVTVECDAIEFENLAKQALAAEDIKEQQKLLEKAVAVYNGDFLPGLSGVEWVVSVQVKL
FT                   KKLFDRCLKQLMEMYVLQEKYDKLYKVSHKADALYPYDNWQTYEMQALIELGKAKEALK
FT                   LYEDTEALMFQELGVSVSSAMTEQLDKLGEQVKNNTDVISEVKKNLDTSKEDIEGAFYC
FT                   TYPIFVESYRYIKRVIRRSGQSAWLMLCTITDGKGFALNDSDRLSLLSDELSEAIRTSA
FT                   RGGDMYARYSNNQYVVLLLDITQEDCVLVQARINENLSKESRKRYIKYHLAPVNLASAG
FT                   TDNDTDELQDIVRGDE"
FT   CDS             complement(587154..587723)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06600"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /function="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73569"
FT                   /db_xref="GOA:D4J0D0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D0"
FT                   /protein_id="CBK73569.1"
FT                   /translation="MYLIVGLGNPERKYDGTRHNVGFEAIDAISKKFGIEVNHKEHKGL
FT                   VGKGIINGKKVILAKPQTYMNLSGECVLPLTDYYEIDPSTEMVVISDDVLLSTGNIRVR
FT                   KKGSAGGHNGLKNIIALIGSNEFPRIRVGVGECENGDMVSHVLGRYDKEDRERVDASME
FT                   KVIGAVELFLDGDLDSAMNKYNVKEK"
FT   CDS             complement(587729..587989)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06610"
FT                   /product="Uncharacterized protein, involved in the
FT                   regulation of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73570"
FT                   /db_xref="GOA:D4J0D1"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D1"
FT                   /protein_id="CBK73570.1"
FT                   /translation="MQITDIRIRKIEKEGKMKAVVSVTIDEEFVIHDIKIIEGDKGLFI
FT                   AMPSRRGSEGGYKDIAHPIKSSTREQMQTMILNKYKEEFPE"
FT   CDS             complement(588031..589128)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06620"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73571"
FT                   /db_xref="GOA:D4J0D2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D2"
FT                   /protein_id="CBK73571.1"
FT                   /translation="MKALGIILAGGNSSRMQQLTDKRAIAAMPIGGSYRCIDFVLSNMT
FT                   NSHIQTVAVLSQYNARSLNEHLNSSKWWNFGRKQGGLFLFTPTVTTNNSWWYRGTADAI
FT                   WQNIDFLKKRHEPYVIIASGDGVYKLDFNKVLDYHIEKQADITVVCAKLPEGDDINRYG
FT                   VVSMDRDGRITEFEEKPMVATSDLVSAGVYIIRRRALIDLLEECNREGRYNFVTDILIR
FT                   YKSMKKIYGYKMEGYWSNIADVESYFKANMDFLRKDVRDNFFHSEPGVFSKTHDLPPAK
FT                   YNTGSKVKNSLIAGGCIINSTVENSVLFKKAFVGNNSVVKNCVILNGAYIGDNVHVENC
FT                   IVESHETLLSGSTYIGEKWNPHRYR"
FT   CDS             complement(589125..590399)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06630"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73572"
FT                   /db_xref="GOA:D4J0D3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D3"
FT                   /protein_id="CBK73572.1"
FT                   /translation="MIRKEMIAMLLAGGQGSRLGVLTSDVAKPAVSFGGKYRIIDFPLS
FT                   NCINSGIDTVGVLTQYQPLVLNSHIGIGIPWDLDRNNGGVTVLPPYEKSDTSEWYSGTA
FT                   NAIFQNLKYMENYNPEYVLILSGDHIYKMDYEAMLDFHKAKGADVTIAVIPVPWEEASR
FT                   FGVVIADDDKRIREFEEKPPQPRSNLASMGIYIFTWKALKESLLALKDQSNCDFGKHVL
FT                   PYLHEKGSPMYAYEFNSYWKDVGTLGSYWEANMELIDLIPEFNLYEEFWKIYTNQNIIE
FT                   PQFVASTAVVEKAIVGAGAQIYGEVYNSVLGAGVIIEEGTVIRDSIIMEGVKIGKNCII
FT                   DKSIVAENTVIGEGAKIGQGEEAESKLNASVYAFGLAVIGENSTIPANVTIGKNTAIKG
FT                   ETSEGDYPDGQLASGGYIIKAGDRL"
FT   CDS             590763..592007
FT                   /transl_table=11
FT                   /locus_tag="CIY_06640"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /function="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73573"
FT                   /db_xref="GOA:D4J0D4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D4"
FT                   /protein_id="CBK73573.1"
FT                   /translation="MSGLAEILLGAGFTISGSDRDCSDLTKHLEALGAKVNYPQAASNI
FT                   TDDIDLIVYTAAISDDNPELMAAKASGKPMLTRAELLGEIMENYANSITVAGTHGKTTT
FT                   TSMVSQILLETSKEPTITVGAILDAIHSNVHVGDSDIFVAEACEYTNSFHSFFPKYNII
FT                   LNVEADHLDFFKNLDNVRASFRKFAENTSDDGALIINNEIDNVSYFTEGLKCKVITYAL
FT                   HGDADIVPTEISYNEKGFASFVPVYKGQALERITLNVPGDHNISNALSAIVLCLEMGVD
FT                   YSCIKTGLSKFGGAHRRFELKGIYKGATVIDDYAHHPTEIRASLAAAANYPHNRIIVCF
FT                   QSHTYTRTLSLLDDFAEALSAADIVILPDIYAAREPDIYGVSSKDIADRLEKLGTEAHY
FT                   LGTFEACEKFLKKMF"
FT   CDS             592293..593393
FT                   /transl_table=11
FT                   /locus_tag="CIY_06650"
FT                   /product="DnaD and phage-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73574"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D5"
FT                   /protein_id="CBK73574.1"
FT                   /translation="MADIMLHTTTNTGFTCVPNTFIDDFMKEANGEYVKVYLYLLRSLN
FT                   RDGYEFSISQLADCLDHTEKDVMRAFTYWEKVGLLRLEYSPDNELSGIYLVDVNGNGYD
FT                   KTESPVISNITSMHRATKPVTTQTASQKPTYTPDELKAFSEDSQVEDLIFATQTYLKKT
FT                   LSVSETTTLLYWYDSLHFSVDLIQYLVETCIGSGHSSFHYMDAVARNWAEDGITTVDEA
FT                   ISTSSARNNMVYSIMKAFGISGRVLVEAELNYVNKWSSIYGMDLEIICEACKRTILQTN
FT                   NVSFPYADSIINSWHKAGVKTMDDIERLDQEHNLANVAKISSASRTRNSAANSNAAAKT
FT                   KATSKFHNFSQRDYNFDELEKKILGN"
FT   CDS             593406..594398
FT                   /transl_table=11
FT                   /locus_tag="CIY_06660"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73575"
FT                   /db_xref="GOA:D4J0D6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D6"
FT                   /protein_id="CBK73575.1"
FT                   /translation="MALTNEQYDALMRIYNNKQARNNQIVAYRTEEVYSAIPTLSQLDE
FT                   EVSRVSVSSITAIFNGSDINEAAAQSKRKLSELKDRRIKLMESAGFPADYLEPPYDCPD
FT                   CKDTGYINGKRCHCFKQAAINLVYKQSNISNILSKENFDYFDLNVYDENYYEGNSEVNA
FT                   RATAQIALERAQNFVQNFKTKGGNLMLLGQTGCGKTFLSNCIAKALLDEGISVIYFTAS
FT                   ELFKVFEDQTFKRNVNVEDLHDQIFDCDLLIIDDLGTEFPNNFTITKLFQCLNERLLRN
FT                   KSTVISTNLSLEEMRDTYSERITSRVFSYYDAIRLIGDDIRIKKVMLNK"
FT   CDS             594421..595599
FT                   /transl_table=11
FT                   /locus_tag="CIY_06670"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73576"
FT                   /db_xref="GOA:D4J0D7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D7"
FT                   /protein_id="CBK73576.1"
FT                   /translation="MPNNEIVLENTPPMAELGLIPHKSCTAIAERVNDYLLQWRQERKS
FT                   DQSIITLAGYRSDSYIVDADCPRFGSGEAKGIIKQSVRGLDLYILVDVTNYSLTYTVCG
FT                   HENHMSPDDIYCDLKRIIAAAMGKAKRITVIIPFLYEGRQHRRSARESLDCAMALQELV
FT                   HMGVDNIITFDAHDPRVQNAIPLHSFETVSPTYQFLKGIFKNCKDLKLDNDNLMIISPD
FT                   EGGTKRAVYMASVLGVNVGMFYKRRDYSRIVDGRNPIVAHEFLGNDVAGKDVIIVDDMI
FT                   SSGESMIDVATELKKRNAKRIFVVATFGLFTNGMAKFDEAVEKGIIYRVVTTNLTYLPE
FT                   EVQNKDYFIKCDMSKYIAYIIDTLNHECSISELLNPYGRIEKLINRYKNGEY"
FT   CDS             complement(595690..597876)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06680"
FT                   /product="Phosphoglycerol transferase and related proteins,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73577"
FT                   /db_xref="GOA:D4J0D8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D8"
FT                   /protein_id="CBK73577.1"
FT                   /translation="MKKVLSKIKSGLCWIGKAIKVPFTALANSKPVQGFLNSKVHKGWM
FT                   MLWDKYAFWMQIPLSMIIIFIMEWMSRHSFTAAWTFVVDHTGPYLFNSYCVFVTLSIVF
FT                   LSKRRGWWRTFISMIFIILGIINCVILLNRVSPFGYTDLYMIGDLLTMQDSNYFSAQQA
FT                   MLSVAALIIYIIIMSVYAHKGPKKEDAKPLWQRIVLVFALFLSLYPSTVLLRNSGIMTS
FT                   YFGNLAQGYLDYGYLYGFSTSVLDRGMNRPFGYSEAKIDTILENDDAYIQTLQTADGTR
FT                   PNIVVILLESFYDVSECKFLETSEDPIPFIHSLEQNYSTGHCIVPVVGAGTCNSEFEVL
FT                   TGLSCNFFGPGEYPQKTILKEVDVESYADVLNEIGYTSHVVHNNGGNFYSRKNAFSQMG
FT                   FDTFTSKEMLDITEYTPLGNWPTDDILLPATMDAMDSTEGSDFIYTITVEGHGSYPEYE
FT                   VEKDPEIKVKANGKTEGQNYAWEYYVNRIHNVDDFIKNYIQAFDERGEDTLVIMFGDHL
FT                   PTMGLTSDEVATGDLYKTKYFTWNNFGMEKQDADLTSYQLVSEYLNRLNIHNGNINGYH
FT                   QTAMAAGKKYGTSDYMSDLKMLQYDIMYGDRYTYKDGKEYKPSDIVMGVKDVNIDRAYF
FT                   FNGKLHIYGDEFTKWSKVFINDEQVSTKYESGQVLTVNASDVKNGDKIKVCQVGSSNTI
FT                   FRESNEYVVYDPHYVEETEEESIEDGEADTDSAD"
FT   CDS             598013..600565
FT                   /transl_table=11
FT                   /locus_tag="CIY_06690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73578"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0D9"
FT                   /protein_id="CBK73578.1"
FT                   /translation="MKLQFYKKGIPTKILKRIAVLSVVFIISLIFFEIITNVSEVLEIS
FT                   SQSSPTLPIVKVDYLSDASTELHGYVSEMDPAYMRDAIIPLDSERNISLSIDTKDYQID
FT                   GLSYEIRSLDTQRNISKNELKYKKKDGILTTSFQAENLIDANEEYLLVITLTSQSNKIY
FT                   YYTRIMQPEGCNEEEILDFAQYFHNTALSEDATDLATYIEPKSSMNNTDLSHVTINSNL
FT                   SQISYGTFKGTQVGDTNVALTDISNNYISLTLGYTLSLDNKGKTEYYTCSEDYRIRYTS
FT                   DRIYLLAYDRTMEQILDENSISITDNLVDIGITDADVQYLSNETGTIVSFVQNGSLYQY
FT                   NQTDRQAKEIFSFVDDPTDSRSTYGQHQVLILNIDESGTMDYVVYGYMNSGSHEGLCGI
FT                   NLYHYDAISNISSEQVFIPSTSSFQILNANFSDLLYETADNEFYIMVNGTLLYMNLNDL
FT                   STKELLTGLDERQYASSGSRRYLAWMDSATVSETIHIMDLERGQSFDIEAGSGQLLRPL
FT                   AFMDEDLIYGTIHQKDITTDGAGTKIYPMYSLTIADITSGSERQLMNYKKSGYYISDVS
FT                   LQSYTIYLDRIQIDADGNILAADQDTIKNSAGEQNKAVPITTAEDDVKQQVVILNMTPL
FT                   AEDEKLGKIKYEVTNLVLADESHSISVASATSSTQYFVYVGSKVKLATDNLIDAISLAD
FT                   EEMGIVLDNEPKYIWKRGRKAYQTSISPITVGSSDFEASGSARALSAMLVHEGENVQVH
FT                   TLLESGETPISILTKTLKGYSILDLTGANLSEALYYVSNGTPVYAYTGDDTAVLIIGYD
FT                   ATSIIYFDPIKGTNAKMSMTEATDYFASYGNVFVSYIK"
FT   CDS             complement(600676..601323)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06700"
FT                   /product="YhhN-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73579"
FT                   /db_xref="GOA:D4J0E0"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E0"
FT                   /protein_id="CBK73579.1"
FT                   /translation="MIVETIVYLALLIALFRVCDNSLSRRYYVPLKVVCSASFLVILWI
FT                   EQFYSDKLWMMFWALLACFVGDLLMGLYNIYMRKRFMVLGIIAFMLGHLGLLNYMCRIT
FT                   DDTSSLVYMLPVVVCVFMVLIKKMWHLHMGSLFVPCLIYCYFVTTMTLKAIECGLSNMP
FT                   ELAAAGILFWLSDFTILFLYFYHFTDKNTKRMVHYVNLATYYVAILLFIYSL"
FT   CDS             complement(603096..604274)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06720"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73580"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E1"
FT                   /protein_id="CBK73580.1"
FT                   /translation="MAENRRFIIGGYEFETYYEYRAAQEDVKKIECINEELDIQDPEVA
FT                   LRLYNDIRDGIITFNSPIGKQYADHIADIVANKSAGMLDDREIIEEAAGKAKSSRLFGL
FT                   IFVSIAAVLVVIFAGIEIKEIAETRKIAKLQESVQKATNTNNSQNKVNINNEIDDIGTV
FT                   EDSNAGQGEDNNTPAKVIEDDLIVSPWDTDYSADDREILPELTELYSTNPDLVGVLEVV
FT                   DTDINYPVVQTPNDPEYYLRRDFYGKDSTAGTLFVDYRCDIVNPTTNTIIYGHNMRSGT
FT                   MFGGLKRYLNHDYYQAHKKIIFKTLYEEQEYEVVGVGLSEVGYDDDDSYKYYNFIHAVT
FT                   GAELQEFLDNIQRLSAFDETIDISSTDKILTLSTCNTYKEDGRMFIVAKRVK"
FT   CDS             complement(604416..610589)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73581"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E2"
FT                   /protein_id="CBK73581.1"
FT                   /translation="MDKWLFTYSSFGMEKRKNEAVEEWFNGSANETKSGSEVDFADAQS
FT                   MTTLPNKYDSRPAGNEANTYNTITVTVTPKANTQFYGTRTITYEIQPMDIGASGDIITR
FT                   AGTIREYPYTGALITPIVKLQYKYGTDSANTYKLNTKIEGGQEVATTADFKLNIDTIGP
FT                   ASTESTIQRKILGHGNFRGETTVVFEISKGDVTLWLQPKAGGNPIALTPLVKPDSTSDN
FT                   QTFEITDQESYFYQKGQEFKPNLYLKDASGTNTLTADECEGPVYTNYDVPSKNGVKATA
FT                   VLTVKDGGNYKPRTVTVTYTISTNDIGEENDGYTAVMKDFIYDAQTTLNPAKVKDKIRG
FT                   DSEFLVVKRGNQVLNYAATEDDANGDYVILTSEEADFITWKTQNQITSNYTGTNNSPSV
FT                   DDTVNYIWIKGINAYSGYKKVPVKILLNISDDNIARVYTNASRYNLDENGENPTVVDGT
FT                   DGLKAIIKYRAIGQGNITTVLDQETDADYTKDSNYTLTRGREGLPGPDRTIKVVGKGTC
FT                   TGTATGIKKENDSEYPAFLVSLGTYKGISISGGTIYPYTGNPVNVNFTGIDDGITIEAD
FT                   KAVYEENINNYTDGDYTIIYKKTANAAENVQGDHTTAGKWYAIIKAQQDSRYFKYPSSS
FT                   DTDAAREKYAFYIKYYLEDTYVDFTFDGGATVGYEGTAVEVKPIIKTKDGAVTLYNWSD
FT                   TPDTTREKYIKVNRTTVPGMGTYNIVATSNNELVVDNNGVGLTKPFKVTGVALKDSDVT
FT                   IKDDVSNLIYTGTEYTPAVEVKSAGQTLKVNIDYTVKYEDNAEAGTAKIIVTGKNNYSG
FT                   TVEKTFNIAKKKLDDSDILDSNGEYKSGYEGYSKITIETEDCHYVGSKDDNGNTIYLKP
FT                   GFTVKYGNITLVEGKDFELDGEGYENNSSIATELITTAKPKIMIKTKSTSRNFTGSRNE
FT                   QFIIEKLDISNSNLVQITPDSTEYTGEILDPYEIIKVKVPYGDTTSTLEKYREKTDDPG
FT                   KFIGDYTISVRDSAGNEVSNIKEMGTYKLVITGQLNCTGEVSRDFTVNKRSLADNYHYY
FT                   YKTGEGFKYTIWEYKPNLYENEEGHVEVPGFVTRGINPETGAADSLLIWIEDVTSVSKG
FT                   GENKPKVHIWDYGVKDSNGNATELSTDDFTISVTNASEAGTAAWAREIPPTDPFHAPVA
FT                   STSPAVKITGKGDRYKDDSITLPFNIGKNIKNLNLEITYKVNGVNKPYNPIWDNPTATT
FT                   LETGIGSWERYEYNGYPQTPTVTVRLINADGTKTTLRERTNYEVSYTDINGNRDDSINA
FT                   GWKNVVITGIGDYCGTKSQTYGINKKKITAVTQDNKAFTNENPMETTQGELTFNLSGTG
FT                   LYRFTDEATAIKYLVPEGVTEEDAKKFVGYYYAIYDGEPVKPDVTVRDNTLGPERNRKG
FT                   VISSTDLDVDKNSTDSYPKADTVSTFEYSGSTLNYTTSQVVIGFANKKEDGAGDFSAGG
FT                   NYYVGETSVKYSINYFILRHDITDDFTVSFVNGFDNNNVPYNEGKAIPAPVEVKKGLQV
FT                   LEEGVDYELVYDNNFAPSYRKPATVTVKGIDKYRGEQTLSFTITCDLDKTSIYYYNEDN
FT                   VFTKCPDPYGPTQLYSGTWIYKGEPEIYLVLEANNNHEDIKLEYGTDYSAPSPSDHYSE
FT                   DSYVRSGEVYYRAIPSSCWTGSKTVIYDIEYDESSVRVTNNEGTYKYTGRDIKPKFNVN
FT                   ISTAKIDRDNILYERVALDSNGNVTENNETTDFKSLGYIRATIPYKVGEYPGEVTAIYQ
FT                   IVPRPISECTVIYAAEQRYTGRAVKPAFTVVIESTDLQTEKPNEPYVVEETDYNVNYGN
FT                   YICNDYAESQTINYKGEDMTLSRAGKGMFVLTGNSDEITRSSTKGYEYGIKLQSPANLE
FT                   VKDNIGESMRAEWVSDVYSNGTDLKLQTANNGTYKTYITTRIAGSRGAYLFENLKSSTN
FT                   YRVVATAYAKLADGTTIYSDDKYIDVVTEVASNDIKVESTKAGKAKVSWVPSGDIVLYY
FT                   VYRADDPVSEGKVVAIIPASSGSYTNSKLTSGTTYYYHIDGYALIDGVLSKDPVNSSEH
FT                   VPVTIK"
FT   CDS             complement(611950..615228)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73582"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E3"
FT                   /protein_id="CBK73582.1"
FT                   /translation="MRENLNAIKRLVAFFLTVFLFATTVWNDVFVIATEENHCSEYVDE
FT                   QTYAANVLQPVGEGDGYCDHCGQVVQAHVHEEPASEPAEETAAVDEAAPETEAEGEVQN
FT                   PEATNPEVANPEPAAEEPEGGATGDTAAETEIDKPENSDETPTDETDIETTPEDELDED
FT                   ELTDEELAEEEELEEDEEEECEHEWSYTSNNNGTHIKKCKLCDEEVEEDCLLDDNGVCH
FT                   LCGYEDERLVYQSTTKKIFGTVVTVSGKMPRGSYVEIYYAGTKPVEDIINENTEEKNVT
FT                   ALVAFDINIYRRGGEKYQPQEDGGSVNVRFAGVDEVEELAPEEVSVYRIEDNDTVTKID
FT                   CQLDGENVSFKADHFTIYAAAATGLSNPSTQMLESYEHFAMIGSTGSNEYTTLEEAYFY
FT                   VYFPTAGTISFTIDTYKNLTSATNPTRGTQLYASETVTVTGAKGEYKKVGANFTHTASS
FT                   YITANKYYSVVVSADETCNVVVGQEQIKSYIYTTSDEWVDNSNYEGIFHIVSNNTAPTD
FT                   SSLTIDHIKDQDGKDLLEKNESYIYYYGKNDTDTFTATFNEANVDRTITWGYGTTTSSN
FT                   VVQIVSTTSTTASIKAVGAGSAKITASYGSSTKTININVLEFKVGTDSFEDYSVQYTGT
FT                   VIHPDVKGYITGAAESNLAVTYDDDNELYSNVNDDAKVYLTYTSPGDSSYKKTWTKSFK
FT                   ITPLEITSDVFYIDTNSDGKNDRNVEFTVAAGEIQSMTGMGTIAANTGKPNATQVSLVY
FT                   NQNNQDFSAIITNTVPSSGGLKYTIAISGIGNFTGDFEVTLTNGTGLTKISSILKAQAR
FT                   GTGLSGKTYTGNDFALTDRYDSTTLLGWNEVEFVGNDEVAVDEIVTKETADVTITDLTT
FT                   GASDAASAGLKKITFTMKQNSGYEGDLSVNFRIYPANISAATIEWTDTSRNFKHKVGDA
FT                   EVQPQPDIDFVVKFGGNVVHEFADDDKTIRNFTVSYSNNTAITSNARVILTGNGNFTGE
FT                   KTDTFNIVANFANDVVVIINDGTEYRATEANDFNFTTAGYTRYYDPTFNGETTANLNNV
FT                   YSLFSVQVPGNRAAGSTLTQGTDYTIQVYDEGSTTLTADVKTKR"
FT   CDS             615515..615679
FT                   /transl_table=11
FT                   /locus_tag="CIY_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73583"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E4"
FT                   /protein_id="CBK73583.1"
FT                   /translation="MSTDEKIASVQASFAMEDMILTAEELERGRMIIENKIDVEDVVRE
FT                   ITSRYVSVG"
FT   CDS             615684..616295
FT                   /transl_table=11
FT                   /locus_tag="CIY_06770"
FT                   /product="Protein involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73584"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E5"
FT                   /protein_id="CBK73584.1"
FT                   /translation="MMDEYYRYEYEDNGQYCYPHTHILKNKLDIHDKDELFKVEQELSS
FT                   ARYFELVKRPIPGDFSLDHLCAIHRYLFQDIYEWAGKIRTVDISKGTIFCLTQFIEIEF
FT                   KRVQDWLVANNYLIDVTDKNEMAKKLAFLIGEINMIHPFREGNGRAQRVYIEYVCKNSK
FT                   TFDIDFSKTTKNDMILASKESSVLNYEPFEELLFKCLVDI"
FT   CDS             complement(616355..618265)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06780"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73585"
FT                   /db_xref="GOA:D4J0E6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E6"
FT                   /protein_id="CBK73585.1"
FT                   /translation="MPRGPQPGSVPKLTAEQKAKRRGVLGRLFKYIGANYWLHLIVVVV
FT                   GIFTAVICNAKGTAFMQTLIDSYIVPMLQSGSTDFGPLAAAIKDLIFYYALGAIATFVY
FT                   NYTMIFVGQGTLRNLRDDMFEKMEDLPIRYFDTHAHGDVMSIYTNDIDTMRQMISQSFP
FT                   QILNSAITIVTVFTYMVLTSWPLTIVTILMIVLITFTTAAVAGRSGSYFRKQQKALGAV
FT                   NGNIEEIMKGQKVVKVFCHEEEVMEKFNELNEELYNNAYKANRLANCIGPVNMQMGNIS
FT                   YLACAVVGGVLAINGWTGLTLGGLAAFLSFNRAFNMPVNQISQQFQSIVLAMAGAERVF
FT                   DLIDEEPEVDDGYVMLVNAREVNGEIVECEEHTGMWAWKHYHKAEGTTTYVKLTGDIVF
FT                   DDVDFSYNPDKPVLHNIKLFATPGQKIAFVGATGAGKTTITNLINRFYDIADGKIRYDG
FT                   ININKIKKADLRRSLGIVLQDTHLFTGTIADNIRYGKLDATDEEVVAAAKLANADSFIH
FT                   RLPQGYDTVITGDGGNLSQGQRQLLAIARAAIADPPVLILDEATSSIDTRTEKIVQDGM
FT                   DKLMHGRTTFVIAHRLSTIRNSDCIMVLDQGRIIERGSHEELIGEGGKYYQLYTGKIQN
FT                   A"
FT   CDS             complement(620054..620512)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06800"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73586"
FT                   /db_xref="GOA:D4J0E7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E7"
FT                   /protein_id="CBK73586.1"
FT                   /translation="MLEDFDSRIHLGFLCDCVSREIKKAVGRGVCEINADTCNVKNGWL
FT                   LGFLERQTEPVFQKDLEKLFHLPKSTLADMIQMLEKSGYIAKAPVDGDGRKKQIVVTEE
FT                   GEKYVNMTESQILAVDDYIVKDISTEEMDKVVEILEKLRKMQRNTNPM"
FT   CDS             620787..621347
FT                   /transl_table=11
FT                   /locus_tag="CIY_06810"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73587"
FT                   /db_xref="GOA:D4J0E8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E8"
FT                   /protein_id="CBK73587.1"
FT                   /translation="MRERSKDLRVRRTINSIRRAFFELVLEKNYNEISITELTERAGIN
FT                   RKTFYLHFSSLDDFVAEIEEEIVADILDHIGENAEAFDLAGCITNFYLYLESCNEVQQK
FT                   LLCDEHYSFFYESVTEGVLRSVPFSKFFERTEYPSIVRSYTISITFIYRDWLKSGKQIP
FT                   FDVLTAQASKIVENGYAGIIKKK"
FT   CDS             complement(621404..622342)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06820"
FT                   /product="glucokinase"
FT                   /function="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73588"
FT                   /db_xref="GOA:D4J0E9"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0E9"
FT                   /protein_id="CBK73588.1"
FT                   /translation="MAKYGFGLDLGGTTCKCGLFTTEGELVEKWEVPTDTSNGGVNILK
FT                   NLAQAVIKKMEEKGISTDDVSGVGIGIPGPISKDGVVNRCVNLGWGVFNVEKEFSECLG
FT                   GLKVKAGNDANVAALGEAWMGAAKEYSSSVMVTLGTGVGGGVIINDDIVSGAAGAAGEI
FT                   GHIRVNYTEENTCGCGNRGCLEQYCSATGIARLARIRLAENDDASTLREVESLDAKAVF
FT                   DEAKKGDVVAKEIVKRACEYLAQGLQVISCVVNPEAFVIGGGVSRAGQYLIDEVEYRFN
FT                   EIAFHGCKNTKITLATLGNDAGIFGAMKLIL"
FT   CDS             624943..625887
FT                   /transl_table=11
FT                   /locus_tag="CIY_06840"
FT                   /product="aldose 1-epimerase"
FT                   /function="aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73589"
FT                   /db_xref="GOA:D4J0F0"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F0"
FT                   /protein_id="CBK73589.1"
FT                   /translation="MNFGCNLLELWVPDKEGILSDVVLGYENIEDYFVNGPGFGCCICP
FT                   NGNRIGDSKFTLNGVEYKLDANDGKNNLHSGFNPMHKRIWDVESVDDGHITFTCHKADM
FT                   ECGFPGEMDITITYTLSDDNALKLEYSGISDVDTIFNPTNHSYFNLNGHDSGSVMNHIV
FT                   WIDADRYTHTDSESIPHGECREVKGTPMDFTTPKALIKDTDADYDQLNWAGGFDHNYCL
FT                   NNPSLTKPSCTLEDPESGRKMEVYTDLPGVQLYAGNYLDNSHLGKGEFPYDKRYGVCFE
FT                   SQYFPNAINVPSFAQPIAKAGVKAHSTTIYKFV"
FT   CDS             complement(625952..626890)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06850"
FT                   /product="Transketolase, C-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73590"
FT                   /db_xref="GOA:D4J0F1"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F1"
FT                   /protein_id="CBK73590.1"
FT                   /translation="MADVKKIATRESYGNALVALGEKYDNLVVLDADLAEATKTGIFKK
FT                   AFPERHIDCGIAESNMVGIAAGIASTGKVPFCSSFAMFAAGRAFEQVRNSVGYPHLNVK
FT                   IGATHAGISVGEDGASHQCNEDIALMRTIPGMTIINPSDDVEAKAAVEAAYKMDGPVYL
FT                   RFGRLAVPVINDRPDYKFEIGKGVVLKEGKNLTIIATGLEVNESLEAAKKLAEDGIDAE
FT                   VINIHTIKPIDADLIVKSASKTGKVVTVEEHSIIGGLGGAVAEVLSEKCPTKMLRIGVK
FT                   DTFGESGPAVKLLAKYELDAEGIYKQIKAFI"
FT   CDS             complement(626893..627717)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06860"
FT                   /product="Transketolase, N-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73591"
FT                   /db_xref="GOA:D4J0F2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F2"
FT                   /protein_id="CBK73591.1"
FT                   /translation="MTNQELKTTAIEVRKGIIEGVHAAKAGHPGGSLSATEVFTYLYFE
FT                   EMNIDPKNPKKADRDRFVLSKGHTAPGLYSALAQRGFFPVEDLKTLRSIGSHLQGHPCV
FT                   QHTPGIDASSGSLGQGISVATGMALSAKLSNESYRVYTLLGDGEIQEGQVWEAAMFAAA
FT                   KKLDNLCVIVDNNGLQIDGRIEDVNSPYPIPDKFRAFNFHVVEVADGNDFDQLRAAFKE
FT                   ARETKGQPTAIVMKTVKGKGISFMENQVGWHGKAPNDEEYAIAMEELRKAGE"
FT   CDS             complement(627834..628130)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06870"
FT                   /product="Archaea bacterial proteins of unknown function."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73592"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F3"
FT                   /protein_id="CBK73592.1"
FT                   /translation="MDEYMETVFIKICGEYLVDRSNKNMLPFTVEEIGNWWVNDDEAGT
FT                   TDGFDLVSLGKCDGKSATIFAQCYYNHEPIEVAQLKLLIEKQSSFTDRETHSI"
FT   CDS             complement(628945..629163)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06890"
FT                   /product="Archaeal ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73593"
FT                   /db_xref="GOA:D4J0F4"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F4"
FT                   /protein_id="CBK73593.1"
FT                   /translation="MFKGRTNEIQQLNGFFEGNTVSVAVVSGSIGIGKTALLQEFSKDK
FT                   QALFFEAYETTGKHQLERLAKLMGKNL"
FT   CDS             complement(629436..630746)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06900"
FT                   /product="Predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73594"
FT                   /db_xref="GOA:D4J0F5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F5"
FT                   /protein_id="CBK73594.1"
FT                   /translation="MGDSSKGFRTAAFAGARDLINEENGKWMNYVTRLLTETDPHVAKM
FT                   TALNLGYQAAFKGTKMIRENREKYNCNIPWLILMDPTSACNLRCKGCWAAEYGHKLNLT
FT                   FEELDSIVTQGKKLGIFFYMLTGGEPLVRKDDIIKLCEKHNDCAFHSYTNGTLVDQAFC
FT                   DEMKRVGNLTLSISLEGFEDANDFRRGDGVYAKVLKAMDLLHENGLIFGNSVCYTTKNM
FT                   DSVTSDEFFDLLIEHGSRFAWYFHLMPVGMSATPELMPTPEQREYIYHRIREVRARRGG
FT                   KEIYVMDFQNDGEFVGGCIAGGRNYCHINPKGDVEPCVFIHYSGANIREKTLLECLQQP
FT                   LFMEYRKGQPFNDNMLRPCPMLENPELLQEMVKRSGAHSTDVQEAEPVEHLCGKCAEYA
FT                   ANWKETADRLWMAHPYRQKGYINYADAKEKGYAYKVE"
FT   CDS             complement(630773..630868)
FT                   /transl_table=11
FT                   /locus_tag="CIY_06910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73595"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F6"
FT                   /protein_id="CBK73595.1"
FT                   /translation="MEVKDNVERAAFAVAIDGVLKNIKKTLKITY"
FT   CDS             631036..631218
FT                   /transl_table=11
FT                   /locus_tag="CIY_06920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73596"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F7"
FT                   /protein_id="CBK73596.1"
FT                   /translation="MPGFITHLSFGEQSLSFIESSYTTDLLEKHMHSYGLGLQGPDIFF
FT                   YHIPAYLFIRKISET"
FT   CDS             631218..632009
FT                   /transl_table=11
FT                   /locus_tag="CIY_06930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73597"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F8"
FT                   /protein_id="CBK73597.1"
FT                   /translation="MHRQRVMLFFESLFNARNVFEDTHSRCICDAYILGFIGHYSLDIV
FT                   CHPYIYYKSDHFNNLKRGGVYDFGRHVSLETDIDHEVLMHYKKLLPSQFDYAKAICPSD
FT                   NEKRVIATLLFNTISQTFPEYHIRFGTILHAIDSIIRLNHAMNDPKGRKKKHIRRIEQV
FT                   FFKCAVISSMIPSDTIIKYQDPCNNEHAKWYNPWDPEKIREDSIFDLINKTMPKYIERI
FT                   NLYMNCVNETTEDTDQILHYRNRLLSSLSDLSYLSGLPLLI"
FT   tRNA            complement(632048..632123)
FT                   /locus_tag="CIY_T_35370"
FT   tRNA            complement(632130..632203)
FT                   /locus_tag="CIY_T_35360"
FT   tRNA            complement(632217..632298)
FT                   /locus_tag="CIY_T_35350"
FT   tRNA            complement(632324..632396)
FT                   /locus_tag="CIY_T_35340"
FT   tRNA            complement(632419..632492)
FT                   /locus_tag="CIY_T_35330"
FT   tRNA            632593..632664
FT                   /locus_tag="CIY_T_34810"
FT   tRNA            632747..632818
FT                   /locus_tag="CIY_T_34820"
FT   tRNA            632843..632915
FT                   /locus_tag="CIY_T_34830"
FT   tRNA            632981..633054
FT                   /locus_tag="CIY_T_34840"
FT   tRNA            633074..633147
FT                   /locus_tag="CIY_T_34850"
FT   tRNA            633169..633241
FT                   /locus_tag="CIY_T_34860"
FT   tRNA            633314..633397
FT                   /locus_tag="CIY_T_34870"
FT   tRNA            633426..633499
FT                   /locus_tag="CIY_T_34880"
FT   CDS             633654..634409
FT                   /transl_table=11
FT                   /locus_tag="CIY_06940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73598"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0F9"
FT                   /protein_id="CBK73598.1"
FT                   /translation="MKRRNKRIISIITIAVALVLVVACGAWFVLKNNTLDNSENEISTV
FT                   ENNENESAKTEDVANSESENTVNKDEQKDTNDMTPEELFQAFCDGKITAEARSYYDDTT
FT                   WTMDNTSFQLEETTPEEDLDPTIAVKKLEPVDLDNDGEVEFILESAFYGDMCFDCKDGK
FT                   VVCFAQGEGTAAMCSYTQYDGAYWIVHSDTTHAGRCTYELTKFNGDLQVVDSFKFGWED
FT                   WEDTGVKTYYQDDNEITEADYEALYDKVF"
FT   CDS             634589..634906
FT                   /transl_table=11
FT                   /locus_tag="CIY_06950"
FT                   /product="Uncharacterized BCR, YitT family COG1284."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73599"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G0"
FT                   /protein_id="CBK73599.1"
FT                   /translation="MKQGEAMKKTQGFLSYIFIIIGAIMASFSVALILLPNDAIDYGTA
FT                   GVAIILSKLTRIDLSVCVIIVFLPFILAGFIFLGKKFTLKAAIGSIFYTLGLDFFEKNS
FT                   L"
FT   CDS             635451..635939
FT                   /transl_table=11
FT                   /locus_tag="CIY_06970"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73600"
FT                   /db_xref="GOA:D4J0G1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G1"
FT                   /protein_id="CBK73600.1"
FT                   /translation="MAEIWDAYNKDFTRIEGMSLVRGQHIPDNIYHLVCDIIVRHVDGS
FT                   YLIMQRDLEKTHGGLWELSAGGSALQGEDPEEAAIRELKEETGIIGNLVEVGRTVQDKN
FT                   HSIYVIYLCQTECAKDSIRLQEGETINYKWISRNELLEMTDETLITHRALKILKEQNL"
FT   CDS             636018..636116
FT                   /transl_table=11
FT                   /locus_tag="CIY_06980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73601"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G2"
FT                   /protein_id="CBK73601.1"
FT                   /translation="MTWKTTNIHLMKGSILAVYGDSALFLHQFREK"
FT   CDS             636201..636431
FT                   /transl_table=11
FT                   /locus_tag="CIY_06990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73602"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G3"
FT                   /protein_id="CBK73602.1"
FT                   /translation="MELFIDKNKARKQIRKLYLIDSLGGLMIGGAAWVALLAARGFSTV
FT                   EIGFAESIFHVASMIFEIPSGALADVFGRKR"
FT   CDS             636431..637306
FT                   /transl_table=11
FT                   /locus_tag="CIY_07000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73603"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G4"
FT                   /protein_id="CBK73603.1"
FT                   /translation="MILSSIMTIISSTFMILSRSFVGIAVTMIFSALSYNLASGTREAL
FT                   AYDSLKDAGIEDEYQKFASNDLMIYQIFSSTGTLLIGVALMLGYKKANLVDIILAIICV
FT                   GIAGTFFEIKTNLNQKKSVIGRFKEVAVESTRFIKNNRKARFIIFFNALTGAISILILF
FT                   FLQAKLPEFGLPKIWLGPALFIMGLGAALGAKVIQYFSKLRYMIIGSVSIMGVLLAFAS
FT                   IFTGNVWLIIIGGFIGAFFDNFLEVRTDVLLNDMVPSDQRTTLMSINSFTFSVIMIVLS
FT                   PIFGWIFSAI"
FT   CDS             637474..638181
FT                   /transl_table=11
FT                   /locus_tag="CIY_07010"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73604"
FT                   /db_xref="GOA:D4J0G5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G5"
FT                   /protein_id="CBK73604.1"
FT                   /translation="MNNILICDDEKDIISALRIYLESEGMNVTAASNGREAVDIMAGPN
FT                   GKDMQLILMDVMMPEMDGIAAMAEIRKTSNVPIIMLTAKSEDADKVIGLTVGADDYVTK
FT                   PFNPVELMARVKSQLRRYTMLGSQNNDNIVNTNTISIGGIELNDKSKEVTLDGNPVSLT
FT                   PLEYDILKLLMTHKGEVLSPRDIYESVWNETGLGAESTVAVHIRHLREKLEYDSANPRH
FT                   LKAVWGHGYKFEG"
FT   CDS             638181..638399
FT                   /transl_table=11
FT                   /locus_tag="CIY_07020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73605"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G6"
FT                   /protein_id="CBK73605.1"
FT                   /translation="MPLEDDMKIFYKSSRRLILAICSSVFAVLFVISAVLGLILGELGL
FT                   YDSDTDRFKDEIYQYAGDSYAPMIFFI"
FT   CDS             640823..644278
FT                   /transl_table=11
FT                   /locus_tag="CIY_07040"
FT                   /product="Beta-glucanase/Beta-glucan synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73606"
FT                   /db_xref="GOA:D4J0G7"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G7"
FT                   /protein_id="CBK73606.1"
FT                   /translation="MAYERRNNMKKGKWFNALAMAMTASLAVTSVPAIVQAKSSEGFAN
FT                   KYSDEGYSLVWNDEFDGESLNTSDWNVEQHEPGWVNSELQRYTSLDEGNIQVKDGKLSL
FT                   KPHVTETESTDDNDAQVEEKVTNVSFDFSFDAEDSDTIAVQLNFGKIDSLGDAGVAQAT
FT                   VKLSNLSLVDTEDDTQIFTDRNFENGGWSCGISAPGKGSYSFEDGKAVINIEDSGDANW
FT                   NIQLQQTGIKLQQGHHYKFSADAVANADRGIEVSVLDPEKGWAWYGGATATIEGSAISG
FT                   GSSSSGKREITSGRITTQNKHDFTYGRFEARAKVPAGKGYLPAFWLMATDEGLYGQWPK
FT                   CGEIDIMEVMGQDTSKSYHTIHYGYSAGSGHKENQGSKTLRENDFADEYHVFRMDWEPG
FT                   KITWFVDDEQVYTTSDWYTGADDASQLTYPAPFDQNFYVILNLAVGGSWVGYPDDDVYG
FT                   HMNDDSYDVDYVRVYQKSEEEYEKEEAKAKRPEKEPVKFREPDEDGNFVINGDFAKNIA
FT                   IDGAEDADKDNWVLHLESDAKETTYKVADNKIKIEPSAVGSQNHSVQLKQAGIPMYKGW
FT                   EYELTFDAVADEERDIIVDVEGPDRGWTRYMQDTSVRVGTEKKSYTYTFTMNDKTDPNT
FT                   ALEFNLGKQKSTAAVTISNVKLVHKSGETVADENLKEIRPDGNYVYNGGFDQGEGRLGY
FT                   WDIDDKDKSAVSVTNKKNSRVLKVVAPKGTSAKKPVKVSQGELSPLVAGQYEISFDAYT
FT                   EEGSKDGITVNAAGHTFTPELTENSKHFAKKIVVEKNLSREESNVELLFTKPGTYYVDN
FT                   VFLTEAALIKNGSFNAGLTGFNPYIYDSVNANYVIDNMNGNDNTFAITIDDTVADTDDN
FT                   CWYIQLNQDGVTLEKGKTYTVSFKAKSSIDRVIKYSLQEFEGNWTNYSDTGSVEIGPEW
FT                   KIFTNTFTMESDTDTNTRFNITMGSVDGIRITEKHDVFIDDIELIEVGADEPTHTDEPA
FT                   QPEVKPAPKPSQGGAPSGSSSSRPSSSSSSSSSSSSSSRPSSTTVSPTQTPNVVIADAQ
FT                   VPTTGKTEAKPQAKKIDSGKTKSNTKVAQAAESDEESEEAEAEDAETEIEDEEAPKAAE
FT                   EAVEEPATEEETEEAEQPEEKTGFWAAIVNFFKAIADFFRSLFS"
FT   CDS             644944..645429
FT                   /transl_table=11
FT                   /locus_tag="CIY_07060"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73607"
FT                   /db_xref="GOA:D4J0G8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G8"
FT                   /protein_id="CBK73607.1"
FT                   /translation="MYLLGIRLGLFPIISKDVSITSVAMPTLTLAIAMSAKYLRQVRAT
FT                   VLDELSKDYIVGAKARGVKFSVVLWQSVMRECLVTIITLLALSIGSLLGGTAIVESIFM
FT                   WDGVGKMAVDAINLRDYPIIQAYVMWMAIIYVTVNLITDLSYRLLDPRIRLEGNINE"
FT   CDS             645422..646228
FT                   /transl_table=11
FT                   /locus_tag="CIY_07070"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73608"
FT                   /db_xref="GOA:D4J0G9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0G9"
FT                   /protein_id="CBK73608.1"
FT                   /translation="MNRKPSKKLIVFTVLAASLILASIFADWLCPYDPYEQDLSLSYNA
FT                   PSLAHIMGTDTYGRDMFSRVIIGARASILSTLALVGVITVLGTIVGVICGYFGGKVDLV
FT                   VMRISDFFLAFPGLVFALAVAALLGGGISNAVIALAVISWPKYSRVARSQTLSVKAQSF
FT                   IQAAKLAGDNPGQIIIRHILPNIFGPILVTSMLDIGTMMMELAGLSFLGLGAQPPIAEW
FT                   GSMMSNGRSMLQTYPWVVLSPGIAIFISVVIFNLLGDTVRDYLDPK"
FT   CDS             646265..647848
FT                   /transl_table=11
FT                   /locus_tag="CIY_07080"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73609"
FT                   /db_xref="GOA:D4J0H0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H0"
FT                   /protein_id="CBK73609.1"
FT                   /translation="MKGIKKSIAFVMAMALTLSVFTGCGAKNSDSESASTETNKSVDGK
FT                   KTFTFGDTTFNAENEEANIDPHDTYCGWACIRYGIGETLFKFNDNMELEPWVAESYENV
FT                   DELTWKVVLKDGVTFSNGKACDAAAVKACIEDLVAVHERAAGDLAIDSIEADGNTLTIK
FT                   TQTPKPTLINYLCDPYGCIIDVESGNADGIVVGTGPFVCTELVTSDHLNLVKNENYWNG
FT                   DVKIDEATVLTISDGDTLALALQNGDIDAAYGMAYANYPLFENDQYTFTGTPTSRAFYC
FT                   QMNYNSPIIKDDAVRKALALGIDKEGFVNTLLNGYGYIGVGAFPDNFAFGGDVVKTESY
FT                   DPEAAKSLLEEAGWVDSDGDGIREKDGKTLTIRWISYPSRQELPLLAESAQATLKDIGF
FT                   DVQLNVTADHGTIVAEKDTWDVYAAAFVTCGIGDPMYFFTTHCLDDSSKNRGGYHNDNI
FT                   QALAEEMNNTFDSAERGDIAVKMQQQILDDNAFIFCSFLRMSMIAKSNVTGLVAHPSDY
FT                   YEFTADLDIQ"
FT   CDS             647929..648396
FT                   /transl_table=11
FT                   /locus_tag="CIY_07090"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73610"
FT                   /db_xref="GOA:D4J0H1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H1"
FT                   /protein_id="CBK73610.1"
FT                   /translation="MSQEILKYDSVEISFEKCPVVQDISFSLHEGEILALVGESGSGKS
FT                   SLIRSALGILNDDGKVTKGEILYRGTNLLQLKEREMRQIRGAKIGMIFQDAKSSLCPIR
FT                   TIGDQILESLSAHGKTNKAEAKKNPWSFLISLVLRMEKKFGIAIHLNYQGV"
FT   CDS             648393..648713
FT                   /transl_table=11
FT                   /locus_tag="CIY_07100"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73611"
FT                   /db_xref="GOA:D4J0H2"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H2"
FT                   /protein_id="CBK73611.1"
FT                   /translation="MNQRASIAITMLLNPSILLADEPTSALDVAVQKQVVDEMLKLREI
FT                   FGAAIIIVTHDISVAAAMADTVLVLKEGRMMEYGPAKKIFESPESEYTKLLLSAVPKLK
FT                   RK"
FT   CDS             649507..650301
FT                   /transl_table=11
FT                   /locus_tag="CIY_07130"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73612"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H3"
FT                   /protein_id="CBK73612.1"
FT                   /translation="MIYFTGMDNSLIKENRAYWLQRAAGYSEVNKEELSGVQRSNWTSF
FT                   LTNEISKAFPEKEPSEISIIDIGAGPGFISIILAEAGYKVTAFDFADTMLEEAKANAKE
FT                   LADRIQFIQGDAMDTSLAPESYDVVISRNLTWNLPRPDNAYREWLRILKKNGLMMVFDA
FT                   NWYRYLVDEDKKAAYEADRQNVVQEGYGDYNIGENFDQMEIIASQMPLTKMIRPEWDKQ
FT                   FLTENHAGQVFVQEDVGSILYSQKELINYKSTPMFMVKVIKE"
FT   CDS             650348..651112
FT                   /transl_table=11
FT                   /locus_tag="CIY_07140"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73613"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H4"
FT                   /protein_id="CBK73613.1"
FT                   /translation="MGELHHIAFEDEADNIKEKVESYWTKRAQGFFELRHDEIESNKAA
FT                   RWTKALNELLPKKECLNILDVGCGTGYFEVLLGKLGHRVTGVDLTEEMIVKANEMIQMY
FT                   GLDTENIKAIIGDAEKLDFDDNTFDAVITRNLTWTLPHPIEAYKEWNRVLKKGGILINF
FT                   DAEYAKGAHNLKSPENLAHSKISDSLKDECHDIYHMLTISTLDRPEWDKAVLLRNNYEN
FT                   ITVNLDFGSHIFIEHDEFYTPEKMFCLTAFKP"
FT   CDS             complement(651429..651767)
FT                   /transl_table=11
FT                   /locus_tag="CIY_07150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73614"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H5"
FT                   /protein_id="CBK73614.1"
FT                   /translation="MYSHRGTFNIVFQVTTAAAVLAAAAYTLQNLLFIFLSSFQTHTSC
FT                   SLNLKILLSSNIVRPLTTFLKIVKAYKRHLLIRMRVFAYMENIIFLRCFPSSGRGWARA
FT                   GGAAMSNN"
FT   CDS             652138..652809
FT                   /transl_table=11
FT                   /locus_tag="CIY_07160"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73615"
FT                   /db_xref="GOA:D4J0H6"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H6"
FT                   /protein_id="CBK73615.1"
FT                   /translation="MGEVKVIEIGESVFAENDAAAEAIRQQMKKQGTFFVNVMSGPGSG
FT                   KTTTLSAIINRMKDKYKIGEMDVDIETSIDAQRVADATGVQSIQIHNMGLCHIDADMTS
FT                   RALMEYDTNDFDLLILENIGNLVCPAEFDVGANKNLMLLSVPEGDDKPLKYPLMFEISD
FT                   VVLINKIDTLDYFDFSKEKVTERILKLNPNAKIFFVSGKTGEGLDDVVAWLEEEIAKAK
FT                   A"
FT   CDS             653032..654621
FT                   /transl_table=11
FT                   /locus_tag="CIY_07170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73616"
FT                   /db_xref="GOA:D4J0H7"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H7"
FT                   /protein_id="CBK73616.1"
FT                   /translation="MKLFKKITTIAMALAVMITAIAGTSGLSIKAEAAGGVAIGGVVIS
FT                   GGNVVVAASGQTASDDGVYHLIASDANQAGNTGVEVAQAPVSAAANFTFPLNKNTADSV
FT                   LFKKFTVCVMKGGALTAASNSMYITNPEACATRTTPRMDNGKKGLLTDASSANLGMRTL
FT                   ADLGVKQATVSLPLSKISDGNGVPYVYNGKTYNFNTKIIANFDNYLGRLNAQGVQVTMI
FT                   LLVDQGAKREFISPYSYDGLGAHNYYGLNATTTEGIELLAAAGSFIASRWSSYSYFGMN
FT                   AKVDNFVIGNEVNAWNEWNYMNCGPNFEVYTQEYAKAFRILYNAIKSENANCNVYTCTD
FT                   HHWALNERTVYGSKKFLTQFNNIIRSQGNIDWRLALHAYDYPLTNVQSWAPTANIQRNQ
FT                   NTKFISVYNIDVVTDFLCQKEFLSPSGAVRTVKLSEQGYTSSQGEEVQCVAITYAMLVV
FT                   NNNSHIDGFILSREKDDPHIEMPQGLANGLLRYDNTAKPSYEFYKHAGEPEYTAKAGAL
FT                   IGIDLNTLLAPR"
FT   CDS             654862..655872
FT                   /transl_table=11
FT                   /locus_tag="CIY_07180"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73617"
FT                   /db_xref="GOA:D4J0H8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H8"
FT                   /protein_id="CBK73617.1"
FT                   /translation="MTIKDIAKLAGVSVSTVSRVLNDHPDVSEKAKEKVLAVVNEYNYI
FT                   PNTSARDLGKSSSDNIGLIVRGISNPFYTKIITEIGDKIEKAGYTMVMQQIGTSDDEIL
FT                   TAARMERDKRLLGVIFLGGRLDYTKEQVSAINVPFVCCTFNNQYGTLDKSDYSSVCIDD
FT                   NQAAYEAVEYLYKEGHRRIAVLLSGPDDGSVSQVRFAGYVRALNDFGIQLDDELIIPID
FT                   SYNIADAYEGMKAWLKQNKDFSAVFAISDNMAMGAMKALREAKKSIPKDVAVIAIDGIE
FT                   ASEYMNPVLSTLCQPMEKMGEEAVKLVVDIINGKKNHKHILLPTILREGESLREV"
FT   CDS             655954..657264
FT                   /transl_table=11
FT                   /locus_tag="CIY_07190"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73618"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0H9"
FT                   /protein_id="CBK73618.1"
FT                   /translation="MKRKKVLALGLIAMMSAMTFAGCGSSASKDGAGDSASADGASGKV
FT                   YYLNFKPEADEAWQKIAKQYTEETGVPVTVITAASGTYEETLSSEIVKDEAPTLFQVNG
FT                   PVGLANWADYCYDLKDSSLYNELTSDSFALYNDDAVAGIAYVIESYGIITNTKLLEEAG
FT                   YTTDDIQSFDDLKKVAEDITARSSELGFSAFTSAGMDGSSDWRFKTHLANLPIYFEYQD
FT                   KGIDSTDAIEGKYLDNYKAIWDLYINNSTCKPADLAGKTGDDAENEFVEGKAVFFQNGS
FT                   WEYANLTDKGMTDDELAMIPIYIGAGDEKNQGLCTGTENFWCVNSEASEEDIQATIDFL
FT                   TWMVTSEAGTKMLSEQIGVIPFKKAADTTNLFVLNDRAYTEAGKTPVSWNFTTMPSEEW
FT                   KNGVGSALTAYAAGTGSWDDVVSAFVDGWASEYAASH"
FT   CDS             657572..658423
FT                   /transl_table=11
FT                   /locus_tag="CIY_07200"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73619"
FT                   /db_xref="GOA:D4J0I0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I0"
FT                   /protein_id="CBK73619.1"
FT                   /translation="MEKAIRRYWPIFVLPTLAAFSVGFIYPFVQGLYLSFCKFTTIKKS
FT                   TFIGFGNYAYAITDADFWHSFWFTALFTVVSTVLINVIAFAIALALTKEIKGSNFFRTV
FT                   FFMPNLIGGIVLGYIWQILINCVLSIAEKPLLALDATYGFIGLTILMCWQQIGYMMIIY
FT                   IAGLQSIPDDYIEAAKIDGATSGQILFRIKIPNVMPSITICSFLTITNGFKLFDQNLAL
FT                   TGGEPAHASEMLALNIYNTFYSRTGPQWKGYGQAKAVIFCIMVILISMIQLKFTKSKEV
FT                   QQ"
FT   CDS             658423..659265
FT                   /transl_table=11
FT                   /locus_tag="CIY_07210"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73620"
FT                   /db_xref="GOA:D4J0I1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I1"
FT                   /protein_id="CBK73620.1"
FT                   /translation="MKTKEKVARVVVFIVLCLLAIFWIYPVFMILINSLKGDTFISTNT
FT                   VFQLPNVKSFAGVENYVNALTAKGFAAAFGYSFVITVSSAVLILLCTSMCAWYITRVHG
FT                   ILSKVCYALFVFSMVVPFQMLMFTLASTADRMDLDTPFNICIIYLGFGAGLAVFMFTGF
FT                   MKSIPLEIEEAAMIDGCNPIQTFFRIVLPILKPTLISVAILETMWLWNDYLLPYLVLDR
FT                   KKYMTIPILIQYFRGSYGHVEMGPMMACIMMTVLPIIIMYICLQKYIIKGVIAGAVKG"
FT   CDS             659379..660938
FT                   /transl_table=11
FT                   /locus_tag="CIY_07220"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73621"
FT                   /db_xref="GOA:D4J0I2"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I2"
FT                   /protein_id="CBK73621.1"
FT                   /translation="MKRSSGILLPISSLPSPYGIGTFGKAAYDFADFLKASGQKYWQVL
FT                   PLGPTSYGDSPYQSFSTFAGNPYFIDLETLIEEGLLTKKEVEAENWGTNPRYVDYGQIY
FT                   ESRFKILEKAKERGCKDSLGDIALFRKQNAWVENYALFMSIKKHFGQLSWQEWPEEDIR
FT                   LHEKKAVEKYTKELAEDIEFYIYIQYLFFKQWAKLKTYINSLGIEVIGDLPIYVALDSC
FT                   DVWAEPEFFSLDDENYPVEVAGVPPDYFSETGQLWGNPCYDWKAMKKDNYRWWIRRIDG
FT                   ASKLYDVLRIDHFRGFDEYWAVPAKEKTAKRGKWKKGPGMDLVGLLSKTFPNIEFIAED
FT                   LGEPSPTVVKLLQDSGWPGMKVLEFAFDSGEANNYQPHSYDKNCVCYTGTHDNATVMEW
FT                   YEDADKKDRDYASKYLGISKSEGFNWGLIRGGMSSVAVLFVAQMQDFLGLGKYNRINVP
FT                   GTDSGNWQWRLLAKEPTTELAKKIFDMSLLYERTTKPPKPKKPEKPQKPQKKQAKKASS
FT                   KK"
FT   CDS             661093..661707
FT                   /transl_table=11
FT                   /locus_tag="CIY_07230"
FT                   /product="Glycosyl hydrolase family 3 C terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73622"
FT                   /db_xref="GOA:D4J0I3"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR026892"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I3"
FT                   /protein_id="CBK73622.1"
FT                   /translation="MQKWSRLLYQPALPLYGDRRVTGCEEHIKLSRKAASEGMVLLEND
FT                   GVLPLSKKQPLALFGKGSVDYVKGGGGSGDVYCKYVHSLYDGLKAKGVSVYEPLISYYK
FT                   EDLKEQYGKGRVPGMTSEPEVSEELLKGAIAYTDTAVIVISRFSGEGWDRSDVECNNEY
FT                   NPWESETSMPKISGEIFPNGDFYLTDEEKKLVDIVKANFKK"
FT   CDS             662453..663496
FT                   /transl_table=11
FT                   /locus_tag="CIY_07250"
FT                   /product="Beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73623"
FT                   /db_xref="GOA:D4J0I4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026892"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I4"
FT                   /protein_id="CBK73623.1"
FT                   /translation="MLADGSYEELPQGQHKDINESIIKKMEPGTEEGLTPSVRARDSYC
FT                   LIYPYKEGAHPLSDVAEGKITLDEFMEQLSTEDLMNLVGGQPNTGVANTFGFGNLPEYG
FT                   VPSAMTADGPAGVRIAPETGILTTAFPCATLLACTWNTHLIAQVGKAGGEEIKENNLAV
FT                   WLTPAINIHRSPLCGRNFEYYSEDPLLAGKLGAALVDGIQCNHVGASVKHFACNNKETN
FT                   RKHSDSRVSERALREIYLKAFEIVVKEAQPYTIMSAYNAVNGERASESHDLLTGILREE
FT                   WGYEGMVTSDWWTRGEQYKEVNAGNDLKMGNGFVDRLKLADEKGALDHDQLKLNAKRIL
FT                   NTILKFD"
FT   CDS             663599..663736
FT                   /transl_table=11
FT                   /locus_tag="CIY_07260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73624"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I5"
FT                   /protein_id="CBK73624.1"
FT                   /translation="MKFAEENLEEVNMSKINYVDKNGTFELKNPEHTSGLYLPMASKKD
FT                   "
FT   CDS             663793..664662
FT                   /transl_table=11
FT                   /locus_tag="CIY_07270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73625"
FT                   /db_xref="GOA:D4J0I6"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I6"
FT                   /protein_id="CBK73625.1"
FT                   /translation="MIAPKSILNLSNDRDTRNFFLVMDGKLWSVTGVSAEQEANRFTDK
FT                   EDSTKLTAGRMWQRVERNHTSGRLKSSTTIFDTLDHNAEIMLVTIENLSDEDLFFEPVA
FT                   AIPLYGRSADNLRDHRHVTSLLNRAVITDDGVVMHPTLSFDERGHQKNDMSYFVFGRDE
FT                   NGNKPNRFIADVEDYLGAGGTFLRPRSLLDKKSKDTIWKKPTEAIDGKEIVAVLRFPKC
FT                   TLKKSESCSFQIVTGMVDDENIAEMDIIRRLIYSKTQVENLFETTKITGIVLLILFLKL
FT                   AMKDSMDL"
FT   CDS             664659..666350
FT                   /transl_table=11
FT                   /locus_tag="CIY_07280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73626"
FT                   /db_xref="GOA:D4J0I7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I7"
FT                   /protein_id="CBK73626.1"
FT                   /translation="MKWVSFQPELRRIFGCSFLPHHDYGRGGRGWRDLWQDCLALLLTD
FT                   PTQVRDMLVNNFKGVRLDGTNATIIGDKKGEFKADRNGIPRVWMDHGFWPFLTVKLYMD
FT                   QTGDLDILNEKVSYFKDALINRVTKRDEEHSKEYGLEQKNAKGEVYKGTILEHILLENL
FT                   CAFYDVGAHNEIRILNADWNDALDMAPDKGESVAFTCGYAGNLKELATYLRIYKAKTGR
FT                   SKVSILKELLILLEEDSILVYGNPAKRRKVLEKYVQAVSDEILGETVLVEIEKISVLLE
FT                   HKADFMMKQIREEEWVTDKEGNGWFNGYYDNNGIRVEGDFENGVRMMLTGQVFSIMSGT
FT                   AKKESVASIVKSCDKYLYKKGLGGYALNTDFKDLRLDLGRMFGFAYGEKENGAVFSHMA
FT                   VMYANALYKRGFVKEGYKAINELFMASDNFEISNIYPGVPEYFNEKGKGLYSYLTGAAS
FT                   WYLLTMVTEAFGVRGNAGDLYIEPKLLKEQFDEEGIAAIQVPFRGHRFKVVFKNTKHKD
FT                   YGDYSISNVIIDSTSKVKPQKNQVIIPEKLLIDWNEKDHIVEIELK"
FT   CDS             666365..669436
FT                   /transl_table=11
FT                   /locus_tag="CIY_07290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73627"
FT                   /db_xref="GOA:D4J0I8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I8"
FT                   /protein_id="CBK73627.1"
FT                   /translation="MQINTEVKDEIFDYGRKTPFASFLPGISGVEGIPMWCYYVNRGQA
FT                   VVSFGVQDKDHSIMEFYPAHTAYQNVKRTGFRTFIKVDGEIIEPFSKENDSNKMSIYMN
FT                   VLGLEDVVHEKGIKVNVNYGTLPGEKIGALMRVVEITNESDGDRELEIIDGMPCLIPYG
FT                   VNQESMKMMAQTTKAWMQVEDVENKHPYYRVRVSMEDSAEVSRVEGGNFAVGFLADGTP
FT                   LDVIVDPGVVFDYDLSLENPMGFVRKSIDALFEKKQNTSNELPCAFFGTKKLLKKNEII
FT                   TLYELIGQVRNKDILGRFLGQKIDREYFQKKFFEAAELTEKLTAVVNTKTANRVFDNYC
FT                   RYNYMDNVLRGGTPIRLTDNHTFYVYSRKHGDLERDYNYFAMSPEFYSQGNGNFRDVNQ
FT                   NRRCDTFFSPEVMEDNIKMFYSLIQLDGYNPLSIEQMRYQVSEDSLDGLCLKQPFTPGE
FT                   LAAALMDTGDDKFDKEQKDRFVQIMSAAEKTANARFGEGYWSDHWTYNLDLIEEYLEIY
FT                   PDKTEDLLYNTSVKSFNANKKVLPRFERYTKTENGIRQYNYLVNRTEVENASSFECYKN
FT                   GREIDMSLMAKLILMCAVKFATLDAYGLGVEMEGGKPGWYDALNGLPGLMGSSMNETYE
FT                   LARMVEFTKDMLGKFDNNIVFPKAVLEFVSEVKDVTLKATSEFECWNRKNDIKEQYRAK
FT                   VYSGLDEENKEINSDDLKQILEVFSNKLNDSIQKAVELSDGIAPAYFTYEIHDYECKKN
FT                   GIIPKHFSMVKVPYFLEGPVRYFKLGNDVEAKRNMYSKIKNSDLYDEKLSMYKVNASLQ
FT                   DASFEIGRCRAFTPGWLENESIWLHMEYKYLLELIRSGLYEEFFLDFKKAAIPFLDREE
FT                   YGRSTLENSSFIVSSKNPNESIHGKGFVARLSGSTIEFISMWKLIFFGKDIFKYDEENG
FT                   LIFALSPAIPEYLISSGDLKHTVSTTLLGKTELVYEMTTHCDYIPGEYVITDIEVELFD
FT                   GTIYRFNREYVTGEVAKKIRDRLAKKVTVKMTPK"
FT   CDS             669519..670916
FT                   /transl_table=11
FT                   /locus_tag="CIY_07300"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73628"
FT                   /db_xref="GOA:D4J0I9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0I9"
FT                   /protein_id="CBK73628.1"
FT                   /translation="MKLKKLLATILVGACALSLVACGSDGNDAVLEGENVDSATVGSED
FT                   GEKLVIWTLAKDLQTFAEKYAEENPDVQIETVVIEPADYVTKVQTALNGGQTTPDIIVG
FT                   EPQMLEDFYDANYFEDLNQAPYNAQDYADQIVDYVWKVGQDSEGIQRAISYQITPAGIY
FT                   YRRDIAEKVFGTEDPEEIGKLFADYDTVLNTAKTLKDAGYRIFASDAEINYFSGDSAWV
FT                   VDGKLNVNQARLDYMDLVIDLYQNDYTAYANQWSTPWYQAMAGEVPILTADIQNYADDS
FT                   VNVWDAEQFEEATKDLDKTEVFAFGLPSWGVLTLRDNVGETSGKWGVCSGPASGFGGGT
FT                   FIGISSQSEHKDLAWDFLKWVTLDEKTAEWWIEKSEGDTVSLVSVLEKHKDDENSVYGN
FT                   QHMYSFWQAQAENIDYSKVTRYDKVINDAWGAAITAIKTGEKSKDDAIAEFYDVVESTY
FT                   PDITVER"
FT   CDS             671901..672728
FT                   /transl_table=11
FT                   /locus_tag="CIY_07320"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73629"
FT                   /db_xref="GOA:D4J0J0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J0"
FT                   /protein_id="CBK73629.1"
FT                   /translation="MATKIKKVILYIALIVLALGCLLPFWLMIVNSTRSGVEITHSFSF
FT                   LPGHSLKDNWVVLFDYVNLFRGFGNSIKVAVPATLLTAYFSAITAYAMAMYEWKGNNLL
FT                   FKVIVVFMMIPAQLSLIGFYNLCQKLRLIDSYIPLIVPAIAAPGIVFFLRQYVKSTLSK
FT                   ALLEAARIDGASEIHTFHKIVLPIMAPGIATMSIGAFIGNWNSYLTPLILLNTPKKMTL
FT                   PVMISTLNAATDLQKNQGAIYLGVAISVVPIMIVFAFCSKYIISSISAGSVKE"
FT   CDS             672876..673622
FT                   /transl_table=11
FT                   /locus_tag="CIY_07330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73630"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J1"
FT                   /protein_id="CBK73630.1"
FT                   /translation="METKLSTIKRIIAASLVMTTFVGCGKETVDNTPASEDSITLDWYI
FT                   NYSWFNTGWGSSVVSRAITENTGVNINFITPQGNEEEKLNALIESGSLPDLITLGWWEP
FT                   QVNEMIQKDMVYAINQLADEYDPYFYQVCDKQAVSWYTQSDGNIYGYPCSSVTPQDVES
FT                   NDNIGSNQTFLVRKDIYEAIGSPDMTTIAGFERAVRKAKQMFPEVDGKPLIPIGAHLFD
FT                   DSGNVSFDQYIQNFFGCAIRKGWQAL"
FT   CDS             674426..676252
FT                   /transl_table=11
FT                   /locus_tag="CIY_07350"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase./Histidine kinase./HAMP domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73631"
FT                   /db_xref="GOA:D4J0J2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J2"
FT                   /protein_id="CBK73631.1"
FT                   /translation="MLQKQKKNWESIKGVKLNIKLTAIILVFVMVPIAILSGIMFFNIE
FT                   QSTINENVSYLSSTMARRQDSIRNNVDSINMTTQFFLSDETMNKVLLNAKNGGEYTTKE
FT                   WIKIYRNDVAALERLINTNPVLGGARYYASTDNVQEMMPVMYSASRLQKQAWTPMLEEG
FT                   GWIFDYKDNLFSGGDNTPMMALITPVKNRKYGELGVIEANMKMETMFPSLYENVAGEIS
FT                   CFVTAEGRVIFGKNTNEAVRKIAISLARQMQEIAKKGETPDIKTYYSKNDKSVISGMYI
FT                   NELSGTLVSVKNISENIDEVHSQRNAFVFWMICILVVLYFLVNRVVLNLLKNFYDVLRT
FT                   IRQVRAGNLYVRATDVGREDEMGELAHQVNRMLDNIQTLMQQNIDREILAKDSQIKALQ
FT                   NQINAHFIYNVLESIKMMAEMQEEYQISDSITSLGKLLRYSMKWSSNTVLVADELEYIK
FT                   NYMALINLRFDYVIYLSLNIPEEILSQKIPKMSLQPIIENAIIHGVEEIAEDTTIYIKG
FT                   IVIDSDCIIEITDNGRGMNEEELEMLRKKIAGEIETSGSSSNGIGLKNVEDRLKMAYGP
FT                   GYGIEVAAMEGCYTKVSIKIPMIEIDVNEGNS"
FT   CDS             676249..676734
FT                   /transl_table=11
FT                   /locus_tag="CIY_07360"
FT                   /product="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73632"
FT                   /db_xref="GOA:D4J0J3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J3"
FT                   /protein_id="CBK73632.1"
FT                   /translation="MNKILVVEDEKLIRQGISAMIKRSGVPYEEVIECSNGLQALDILK
FT                   TTRIDVMLTDIRMPKMNGIELVQAVQELDNPPLSVAVSGYDDFSYAVEMMRQGVREYIL
FT                   KPVERDKLKEVLTKLDEELNNRRLDEEKTELTDTKLLKYFLQDSGTTSDDIKLIAKK"
FT   CDS             677721..678887
FT                   /transl_table=11
FT                   /locus_tag="CIY_07380"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (trigger factor)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73633"
FT                   /db_xref="GOA:D4J0J4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J4"
FT                   /protein_id="CBK73633.1"
FT                   /translation="MKKRLLALVLICTMAFSLSACGKKEDKAETKTEKTDKTSKKKVAD
FT                   IEYDVDEFVKLGEYKNLEITLDGEYEYSDEGFDKYVQTTIEDAAIYVEDSEAKEIKEDS
FT                   IVNVDYVGSQDGVAFDGGSAEDQLIDVGNNSSATGGGYIEGFTAGLVGHTVGEEVAYEV
FT                   TFPADYGNADLAGQTVVFTFQVNYIAKSINSKKDLTDEIVSDKFGYDTVDAYMDFLKTQ
FT                   YESSLESNLKNDKQTAVLNAVINGSKVSSIPEDLSQARLDMYLNVYNKQYESYGTTAKE
FT                   YFESMGQDYDAYVESMKTSIQESTETELILEAIAKAEGIEIDEDGYKTFIQGILSSSGA
FT                   TDETSFYEVYDVDGYSGERYFRQAYLTQKALDFCIDNASYTGAPAVAE"
FT   CDS             678982..679125
FT                   /transl_table=11
FT                   /locus_tag="CIY_07390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73634"
FT                   /db_xref="InterPro:IPR023975"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J5"
FT                   /protein_id="CBK73634.1"
FT                   /translation="MEHIKTLNTARLQNTVKEGGCGECQTSCQSACKTSCTVGNQSCEH
FT                   SK"
FT   CDS             680861..682945
FT                   /transl_table=11
FT                   /locus_tag="CIY_07410"
FT                   /product="protein translocase subunit secF/protein
FT                   translocase subunit secD"
FT                   /function="protein translocase subunit secF"
FT                   /function="protein translocase subunit secD"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73635"
FT                   /db_xref="GOA:D4J0J6"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J6"
FT                   /protein_id="CBK73635.1"
FT                   /translation="MADTILKLQQRIENDLGEESATTEANVYRVGDDRITVEIPGVSDA
FT                   NALLEELGTPGTLYFIAQKDNEGNENYSYGTTEDGKPGYVLNYDIQTLMDNGSVICTGK
FT                   EVTAAQGRAQQDQTTSATKYVVTLQFNDEGTKAFGDATTVAAVAGETIGIYYDGQFVSV
FT                   PKVNEAITSGNCEISGMSSMEEAEKLASYIRIGGLDIELKELESQVVGAQLGADALRTS
FT                   LIAAGVGLALVMVFLIIMYLVPGVTASLALALYTAMLVSILKAFDITLTLPGIAGMILS
FT                   IGMAVDANVIVFARVREEIKSGRPVVSAIETGFSKALSAILDGNITTLIAAAVLGILGS
FT                   GTVKGFAITLALGVVLSMFTALVITRILINSFYALGIRSPKAYGEAKEPSKFDFVGKKA
FT                   VFIGISVAIIAAGFITMGVFKAKSGSGLNYSLEFLGGTSTTVDFNETYSLADLDAKVVP
FT                   EIAKTLGISEGSIQTTTVDGSNQAIFKTRTLSLEERTSLNEMFENNYNVKDESITSQSI
FT                   GSTISGEMRSQSTIAVIVAVLCMLVYIWFRFKDIRFASSAIIALVHDVLIVLALYSFAR
FT                   ISVGAAFIACMLTVIGYSVNDTIVVFDRIRENHKAIRIENAETLKTLCNESLAQTLSRS
FT                   ISTSITTAIMVLMLLILGVSSIREFALPLLAGVIAGTYSSIFIATQLWYILKLKFASKN
FT                   "
FT   CDS             682967..684256
FT                   /transl_table=11
FT                   /locus_tag="CIY_07420"
FT                   /product="seryl-tRNA synthetase"
FT                   /function="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73636"
FT                   /db_xref="GOA:D4J0J7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J7"
FT                   /protein_id="CBK73636.1"
FT                   /translation="MIDIKFLRENPDAVKENIKKKFQEHKLGLVDEVIELDDKRRATQQ
FT                   QADDMRAEMNKASKQIGALMAQGKKEEAEAAKAEVAELKQKIKDLEPVEKELADKVEEI
FT                   MMKIPNIIDPSVPIGPDDSCNVEIEKFGEPVVPDFEIPYHTDIMERFNGIDLDAAGKVA
FT                   GNGFYYLMGDIARLHSAVISYARDFMIDRGFTYCIPPFMIRSNVVTGVMSFEEMDAMMY
FT                   KIEGEDLYLIGTSEHSMIGKFIDTLNDEANLPYTLTSYSPCFRKEKGAHGIEERGVYRI
FT                   HQFEKQEMIVVCKPEDSKMYYDKLWQNTVDLFRSLDIPVRTLECCSGDLADLKVKSCDV
FT                   EAWSPRQKKYFEVGSCSNLGDAQARRLKIRVKGEDGSKYFAHTLNNTVVAPPRMLIAFL
FT                   ENNLRADGSVAIPKALQPYMGGKTELTPLK"
FT   CDS             684356..686188
FT                   /transl_table=11
FT                   /locus_tag="CIY_07430"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73637"
FT                   /db_xref="GOA:D4J0J8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J8"
FT                   /protein_id="CBK73637.1"
FT                   /translation="MSVQSREDIRNIAIIAHVDHGKTTLVDELLKQSGVFRENQEVAER
FT                   VMDSNDIERERGITILSKNTAVYYKDTKINIIDTPGHADFGGEVERVLKMVNGVVLVVD
FT                   AFEGAMPQTKFVLMKALDLDLPVIVCINKIDRPEARPDEVIDEVLELFMDLDASDEQLD
FT                   CPFIYASAKEGFAIRDLNEEHKDMTALFETIVDYIPAPTGDPEAPTQVLISTIDYNEYV
FT                   GRIGIGKVENGSIKVNQDAIVVNAHDPEKSNKVRISKLFEYDGLNKVDVTEANIGSIVA
FT                   ISGISDIHIGDTICSVDAPNPIPFQKISEPTISMNFIVNDSPLAGQEGKYVTSRHIRER
FT                   LMKELNTDVSLRVEDTDSPDSLKVSGRGELHLSVLIENMRREGFEFAVSKAEVLYKEDE
FT                   KGHKLEPMERAYVDVPDEFTGAVIEKLSQRKGELQNMTPIAGGYTRIEFKIPSRGLIGY
FT                   RGEFMTDTKGNGIINTIFDGYELYKGDISYRKLGSLIAFETGESVTYGLFSAQDRGTLF
FT                   IGPGEKVYSGMVIGQCSRAEDVELNVCKKKHLTNTRSSSADEALTLVPPRVLSLEQALD
FT                   FIDVDELLEVTPESLRIRKRILDPTLRKRASFKK"
FT   CDS             686197..686676
FT                   /transl_table=11
FT                   /locus_tag="CIY_07440"
FT                   /product="ATP:corrinoid adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73638"
FT                   /db_xref="GOA:D4J0J9"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0J9"
FT                   /protein_id="CBK73638.1"
FT                   /translation="MEKGIVQVYYGTGQGKSAAALGQAIRYASEGRSTTIIQFLKSETN
FT                   TDYLSKLEPEIKLFRFERSKDSFADLTEDQKHEEVLNIQNGLNYAKKVLGTGESDLVIL
FT                   DEVLGVVDEGIVSEQDILSALEGRSYSTNVIMTGLNITKGIFEIADSVLNLKPEK"
FT   CDS             686755..687516
FT                   /transl_table=11
FT                   /locus_tag="CIY_07450"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73639"
FT                   /db_xref="GOA:D4J0K0"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K0"
FT                   /protein_id="CBK73639.1"
FT                   /translation="MTKVVMHGCNGHMGRVITDICKSDSDVTIVAGVDKFKGIDNEYPV
FT                   FDSLNQVDVDYDVVIDFSTASAVDGLLDVCEKNNKPVVLCTTGLDENMLAHVDSASKKI
FT                   AILRSANMSLGINTLFDLCKKATQIFADAGFDIEIVEKHHNQKLDAPSGTALALADACN
FT                   DALEEKYEYCYGRADRREKRPKNEIGISAVRGGNIVGEHEVIFAGLDEVITIKHTAYSK
FT                   SVFAKGAVEAAKFLAGKSAGLYDMKEVIAEK"
FT   CDS             687526..688188
FT                   /transl_table=11
FT                   /locus_tag="CIY_07460"
FT                   /product="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73640"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K1"
FT                   /protein_id="CBK73640.1"
FT                   /translation="MYIQLNSQIICYEKTGEGSPVILLHGNREDHHIFDKLTERLEREH
FT                   TVYAMDTRGHGESATPKEYHYGDMANDVINLIDALDIQKPYILGYSDGGIIALLVAMKA
FT                   GGLLSGIICCGANLSPAGLHHKDIREIKKEYKRDNDPRTLLMLQEPNIEPSDLRNIRVP
FT                   AMIIAGEKDCVRQKETEKIADSIPGAILKILPGETHDSYIIQKDTLYPIINNFISKY"
FT   CDS             688311..688814
FT                   /transl_table=11
FT                   /locus_tag="CIY_07470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73641"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K2"
FT                   /protein_id="CBK73641.1"
FT                   /translation="MTNEIKAFYNIGRFLNNIMLVCCALALIICFFTTYDKSEVDTPTV
FT                   EIKPYSVANLEDGSKEYFFDLSEFDSRYSGVMFFTAHQTVLAYNSGKQVYSFTKLGGFW
FT                   GSTPGACYNFISVNEKMTNVAIIIKPMYDVIANKVPVFTLAHHIRCMMNWSAILLLDFA
FT                   PVFL"
FT   CDS             complement(689924..690184)
FT                   /transl_table=11
FT                   /locus_tag="CIY_07490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73642"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K3"
FT                   /protein_id="CBK73642.1"
FT                   /translation="MIDRGRLLSLGYYKKAPSFTGSDKNKCYKIERFRDEDSEEDQFKA
FT                   TIWPGPFSSENTPEESKQSRTAEFSEDGLQSLVEWMNGINL"
FT   CDS             690311..691324
FT                   /transl_table=11
FT                   /locus_tag="CIY_07500"
FT                   /product="Phosphatidylinositol-specific phospholipase C, X
FT                   domain."
FT                   /EC_number="4.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73643"
FT                   /db_xref="GOA:D4J0K4"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K4"
FT                   /protein_id="CBK73643.1"
FT                   /translation="MDKGRLFRIICGVMIALIAGILVVMFVSDDAVTAEYSTDLSKDYA
FT                   DTSSWMEHLSDDIYVSQITLPGTHGSGARNVVLGYSKRCQNTSISEQLEDGYRFLDLRV
FT                   AIEETEDGDKLRLVNDSVDCHASGGIFSNYLYFDDTVEDIYKFLQQHPTETIILSVNIE
FT                   DSDYPIKDIQKLLLTQIKSNKDYWYTDNQIPTLGDVRGRIILATRFNDEAASEITGLNL
FT                   IWNQQDNRVAVDIPYELYVNSDYRFWVQDRYNYSVEDKYEAVVDGLENCEADENTLFIN
FT                   FVSTSGDGKIGHPYGYAQVLNGFLMEYELKSETSYGIVVVDFGTADLARHIYYSNF"
FT   CDS             691344..691595
FT                   /transl_table=11
FT                   /locus_tag="CIY_07510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73644"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K5"
FT                   /protein_id="CBK73644.1"
FT                   /translation="MEKNYEEGEVNPILLEFLDTDSFEEKYKILVATPIMDFDNLLIDN
FT                   MASSIDVVVEDGDIESRVQDLKNCVRTRSKYETLRFRR"
FT   CDS             691709..693730
FT                   /transl_table=11
FT                   /locus_tag="CIY_07520"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73645"
FT                   /db_xref="GOA:D4J0K6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K6"
FT                   /protein_id="CBK73645.1"
FT                   /translation="MANTKSSEKHAKIKNKLIALLMPVVLLQVILLVVISGYISSQSLK
FT                   KMATAQLDSSISNQGDNIESWLQRNLENFATAKQVIETQKPDDEALQSLLDAFYGYNTY
FT                   CTDGFYIASESGKFMKASESSKTVSNPKDEEWYKQGITRVRLNYGGAYKNEKGESVISA
FT                   SGILNDGSDELKVFAADVTLDQISIIVNSGVKMDQATSFLIDSFDNTILAHRDASRIFT
FT                   VLGEDDSDKLMAGIAKKFAERDYTTTEIEGYQVAFRNIAGTEWYLVSYISNSVILQDVN
FT                   KLIQLLAIIGVVAIIIIVILINVLVSRVIAPIGNITKHISDMSAGDFTIKVKQESNDEI
FT                   GLMGRKVSEFVQSMRGMLSEINNESERLKEQSNNSDRVSKDMFDASRSQADAMQNLNAT
FT                   VDQLAIAVNEIAENATTLAMVVADTRDNSNEANVSMKETVEISKKGKADMEQLSAAMEE
FT                   IKNSNDQLVESINEVGKVSEEITKIVSLIKDIADETNLLSLNASIEAARAGEAGKGFAV
FT                   VATEIGKLAQNSASSAENISNLINEVSRAIDSVVEQAQTSAEEIEQNSERIGTALETFD
FT                   QIYLNIEKSNELIELMLDNIQKVDDVANNVAAISEEQAASADEILETSQNMVEQANSIS
FT                   QSSQDVADNSHELANTSQKLTDYVQKFKIDEEVSDYEG"
FT   CDS             693720..694727
FT                   /transl_table=11
FT                   /locus_tag="CIY_07530"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73646"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K7"
FT                   /protein_id="CBK73646.1"
FT                   /translation="MKVNRQCRNLTVLLLTIIMSLGLVLTGCGSSGGSSSSGGSGGLKA
FT                   FYSGPPSDTFKQMLMDKLAEYAPTEGIDLTIGEACASTNDQVEQIKKAVADGYDAIICL
FT                   PVDRATALQLEIAAGDKPIIYVNACPDEQFLKPNKYMAVSSYEMNAGEYQAEYVYNKLG
FT                   KPSSMNIIIFRGEATHNAAVARSVSVKNWLRSQGVEVNVVFDDTANWSTDQAKDLFRIF
FT                   QKTNQSFDAIFCNNDDMALGAVEALKEAGYDLDKYPVVGVDATVAGCESIAKGEMQFTV
FT                   YQSADGQAQKAIQLTKALASGGTADGIEGLSENGFYIWVPFERVDASNVKDYMK"
FT   CDS             complement(694759..694872)
FT                   /transl_table=11
FT                   /locus_tag="CIY_07540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73647"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K8"
FT                   /protein_id="CBK73647.1"
FT                   /translation="MAEVEFPTIEEANSFVPPEWFGEDVTNDKNYHNSNMI"
FT   CDS             complement(695034..695189)
FT                   /transl_table=11
FT                   /locus_tag="CIY_07550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73648"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0K9"
FT                   /protein_id="CBK73648.1"
FT                   /translation="MEIERKFLIKELPDLSKYDYVDIEQGYLCTHPVVRIRKRMTNLFL
FT                   PIKVAA"
FT   CDS             695360..695917
FT                   /transl_table=11
FT                   /locus_tag="CIY_07560"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /function="translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73649"
FT                   /db_xref="GOA:D4J0L0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L0"
FT                   /protein_id="CBK73649.1"
FT                   /translation="MITAGDFRNGMTIEMDNKVYQVIEFQHVKPGKGAAFVRTKLKDIK
FT                   GGGVTETSFRPTEKFPAARIDRKDMQYLYNDGELYNFMDVETYDQVALTADQIGDALKF
FT                   VKENEIVKMLSHNGSIFSVEPPMFVELQITDTEPGFKGDTATGATKPATVETGAVVYVP
FT                   LFVENGETIKIDTRTGEYLSRV"
FT   CDS             695940..696140
FT                   /transl_table=11
FT                   /locus_tag="CIY_07570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73650"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L1"
FT                   /protein_id="CBK73650.1"
FT                   /translation="MDYREYPLSKLLQNRKIYNVFDEEFQKGTWLDATALLGSDSTINQ
FT                   LYRDGTVPRETLDRIVQRLSK"
FT   CDS             696234..697031
FT                   /transl_table=11
FT                   /locus_tag="CIY_07580"
FT                   /product="Uncharacterized flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73651"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L2"
FT                   /protein_id="CBK73651.1"
FT                   /translation="MYISDSIKYIGCNDKTIDLFESQYPVPNGVSYNSYIILDEKVAVM
FT                   DTADPRVTDEWLANLERELAGRKPDYLVVSHMEPDHAGSIKVFLEKYPETTVVGNAKTF
FT                   PMMGQFMDATLFENRKQVVAEGDTLSLGSHELTFVMAPMVHWPEVMVEYESSEKILFSA
FT                   DGFGKFGALDIDEPWIDEARRYYLNIVGKYGVQVQALLKKAAALDIKTICPLHGPILTE
FT                   NLGYYIDLYDKWSSYKPEEDGVLIVSASIHGNTKRAALKLQEN"
FT   CDS             697052..697381
FT                   /transl_table=11
FT                   /locus_tag="CIY_07590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73652"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L3"
FT                   /protein_id="CBK73652.1"
FT                   /translation="MFIDVTREPMSEAVARAFSYSKMVCCACTYDGGLFLPMEDFLHHL
FT                   RAKSYQGRTVGLVENGTWAPQAAKQMRAIFEGMKNIEIVEPVVSIKSTLNAASEAQMDE
FT                   LVSSL"
FT   CDS             697405..698403
FT                   /transl_table=11
FT                   /locus_tag="CIY_07600"
FT                   /product="Adenine-specific DNA methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73653"
FT                   /db_xref="GOA:D4J0L4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L4"
FT                   /protein_id="CBK73653.1"
FT                   /translation="MNYIGSKYSLLDFLQTTIEEVTGYKRGDECVFADLFAGTGVVGQT
FT                   YKERGCTVIANDIQYYSYILNKHLIENVPELDKGLLKELNTLPPVEGFIYKNYCEGSGS
FT                   GRNYFTNANGMKCDAIRIELERLHESGEINDNMYFYYLASLVNSIDKYANTASVYGAFL
FT                   KHVKKTAQREFQMDLLPVVDGPVGKVYNEDINQLVRKISGDILYLDPPYNARQYCTNYH
FT                   VLETIAKYDEPKLNGVTGLRDYADQKSKFCSKRTVAETFEDLIKNADFKYIFLSYNNEG
FT                   LMSLETIEEIMSKYGTYSFYTKDYRRFKADTEQHRNIAAHKTVEYLHCLVK"
FT   CDS             complement(698452..699069)
FT                   /transl_table=11
FT                   /locus_tag="CIY_07610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73654"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L5"
FT                   /protein_id="CBK73654.1"
FT                   /translation="MSTLQEDLKKALELIKVDWNMQSNKNDSKTNFIYRVKSLDECLNE
FT                   IEKHNVDKLYTLHRWYNYKTSVKCEYIFCNYGAIHESNRFNHDVDIYIKGIPFDVKLTV
FT                   YPSKLSDRPFDLSTQEGKNELIRWLYANQSQESRKQILNRIYVICDAPTTEEKLSMKSN
FT                   FSLMSERIASYMRHVEKHGFNEITITENNTDYNLKSDIIILD"
FT   CDS             700516..701475
FT                   /transl_table=11
FT                   /locus_tag="CIY_07630"
FT                   /product="Alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73655"
FT                   /db_xref="GOA:D4J0L6"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L6"
FT                   /protein_id="CBK73655.1"
FT                   /translation="MVNPDSDLYRAHPDWVLAAPDRRRTLGRHQMVLDYSKPEVVDNIY
FT                   HQLYDVISKANISYIKWDMNRSITECFSQGIEPEKQGMVYHKYILGVYSLYERLIKDFP
FT                   HILFESCASGGGRFDAGLLYYAPQAWTSDDTDGHERVKIQYGTSYGYPIASMGAHVSKS
FT                   PNNQTGRIMHVDDRANIACFGTFGYELDLNDVDDEEFEAVKRQIVFMKEYRGLFQYGTL
FT                   YRLQSPFEKNIASWMVVSDDKKKAVVVMYKTHKTPNIGMETIKLQGLDESMIYTINGNE
FT                   KIYGDFLMERGLGTMGADEPWYLSDKDFTSRMFILEAE"
FT   CDS             701652..701732
FT                   /transl_table=11
FT                   /locus_tag="CIY_07640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73656"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L7"
FT                   /protein_id="CBK73656.1"
FT                   /translation="MWPMIVIYVIFQKQFIEGIATSGGKL"
FT   CDS             complement(701729..702751)
FT                   /transl_table=11
FT                   /locus_tag="CIY_07650"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and an HD-GYP domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73657"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L8"
FT                   /protein_id="CBK73657.1"
FT                   /translation="MLFTNFTGLKNFVGASIYMEYVCLERLCLVVATNYTNYVLLYIFF
FT                   QFALFVIMRKNLGYLFKATSLKWKRIFTYLVGLFYILDLLYAAYLIFPELGTNVLNWQN
FT                   VLWLDSMALIACSFVSGYIKVSISESKEHDEKIEYFQQLQKSQEDIITTLAEMSEVKSG
FT                   ETGQHVRRVAEYSRILAYKLRLSPEECENIKIAAMMHDLGKLMISKDIIEKPAKLTPEE
FT                   YDIVKQHTQYGWDILSKSEGDLMKMARVIAVQHHEYWNGQGYPLGLSGNGISIYAQIVA
FT                   VADVFDALTSKRSYKRAWSNQEAYDEIIKQRGEQFSPRVVDAFIECYNQICVIRDTYLD
FT                   "
FT   CDS             703293..704972
FT                   /transl_table=11
FT                   /locus_tag="CIY_07660"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73658"
FT                   /db_xref="GOA:D4J0L9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0L9"
FT                   /protein_id="CBK73658.1"
FT                   /translation="MRPKHDKRTIDGALKYFSGFSIQMFLTSAIVMGIFLAVIFVNFYS
FT                   FYNVQFVTEKYQMEIRKDVQTINKRLLFAVASNDAAVTADQKADLEKRFPKIEGYFGVI
FT                   SKNLDNEELGSRLTTNWKAFENASFEMLAMVEAGQNQEAVEYFNSTLNATAETLADSLD
FT                   ETGELAEAAAAGKYRIISIVVLVAIAMLFIALVIIITRSKKTTKDLTTQINADLEVLEN
FT                   AASELAKGNVHVDIDFDVDNEIGRVINQLKSAIDSLAYCIDEIDEKMSTMASGNFNINF
FT                   DKDFRGDFKAIQDAIDSFSRQISDSMTEIMEVSEMVSDGANQIAGAGENLADTVTSQAN
FT                   IVDDLSVTVAEITDQISNNSTDATSISKEVEVVAENIVEGNKRMQDVVHAMDAISSSSQ
FT                   EISKIIDTINAIADQTNLLSLNASIEAARAGEAGKGFAVVATEVSQLAGQTVEAAQNTA
FT                   GLINASLKSVEEGIAIANDTAEKLNGMVSQVQGIAEKVKTIAEASNSQAVSVKEMSANI
FT                   GEISSVGQNNAATSEESLALSHEMNEHANSLKELVEKFELKR"
FT   CDS             complement(705121..705504)
FT                   /transl_table=11
FT                   /locus_tag="CIY_07670"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73659"
FT                   /db_xref="GOA:D4J0M0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M0"
FT                   /protein_id="CBK73659.1"
FT                   /translation="MQEVCEFLKKCGTYYLATVDGDQPRVRPFGTIHIFEDKLYIQTGK
FT                   SKDVSKQIQKNPKVEICGFAEGKWVRVAGELVRDDRIEAKRVCLMHTLHFRICTLQRMT
FT                   IQRYFTSRMPKLHSHHLPMRLVL"
FT   CDS             705719..705958
FT                   /transl_table=11
FT                   /locus_tag="CIY_07680"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73660"
FT                   /db_xref="GOA:D4J0M1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M1"
FT                   /protein_id="CBK73660.1"
FT                   /translation="MVEVAMFDVVKEVIIDTLSCAAEKVTMEANLFDDLGADSLDAVEL
FT                   SLAVEEKTGITIDEDAMAEIKTVADIVNYLEAHK"
FT   CDS             705961..706419
FT                   /transl_table=11
FT                   /locus_tag="CIY_07690"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73661"
FT                   /db_xref="GOA:D4J0M2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M2"
FT                   /protein_id="CBK73661.1"
FT                   /translation="MDTKEIKELLKAFDESGSSYFQIKQDGIEIKFKKPAEKQTFMVSS
FT                   DVALPNNVIEMPQPKVQTQETKQEEEQPDGELVLAPLVGVFYSAPSPEDSPYVQVGDRV
FT                   KEGQVLCLIEAMKMMSEITAPKDGLIKAIYAKNQDVVEFEEQLFLIGD"
FT   CDS             706422..707795
FT                   /transl_table=11
FT                   /locus_tag="CIY_07700"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73662"
FT                   /db_xref="GOA:D4J0M3"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M3"
FT                   /protein_id="CBK73662.1"
FT                   /translation="MFKRILVANRGEIAIRIIRACMEMNIESVAVYSTADKESLHVKLA
FT                   TKSICIGGGRAAESYLNMDAIITAAQVTGCDALHPGFGFLSENSQFVRKCKEAGITFIG
FT                   PTADAMDALGNKATARKIMMKAGVPVVPGSEGPVEDYKKLEKIAKKIGYPVLIKASAGG
FT                   GGRGMRRVFKPEDLQKLYEEAKAETRACFNDDEMYVEKLILNPRHIEFQILADEFGNVV
FT                   HLGERDCSIQRKNQKLIEESPCMFINDDLRKSMGKAAVTAAKAAGYTNAGTVEFVLDER
FT                   NHFYFIEMNTRIQVEHGVTEAVTGIDLIKWQIRIAFHEPLNIKQKDVRLKGHAIECRIN
FT                   AEDPAKGFMANTGKITFLNIPGGPGVRVDTLLYNGYETSPFYDSMMAKIIVHAETRLEA
FT                   IRRMRRALLELVTDGITTNGDFDYLLLHHPDFVKGNYNVGFIEEHIDEILAWDRAVDE"
FT   CDS             707863..708111
FT                   /transl_table=11
FT                   /locus_tag="CIY_07710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73663"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M4"
FT                   /protein_id="CBK73663.1"
FT                   /translation="MAPAIKPVEEYTIKNRIDDIADDGTFEEFSFDFPETNPLEFEGYV
FT                   EKKEELRVECGHHDGIIAGKCKIGGYPVVLAVMNKNL"
FT   CDS             708108..708569
FT                   /transl_table=11
FT                   /locus_tag="CIY_07720"
FT                   /product="Acetyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73664"
FT                   /db_xref="GOA:D4J0M5"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M5"
FT                   /protein_id="CBK73664.1"
FT                   /translation="MMASMGLELGETVCRSTEYAMKRKLPLIIFTASGGARMQEGILSL
FT                   MQMAKTSAVIEKFKNQGGLYIAVLTHPTTGGVSASFATLGDITLAEPGALVGFAGPRVI
FT                   EQTIGQTLPEGFQRAEFLEEHGFVDGVVKREDMKVTLTKILMLHQGRSI"
FT   CDS             708566..709366
FT                   /transl_table=11
FT                   /locus_tag="CIY_07730"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /function="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73665"
FT                   /db_xref="GOA:D4J0M6"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M6"
FT                   /protein_id="CBK73665.1"
FT                   /translation="MKAIDRVLAARDKDRPKITDYIDNVFTDFFEQKGDLLGKEDASIY
FT                   GGIALFQGRPVTVIGHRKGKDVNENVTCNFGMPGPEGYRKALRIMKQAEKFGRPIITFV
FT                   DTPGAYPGLEAEAFGISQAISGNLAAMSSLKVPIITIVTGEGSSGGALGIAVANRVYML
FT                   ENAVYSVLSPEGFASILWNDSNRRDEAAEVMKLTANDLLGFGVIDGIIPERGLYIRVSN
FT                   IIAGALKELDGMSGEDLAHERFEKFRSFDEEFFKNDSSARMEKV"
FT   CDS             709367..709588
FT                   /transl_table=11
FT                   /locus_tag="CIY_07740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73666"
FT                   /db_xref="GOA:D4J0M7"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M7"
FT                   /protein_id="CBK73666.1"
FT                   /translation="MTGIKILATGAKTPSKVVSNDDLAKIVETSDEWISQRTGMSERHY
FT                   VSGDENHTELAEMAARQAIERANIPKEK"
FT   CDS             710375..711310
FT                   /transl_table=11
FT                   /locus_tag="CIY_07760"
FT                   /product="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /EC_number="1.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73667"
FT                   /db_xref="GOA:D4J0M8"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M8"
FT                   /protein_id="CBK73667.1"
FT                   /translation="MKLNDLTGTKYPIIQGGMANIATGEFAAAVSNAGALGLVASGGMN
FT                   AEALREQIRICKSLTDKPFGVNLMLMNPDVDNIANMLIEEKVQFITTGAGNPGKYMEGW
FT                   KSMGAKVFPVVASVALAKMMVRAGADAIIAEGGESGGHVGDMTTMTLLPQVVAAVDVPV
FT                   IAAGGIANGKQMAAALLMGACGVQIGTCLLVSEECPIHDNYKQALIKAKDNSTTVTGRS
FT                   QGAPVRVIKNEMAREYLKLEAEGANREDLERMTLGSLRRAVVDGDTVHGSLMAGQTCGQ
FT                   LTAIRPAVEILDEMYVNAKHVLHNASSIAI"
FT   CDS             711385..712338
FT                   /transl_table=11
FT                   /locus_tag="CIY_07770"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73668"
FT                   /db_xref="GOA:D4J0M9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0M9"
FT                   /protein_id="CBK73668.1"
FT                   /translation="MKLGIVYAGQGSQRVGMGQDFYEKYQEFRDTIDNATDVVSQVTEM
FT                   NVADLSFNGPIEQLSNTRYTQPAMVAFAIGVTKLLHKKGIKADYTCGLSLGEYSALYEA
FT                   GVLDEATILELISKRGKFMEEASGDRLVKMCAVLGADRETVKEACDYANDYFCGERIVQ
FT                   AANFNCPGQIVISGDAAAVDRASVFLKEAGVKRILPLKVSGPFHTKLMKPAGDKLAAEF
FT                   EKVDFKEGNSKVIFNCIGRERTGEEKIPKLLENQVQSSVYLEDSIKYMADAGVDTIIEI
FT                   GPGKAISKFISKTVDNIKVYSIDTVEDFENTLEELA"
FT   CDS             712335..713060
FT                   /transl_table=11
FT                   /locus_tag="CIY_07780"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73669"
FT                   /db_xref="GOA:D4J0N0"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N0"
FT                   /protein_id="CBK73669.1"
FT                   /translation="MSVALVTGGSRGIGRVISEKLAREGYNIAICYSGNESAAQETIAE
FT                   CKKHGVQAMFIKADVSREEDVKNMFDEVKELMGPVDVLVNNAGITKDGLLLRMTEEDYD
FT                   SVLDTNLKGTFLCTKAAIKDMMKARKGKIVNITSIVGVNGNAGQSNYAASKAGIIGFTK
FT                   SVAREYGSKGITVNAVAPGFIQTAMTDKLPENVKADYLKQIPVGRFGNPDDVANVVEFL
FT                   ASPKSDYVTGQVIEVTGGM"
FT   CDS             713060..714292
FT                   /transl_table=11
FT                   /locus_tag="CIY_07790"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.179"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73670"
FT                   /db_xref="GOA:D4J0N1"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N1"
FT                   /protein_id="CBK73670.1"
FT                   /translation="MRRVVITGMGTVNPIGNNVEDTWEAVKAGKCGIGPITHFDTSDFK
FT                   VKLAGEVKNFDAAEVLGAKETRRMDVYTQYACAAAKEAMEDAAFDMEKEDHDRMGCIMS
FT                   SGIGGLSTIAEEHGKGETKGYSKISPYFIPMSISNMAAGQIAITYGLKGMCTSVVTACA
FT                   SSNNAIGDSFHRIRDGYEDVMVCGGAEGTVIPLGIGGFQAMKALCTSEDPNRASIPFDK
FT                   ERHGFVMGEGAGILVLEELEHAKARGAKIYGEIVGYGSNCDAYHVTAPNPEGEGGAKCM
FT                   ALAVKDAGLEMDDVDYINAHGTSTSLNDAGETLAIKKAFGDHAYKLKVSSTKSMTGHLL
FT                   GAAGAVEAILTTLALRDGFVPATINYREKDEACDLDIVPNIGRNEKINVALSNALGFGG
FT                   HNASLVFRRYA"
FT   CDS             714289..714717
FT                   /transl_table=11
FT                   /locus_tag="CIY_07800"
FT                   /product="beta-hydroxyacyl-[acyl carrier protein]
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73671"
FT                   /db_xref="GOA:D4J0N2"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N2"
FT                   /protein_id="CBK73671.1"
FT                   /translation="MKLNSSQIQEILPHRYPFLLVDRIEECEPGNYAKGIKCVTANEMH
FT                   FLGHFPGHPVMPGVLIIEALAQVGAVALLTEEENKGKLAFFGGIKNARFKKQVEPGDVL
FT                   ELECKLTSRKGPVGFGEAVAYVDGQIAAKAEISFAIGE"
FT   CDS             714728..715264
FT                   /transl_table=11
FT                   /locus_tag="CIY_07810"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73672"
FT                   /db_xref="GOA:D4J0N3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N3"
FT                   /protein_id="CBK73672.1"
FT                   /translation="MFLGMDILYGNNISRGRNNKKEQVLKMLEQTLSEVYTKFKIHFYQ
FT                   EMFKKLNSRETSLTTVELFCVEIIHALKNPTVAEFANFINVSSPNAAYKVNSLIQKGYI
FT                   EKVQSATDRREYHLHVTDKYYNYFNLSQKYVSTVVERAQEHFSAEQIEILDGILRDMSH
FT                   ELMQEVNIPPVDVVQ"
FT   CDS             715381..716922
FT                   /transl_table=11
FT                   /locus_tag="CIY_07820"
FT                   /product="Exopolyphosphatase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73673"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N4"
FT                   /protein_id="CBK73673.1"
FT                   /translation="MKLSQLLNFNNIIVQCHNTPDADAIASGMALTKYLKDNGKNVFFV
FT                   YGGNFEITKSNLKLMIADLGVDIHYVRHQVQLSHLLGLMEQELPDLLVTIDSQYEEGNI
FT                   RKFKAKNIAIIDHHQVAKPLPEMSEVRSYLASCSTLIWDMLREEGLSVQDDINLSTALY
FT                   YGLMTDSNNFTEINHPLDMDMRDDLKYSSAEITKFRNSNISQEELRIAGIALLGSEYYR
FT                   DNHYSIVKTDPCDPNILGIISDMLLEVEDVDCCLVYSIHEGGIKVSIRSCVKEVKADEL
FT                   AQFICEGVGNGGGHTIKAGGSIIRSLLEQQELDYNASSIQQFFRERMKDYFVNNEIIYA
FT                   DDYVADTSDMALYKNKEIILGYVKATDILPVGKKMIIRTLAGDVDVTVAEDTYIVVGLR
FT                   GEIYATTEKLFFQYYKITDGQYKYPADYEPTVRNHKNQDSKSLLPYVKTCLYVGNGNIY
FT                   AREIKARTKVFTRLSPDSYSLGRPGDFFIASGSDLSNVYILDREMFLSTYEKVVD"
FT   CDS             717265..717900
FT                   /transl_table=11
FT                   /locus_tag="CIY_07830"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73674"
FT                   /db_xref="GOA:D4J0N5"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N5"
FT                   /protein_id="CBK73674.1"
FT                   /translation="MDTTNFSGTNLETKTVKKVNVRNMTVTAMLSAIAFVLMFLDTAVP
FT                   IMPSFIKLDVSELPALIASFALGPVYGVVVCLIKNLLHLLITQTGGIGELSNFILGVAF
FT                   VLPAGLIYHHKKTKTSAIVGAVVGAFIMAAISFPSNLYVVYPVYYNFMPKEVIVEAYQA
FT                   IAPFANIDSIEKCLLMFNVPFTFVKGLISVVITMFIYQPLRPLLKGNN"
FT   CDS             718130..718720
FT                   /transl_table=11
FT                   /locus_tag="CIY_07840"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73675"
FT                   /db_xref="GOA:D4J0N6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N6"
FT                   /protein_id="CBK73675.1"
FT                   /translation="MELGKRIKDLRSLHNWNQDELAEKMFVSRQTISNWENEKSYPDIQ
FT                   SILLLSNLFEISLDQLVKGDVEQMQEIINDQDVKQMKFYGKMMLACIGILIVTFGPLYL
FT                   LIGMWSLIPEGILAMLELYFSKKLNIIEKENDLVTYKEIVTFMNGNSLDEKSKQQEIGK
FT                   RPYQTVLVMITAGLISGILSFTVVYICKHVIGL"
FT   CDS             718751..719098
FT                   /transl_table=11
FT                   /locus_tag="CIY_07850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73676"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N7"
FT                   /protein_id="CBK73676.1"
FT                   /translation="MLSQNFLAVMGVVAGVLVLAWAIWMIYIGVKYKANQDAETKLIIT
FT                   KAKACSANVLWFMVVVWGLVSSYIGAQTTLTVGQVQFFIMLLLGIQCVIEMFAFVYYKD
FT                   ELKKKTDALTE"
FT   CDS             719240..720256
FT                   /transl_table=11
FT                   /locus_tag="CIY_07860"
FT                   /product="Membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73677"
FT                   /db_xref="GOA:D4J0N8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N8"
FT                   /protein_id="CBK73677.1"
FT                   /translation="MPVLIFILVVILVAIAFGIRIVPQGYVYVIEFLGKYHATWQAGIH
FT                   VMIPFLQRVSKKVSLKEQVADFPPQDVITKDNVIMKIDTVVYFKVQDPKLYAYGAERPI
FT                   LALENLTATTLRNLVGELELDQTLTSRDNINSKMRVILDEATDPWGIKVGRVELKNIIP
FT                   PEEIQRSMEKQMKAERDRRETLLEAEGHKQASITRAEGDKQALVLKAEAERDAAIARAT
FT                   GQAESIRLVYEAEARGIEMLKAANMDERVLLIKKLEALEKMGDGRATKIVVPTDLASAA
FT                   ADLTFKTEMLGFGESTPIDKTAPKKAAPKKEDPCCSDDDKGATTRHFVENHGDFEGV"
FT   CDS             complement(720363..720728)
FT                   /transl_table=11
FT                   /locus_tag="CIY_07870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73678"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0N9"
FT                   /protein_id="CBK73678.1"
FT                   /translation="MADSRADLIKGLSDAMSGNKEDELGRQFFADTNTLRTGAAGGNVE
FT                   VSVLVSKAEFARIASGVVKYHVTDRRGIEDGNDIIFNEVEADGFTQTGHKLTKRVTDVK
FT                   SYLQVPGLKDGYCIVAF"
FT   CDS             720859..722655
FT                   /transl_table=11
FT                   /locus_tag="CIY_07880"
FT                   /product="oligopeptidase F. Metallo peptidase. MEROPS
FT                   family M03B"
FT                   /function="oligopeptidase F. Metallo peptidase. MEROPS
FT                   family M03B"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73679"
FT                   /db_xref="GOA:D4J0P0"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P0"
FT                   /protein_id="CBK73679.1"
FT                   /translation="MAKELVSRDQVRVEDTWDLTAMYENKSAWEADIKIIEGKLDEIAK
FT                   YQGKVCESADNLLAVLEINAIAEEKLELAFNYAERLFDQDQGNTEHQSMSQKMFGLIAK
FT                   FEAAMSFVSPEILACDTAVLDGFIASKPELELYRIEIKEIQRLKDHTLSAEMEKVVAMT
FT                   SEMGNTPSEVYSAFKNVDMTFPAIKDENGEEVTLTDGRFVPMLMSADRRVREDAFKAYY
FT                   GVYKKYLNTMAAIYNGEVKQHIFNSRVRNYSSNLEAAVDANNVSPQVYDNLVKTVNANL
FT                   DKLHAYVSLRKKCLGVDELHMYDIYTSMIPDAAKTVKYEEAQKTICEALAVLGDDYVAL
FT                   LKEGFANRWIDVYENKGKRGGAYSATAYGVHPYMLLNYTDTFDDMFTTAHEMGHSMHSY
FT                   FSNKTQPYIYSNYKIFVAEVASTCNEILLLEYLLKNCTDKKEKAYLLNHYLDSFKGTVF
FT                   RQTQFAEFEKTTNEMVEAGENLNAENLCKLYKEINEKYYGPDMISDDEIAYEWARIPHF
FT                   YYNFYVYQYATSFCAAVAIADMILKEGAPAVERYKKFLSSGCTDAPVELLKIAGVDLTT
FT                   PAPIEAALAKMGEIVEELKTLV"
FT   CDS             complement(722754..723911)
FT                   /transl_table=11
FT                   /locus_tag="CIY_07890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73680"
FT                   /db_xref="InterPro:IPR025466"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P1"
FT                   /protein_id="CBK73680.1"
FT                   /translation="MVGCYVDANKEMVLTFKETFLNLDDEEFHKYLEIANKSLSGTVGN
FT                   NLLELPFAPESEIEGSGHDLLMRLRETRLQDEKLLIEYYNRIIESYDFVGNYLILLYHD
FT                   TYDIPVKTTDDLMLDESEEVYDYIICAICPVALSKPGLGYREDENRIGARIRDWVVGPV
FT                   DTAFTFPCFSERTTDLHSCLAYTKNTKEPHVEFWENCIGCGTKKTSTQKKNAFNNILDQ
FT                   ALGEETDETIETKLDIQQNLSDFITVETERLGQDEPIILEPQDVANILTDSGLSDMKVE
FT                   KIQAKFENYFEEQLPLAEEILDEKALKNNELRVEKNVLKERVVDLTKQLKEATGVTEDG
FT                   KPADIVVKVSDAKAASVTTAYVDGKKCVCVPIEPDEVLFLNGEQI"
FT   CDS             724094..726181
FT                   /transl_table=11
FT                   /locus_tag="CIY_07900"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73681"
FT                   /db_xref="GOA:D4J0P2"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P2"
FT                   /protein_id="CBK73681.1"
FT                   /translation="MEHLLDFTKARKQEIYPLSEKFFGKNPDGREIGFTNYYMTIDGEP
FT                   FFAISGECHFSRVFENQWEDTILKMKAGGLNIVSTYVFWNHHEEIEGQFDFSGRRNLRK
FT                   FVELCAKHDMFVILRIGPFCHGECRNGGLPDWLYGKPYDVRSNSPAFLEQVRLFYREIG
FT                   RQIEGLCFKDGGPIIAAQLDNEYMHSAAPWEMTTGISNEWAEGGSDGNDYLIALKKIAI
FT                   EEGIITPFYTCTGWGGAATPTDELLPLWGGYAFWPWMFYGNKDYKHPATPEYIYRDNHN
FT                   NAVKKTYNFEPFYEPESMPYSCCEMGGGMIPFYNYRFQFPYESVDAMANVKLASGCNFL
FT                   GYYMYRGGTNPHGFKSEYLNEHQVPKLGYDYNAPIGEFGQLRPSYYRLRCIHTFVKHFG
FT                   HLLCPMTTLLAEDNEGREPEDTSYLRYAARTDGESGFLFINNYQDHAKLSDKSGESITI
FT                   KLPGKEITIKDLSIAAGEEAILPINIDLDGLRLEYATVQPLARVESPNSISYIFFKPNG
FT                   MKPVYKFEGEEPIVPVDSPSYSFSKQINGKLISIVTLSRELSFEFAEIKPPAELTNQNK
FT                   RVLTPIQCGKSRFTIVIPKLNQNANDTLLQINYSGDIGQLFDAKGKLLHDDFCCEKAWE
FT                   IGLNELGIKEGDVLTIYITPKKDDVVVDVSSTMAGRLEKAEGLHFALGEVALVETLEDK
FT                   L"
FT   CDS             726437..727837
FT                   /transl_table=11
FT                   /locus_tag="CIY_07910"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73682"
FT                   /db_xref="GOA:D4J0P3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P3"
FT                   /protein_id="CBK73682.1"
FT                   /translation="MSVKTTDVRTLSRNFKDYADKEITVAGWVRNMRDSKTFGFLVLAD
FT                   GTFFNPVQVVFNQDKIDNFDEVCHLNVGAAVYVTGIVTLTPEAKQPFEIQATKVVVEGK
FT                   STPDYPIQPKRHTMEYLRTQTHLRPRTNTFQAVFRVRSLCAYAIHKFFQERDFVYVHTP
FT                   LITGSDCEGAGEMFQVTTMDLNNIPKTDDGKVDFSQDFFGHATNLTVSGQLNGETYAQA
FT                   FKNIYTFGPTFRAENSNTTRHAAEFWMIEPEISFADLEDDMILAEDMLKYVINYVLEHA
FT                   PEEMQFFNSFVDKGLLERLQHVANSDFGRITYTDAIAELEKHNDEFDYKVSWGCDLQTE
FT                   HERYLTEKIFKKPVFVTDYPKEIKAFYMKLNEDGKTVAAMDCLVPGIGEIIGGSQREDD
FT                   YDVLLKRMQECGLKEEDYQFYLDLRKYGSSRHAGFGLGFERCVMYLTGMGNIRDVIPFP
FT                   RTVGNCDL"
FT   CDS             729269..729556
FT                   /transl_table=11
FT                   /locus_tag="CIY_07930"
FT                   /product="TrpR-related protein YerC/YecD"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73683"
FT                   /db_xref="GOA:D4J0P4"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P4"
FT                   /protein_id="CBK73683.1"
FT                   /translation="MNKKLETAEMDELLRAILSLETVEEAYEFFEDLCTVNEMVAMKQR
FT                   FEVAKMLREERTYQDIADETGASSATISRVNRALNYGNDGYDMVLKRISK"
FT   CDS             729862..730506
FT                   /transl_table=11
FT                   /locus_tag="CIY_07940"
FT                   /product="Domain of unknown function (DUF1836)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73684"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P5"
FT                   /protein_id="CBK73684.1"
FT                   /translation="MDNSSKKELNEILHQLAEIDYVHPEDIPNIDLYMDQVLTFLDQEL
FT                   GTVREVNEDKAMTKTMINNYTKNQLLPPPEKKKYSRDHMLNLIFIYYFKNFLGLKDIKS
FT                   ILDPINEKYYGDSEGLSFFDIYSDMVGFEHKVAKEVTKDIIKKYNMSREAYADQDEESK
FT                   AVLQDFTFICLLSFDVFVKKMMIEQYISNHREDEAKSSEAQGKSTKEKSKE"
FT   CDS             730590..732995
FT                   /transl_table=11
FT                   /locus_tag="CIY_07950"
FT                   /product="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73685"
FT                   /db_xref="GOA:D4J0P6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P6"
FT                   /protein_id="CBK73685.1"
FT                   /translation="MNLDFLNDRQREGVVTTEGPVLILAGAGSGKTRVLTHRVAYLIEQ
FT                   GVMPYNIMAITFTNKAAREMRERIDNIVGFGSDGVWVATFHASCVRILRRFCENLGQGY
FT                   SSNFTIYDTDDCKTLMKEVCKYLQIDTKQFKERTFLNVISDAKNKLIGPEEFTNRAMGD
FT                   FNMSRQATVYREYQARLRQNNAFDFDDLIMKTVELLRLDGDVRAYYNDKFKYIMVDEYQ
FT                   DTNAAQFELVRLLTGGAQNLCVVGDDDQSIYKFRGADIYNILNFEQHFPAAHVIKLEQN
FT                   YRSTGNILEAANAVIANNEGRKEKALWTEAEDGDKIQFQQFDSAYEEASFIASNIGALV
FT                   RKGEADYKDCAVLYRTNAQSRLIEEKMIYEGIPYKIVGGVNFYSRKEIKDVLAYLKTVD
FT                   NGSDDIAVQRIINIPKRGIGATTITKVSDFARENGLNFYEALLHCEDVPSIGKAATKIQ
FT                   GFTSLIEKLRKIAKEESVSALVEEILEQTDYVAELRAEGTDEAKARIENIDELLTKAVA
FT                   YEKDARDDGEEPTLSGFLEDVALVADIDSYEESDNYVVLMTLHGAKGLEFPRVYMAGME
FT                   DGLFPGQAAIFDGGGADSELEEERRLAYVGITRAREHLTMTAARMRMVRGETAFHKISR
FT                   FVKEIPEELVKGNLWEPKPMDDYSSTPIGEYSVYQKPSGFGKPFAASTSYGTAGSTAGS
FT                   GKGSYSASRYSVGSSTTAVANKNGTKIEKGELDYGIGDRVSHIKFKEGTVKDIIDEGRD
FT                   YEVTVEFDGVGVKKMFASFAKLKRYRKPSPFRGRGTALAVDEVLYETW"
FT   CDS             732982..734268
FT                   /transl_table=11
FT                   /locus_tag="CIY_07960"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /function="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73686"
FT                   /db_xref="GOA:D4J0P7"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P7"
FT                   /protein_id="CBK73686.1"
FT                   /translation="MKRGEIVQGKVVKVSFPNKGIIETAEGDRLRVKGVLPGQTVSVRV
FT                   KKASKEKAQGNLLSVDSPSELEMDCPACVHFGKCGGCTYQSLPYDKQLDIKEGMIHDLM
FT                   APVIGEDVWNATYEGIKSSPKQFEYRNKMEFSFGDEVKDGPLTLGMHKKGSFYDVVTVD
FT                   GCQIIDADMRRVLAITLEYFANAKQPYYRKNTHEGYLRHLLVRKAAKTGEILVDLVTST
FT                   QISSIYEIALLAGWKQALLDCPDWEGKLTGILHTKNDRAADVVADEGTEILYGQDWFKE
FT                   ELLGLSFTISPFSFFQTNSLGAEVLYSTARDFISTGADGAEVYDLYSGTGTIAQVIAPA
FT                   AKHVTGVEIIAEAVEAAKENAKLNGLDNCDFIAGDVLKVLDDITEKPDYIILDPPRDGI
FT                   HPKALDKIIDYGVDSLVYISCKPTSLAAT"
FT   CDS             734619..735380
FT                   /transl_table=11
FT                   /locus_tag="CIY_07970"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73687"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027365"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P8"
FT                   /protein_id="CBK73687.1"
FT                   /translation="MALRKIDKSKYTEYLKYARGCTANRVYPVSIATGSQDGDIYFDGK
FT                   GCVLFWHYCGFVYISGDVSEDVIEEVYRSFLVPDTERRFLLITDSKFVSDYYSGIDMLR
FT                   VDKRIEYTHSGILEKQPELDDGFVIERITSDNIRVIQGRITPSFSWKDRDVFLQDGFGF
FT                   MARSKEDGSFAAVAFSSAVSPEEVDIGVETAETYRHHGLASYLAYKMCEEIIRQGRRPV
FT                   WAHAETNTGSQKTALSVGFKPIGINTVIQKK"
FT   CDS             735465..736592
FT                   /transl_table=11
FT                   /locus_tag="CIY_07980"
FT                   /product="Acyltransferase family."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73688"
FT                   /db_xref="GOA:D4J0P9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0P9"
FT                   /protein_id="CBK73688.1"
FT                   /translation="MIKINVKIFGKGGRNMRKVYLDNIRWITVVLVVIYHVIYIFNGVT
FT                   QHGIIGPFSKHQPQDTYQYIVYPWFMLLLFVVSGMSARYELIKRTEKEFISVRTRKYLV
FT                   PSTIGLLVFGWILGYYNMLMSGAFNSMNNVPGPILFLIMAVSGSGPLWYVQMLWLFSLI
FT                   LVLIRRIEKDRFYNICGKANLLILILLVIPVYGAAQILNTPIIVVYRFGIYGLGFMIGY
FT                   FVLSHDEVMDRLGKNWLLLSILALASCIAFVILYKGQPYPEHVVLDTIMCNVYAWFGTL
FT                   GILAFMKKWGNFTNAFSKWMCRKSWGLYVFHYLMIAVSGWYLHTLCPFLAPVIVYLLVA
FT                   IAAFAGSYLLYEIMSRIPFIRWCVLGIKKERKECR"
FT   CDS             736596..737051
FT                   /transl_table=11
FT                   /locus_tag="CIY_07990"
FT                   /product="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73689"
FT                   /db_xref="GOA:D4J0Q0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q0"
FT                   /protein_id="CBK73689.1"
FT                   /translation="MMEIRVATKNDIDCLMSIRLEMLKVVNNLPEDYEFSDEVIKESRD
FT                   YFCNGDHINVIAVDDDMVIGCASMCFFRIMPTFSHPTGKRAHLMNVYTKSEYRRQGIAR
FT                   KMVESLIEKTWEKGATEISLDATALGRPLYESIGFTNSTECMVLTNQ"
FT   CDS             738226..738738
FT                   /transl_table=11
FT                   /locus_tag="CIY_08010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73690"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q1"
FT                   /protein_id="CBK73690.1"
FT                   /translation="MRKEYLFKNRVIVENKVFLLAEDVAKKFGYDSLEIFANARPELIV
FT                   EKNGLPKLVEETKYNNIILGDVELSDRIKHLEYTRVDTLRSRAETLRSFYPLKFMLAGG
FT                   TLERKAYDAGYESVEKYINDVDYPKELEEEKESMVRKADLISSMEDTKKKINDLVDYDI
FT                   LKNTILG"
FT   CDS             739208..739555
FT                   /transl_table=11
FT                   /locus_tag="CIY_08030"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73691"
FT                   /db_xref="GOA:D4J0Q2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q2"
FT                   /protein_id="CBK73691.1"
FT                   /translation="MTITERIFYLIKARGMSQNSFGKAAGIAPSTISDWKTKGHTPSAD
FT                   KIMDICRVLEVTPEVLLTGKGIDEPDVTVPKIDYKGKQLLLEYESLNEDDKKRLLVYAK
FT                   KLGELTKLEDI"
FT   CDS             739885..741174
FT                   /transl_table=11
FT                   /locus_tag="CIY_08040"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73692"
FT                   /db_xref="GOA:D4J0Q3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q3"
FT                   /protein_id="CBK73692.1"
FT                   /translation="MELVRVQDSDYRKTYELYMTFPENENGFMNSVYGYSYDQFLEWIE
FT                   QKRNWSLGKELPEGFVPDTSYVLVDEGVYVGIFNLRHCLNDFLREGAGHIGYGISPKYR
FT                   GKGYATKGLELTLTKARQMCIHEVYMSVNKDNPASLRVQTKNGAYIHHENDKKYFTRIN
FT                   QIDERASREEIISGFYSQYEEEGRLERTVHGRLEFTTTMNYIHRFADKNTKVLEIGAGT
FT                   GRYSIALAKEGMNVTAAELVDKNLEILREKSKGISNLRALQADATNLSMFEDNQFDVTL
FT                   VFGPLYHLYEKEEVNKAIDEAIRVTKTGGVIMFAFISVYAIMYSNYFYGNWSFGQLENF
FT                   TDDNKVRHFKEQLFTGYDIAEFEDLFKNKGVAHITTTGVDGLIEPIERRADFAISDEDF
FT                   KKLSDWYMAHCEKRELLGNTNHLLYICKKD"
FT   CDS             741534..742415
FT                   /transl_table=11
FT                   /locus_tag="CIY_08050"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73693"
FT                   /db_xref="GOA:D4J0Q4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q4"
FT                   /protein_id="CBK73693.1"
FT                   /translation="MAQIQVTDLTFSYDGSADDIFQDTTFCIDTDWKLGLIGRNGKGKT
FT                   TLLNLFMGRHEYRGNIKTSICFDYFPYQVSALDLKKSASDLIEKWKPQIELWQVMIQMN
FT                   ELKMDSECLYRPFETLSFGERTRVMLAVLFAEENEFLLIDEPTNHLDTEARDIVKDYLA
FT                   SKKGFILVSHDRDLLDKVCDHVLVLNRASIEVQSGNFSTWWENKERKDAFHQAENEKHL
FT                   KEIGKLKAAADRSGRWADKNENSKIGFDPVKEHDRSIATRSFIGAKTKRCRLVSNPMSS
FT                   VLIGKLAKKRDF"
FT   CDS             742346..743065
FT                   /transl_table=11
FT                   /locus_tag="CIY_08060"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73694"
FT                   /db_xref="GOA:D4J0Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q5"
FT                   /protein_id="CBK73694.1"
FT                   /translation="MQARVKSYEQRIDREISEKEGLLNDIERVNDLKIEPLEFHKEILI
FT                   NANDLSLGYEGADRALINGLRFQVKRGDRIILSGENGCGKSTILKAILQKNDYRKYDTD
FT                   SQIHISGTLDVSAGMQISYVNQDTSFLKGSLRKYCETNGLNESLFLAVLRQLDLGREQF
FT                   AKNMEDFSEGQKKKVLIAASLITPAHLYIWDEPLNFIDVFSRMQIEKLILQYKPTMLLV
FT                   EHDVRFQERVASSIIKI"
FT   CDS             743138..743587
FT                   /transl_table=11
FT                   /locus_tag="CIY_08070"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73695"
FT                   /db_xref="GOA:D4J0Q6"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q6"
FT                   /protein_id="CBK73695.1"
FT                   /translation="MKLTINQIKGAEPQVSVTYDEMTPEVERVIDLLKGNHLRLTGKSG
FT                   DETVVISAATILYIESVDDKTFAYTSDKVVQLKYSLAALTEMLNDIRFFRCSKSMILNI
FT                   DKIERLKSLPSNRIDATMKGGEHILITRTYATELRRRLQGGRGHE"
FT   CDS             743580..744050
FT                   /transl_table=11
FT                   /locus_tag="CIY_08080"
FT                   /product="Protein of unknown function (DUF3021)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73696"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q7"
FT                   /protein_id="CBK73696.1"
FT                   /translation="MNKKVSLWERYLTREIGIEFKSCLYFFAILFYYCMYRLVNHTYTA
FT                   DILHMTEMILLCYVIGYAQVYLFHNFDEAWRFGTAEILGFIVCTAVYTVASYLFGWLDH
FT                   SIGWTIGLLVYIVLLYICVIFIYDTKRKIDDKELNKNLELFQARREADEDEI"
FT   gap             744102..745657
FT                   /estimated_length=1556
FT   CDS             745695..746522
FT                   /transl_table=11
FT                   /locus_tag="CIY_08090"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73697"
FT                   /db_xref="GOA:D4J0Q8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q8"
FT                   /protein_id="CBK73697.1"
FT                   /translation="MTEKIIEIKNLTKSYGKHRGVEKVSFEVERGDIFGFLGPNGAGKS
FT                   TTIRSMLGFLDYEGEINILGKDTKAQKELILQDIGYMPSEAMFYPNMRVRDVIKFAADV
FT                   RKKDCDDEANKLCERLKVDVNKRINELSLGNRKKVSIVCAMQHKPKLFIFDEPTSGLDP
FT                   LMQNIFFELINEYVKTGTTCFLSTHVLPEVKRYCKHVAIMKEGHLISQGSVAELTNTSS
FT                   KRVVATVNGESVDYLFTGDINTLLGELSGKNVEDLNISDPSIDEIFMSFYSDK"
FT   CDS             746615..747328
FT                   /transl_table=11
FT                   /locus_tag="CIY_08100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73698"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Q9"
FT                   /protein_id="CBK73698.1"
FT                   /translation="MFCICLYSSMTEDMAALSESFSNMGAFSDAFGMSTLGIGTIAGYF
FT                   ATEVGVVHSLGSSMFAAVTATTILSKEEDGHTGEFLYSLPISRGKVVVAKICSMLIMII
FT                   VFTIITVACYIPGFVYIDAHPEWELFVIFMLSQLLMNVEIMFICTMISAFVKRNMPGTG
FT                   LGIALLLYAYDLIGRVASEMEDAITIGPFSYCNATEIFAKETIPGTAYIFGTIIIVFTV
FT                   ILTFIKYTKKDFASY"
FT   CDS             complement(747530..748087)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73699"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R0"
FT                   /protein_id="CBK73699.1"
FT                   /translation="MKKSVLSLVMAAAIVATIGMSSIEAEASIYAPDQEHEFFLLKEQE
FT                   VEDADYSILFVGNSITMHPACDYWWGYWGMAASKPEYDYVHRVVAELNNTDKTVDYDVI
FT                   SFSLWERDNTRQIAISKLDKVLVKDYDLVIVQVGDNVHHVAHYKSDYETLVGYFKDKYP
FT                   ESKMLLVGDFWSRPGHDAIKRP"
FT   CDS             748865..749479
FT                   /transl_table=11
FT                   /locus_tag="CIY_08120"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73700"
FT                   /db_xref="GOA:D4J0R1"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R1"
FT                   /protein_id="CBK73700.1"
FT                   /translation="MKLIKRFIPYYKPYIGVFILDLVCATILSVIDLAFPQLLRFLRGT
FT                   LYLEAPETILKNLGWIAILMIVMYLIRTACKYYVTYQGHMMGAKIESGMRRELFERFEA
FT                   FSFSYYDTHNTGEMMSKLVSDLFDISELAHHGPENIFISVVKIVGSFILLMRINVPMTL
FT                   CLALVVVLMGIFAVNQNQKCVEHFLIIERRLQESILPYRIL"
FT   CDS             749410..750003
FT                   /transl_table=11
FT                   /locus_tag="CIY_08130"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73701"
FT                   /db_xref="GOA:D4J0R2"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R2"
FT                   /protein_id="CBK73701.1"
FT                   /translation="MRRTFSDNRKKIAGINSSLQDTLGGIRVVKSFTGEDIEQKKFDKS
FT                   NLAFLDSKKANYKQMGTFHSGNSMFEGLMFMTVLVSGGYCIAKGQISVDDLAIYALYIN
FT                   IFINPVNVLVEFTEQLQKGMAGFERFTEVMDTMPDIVDSKDATELNNVSGVIDFENVSF
FT                   SYEEEETVLIRCWKICCYSRTFRWWKDHALCTYS"
FT   CDS             751167..751403
FT                   /transl_table=11
FT                   /locus_tag="CIY_08170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73702"
FT                   /db_xref="GOA:D4J0R3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R3"
FT                   /protein_id="CBK73702.1"
FT                   /translation="MKSNTQNAKIEAVTENTLVVGIDVGSEFHYARAFDWRGIEFSKKP
FT                   FKFSNTEPGFTEFKAWILHIQTEHDKNAVLPGM"
FT   CDS             751455..752348
FT                   /transl_table=11
FT                   /locus_tag="CIY_08180"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73703"
FT                   /db_xref="GOA:D4J0R4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R4"
FT                   /protein_id="CBK73703.1"
FT                   /translation="MKPVLVNPHHVKKSKELDDNNPTKNDRKDPKVIAGLIKDGRYSYP
FT                   YLPDGVYADLRTASNLRFQMQSELTRIQNRISRWFSIYFPEYKDVYGNPDAKSGMMILK
FT                   VAPLPEDIVTLGVEGVNRIWREAKLKAVGLKRAKTLYEAAEHSIGNREGETAARLEIRM
FT                   LLEDYESRAARLQEIMTLIETLVKQIPMAEKLMEIKGVGIKTVSGFLAEVGDISRFDNP
FT                   KQLQKLAGLAIKENSSGKHKGETTITKRGRKRLRYLLFEVAMSLVSKNTEFSQLHQYYT
FT                   TRRINPLKKMQSLMAA"
FT   CDS             752818..754557
FT                   /transl_table=11
FT                   /locus_tag="CIY_08190"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73704"
FT                   /db_xref="GOA:D4J0R5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R5"
FT                   /protein_id="CBK73704.1"
FT                   /translation="MKAMKNLNIRMKIMVPMFMLVLLLVFTFLSSISSLTQMKNADERI
FT                   SGYYAESMSLLGDISTDVEALQKLAYSHCTATDVEMKKSVEAEIETVTARLAETCSKYE
FT                   TVLKANNGDAALYEQYKQKYDTFMDTFNTVITCSSSYQYTTAQGMANVELKAQGSDVNT
FT                   MANQMREANKQEMGEAVRKNRGVYSASINISLIILLLAVILTVLCFIVCKRTVIKPLEK
FT                   THETLQHIVDEISDNRGDLTRRIEVKGTDEVGQMGKGINEFIEALQRTMKSIISNSSEL
FT                   DKIVGNVAHNVTTANEDACDISSVMEELSASMEEISATTTGVNENAANVDAHVADLASV
FT                   SEDLSGYVQEMRNRADELQRTAEENKKNTNIIMGDILSALQEAIEESKSVEKVNGLTDE
FT                   ILSISSQTNLLALNASIEAARAGEAGKGFAVVADEIRQLADSSRETASNIQNINDMVTV
FT                   AVKELIKSSDQIITYVNETILPDYDGFVSSGQKYREDAAYVDSVVHKFNKMSIDLKDLV
FT                   GGIKEAIEGITSAVDEGAEAISNAADNTSDLVRKMENIDEQMHGNNEVARQLKVETDRF
FT                   VKF"
FT   CDS             754571..755911
FT                   /transl_table=11
FT                   /locus_tag="CIY_08200"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73705"
FT                   /db_xref="GOA:D4J0R6"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R6"
FT                   /protein_id="CBK73705.1"
FT                   /translation="MKRKIISCILATGCVISLCSCGTDNAAPKTEAGIEESSQQPEQTE
FT                   QSETVSARDVYILPQHLDNPNLVIVWDMSEEEWENFKANDSNAFNLVWSTKEAFEQMYG
FT                   GTVTVYGVGWGEMINKTTEMVEKGEVCDLVQANDQNFPRYANDGIVQDVSKYVNLDDDF
FT                   WYDNVTTAFTFGGTPYAMGADANPVVISYNKTLFEQKGVKTPSEYFEEGNWNWDTFKEV
FT                   GTKMAEDTDGDGENDIYGFGWWDSFYVQVLNADGTTALVYDDEGKVYSNYASSEAKETF
FT                   EFLQDGYCKSKYIQQPGVDFVEAFKSGKLAMTCEYGFGAKSVYECDYEVGWAPLPTGPS
FT                   GEAYSSGGSIAGFAIPVTSANPEGAAAFARMAYEMQLDYNRRQRVEQNGLQEVELMNEL
FT                   SKHIYFAPIGVNNYGDAQWIVANGIVTGQPIPEFTKEADDKLREGNK"
FT   CDS             complement(755851..756318)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73706"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R7"
FT                   /protein_id="CBK73706.1"
FT                   /translation="MADYLAENNYLFQGNFSSSYLYFSNFANKDNDFGNALKTSTDEQL
FT                   NTTELADGITSFSYQGVMQQFETRIDVNGDEEVDWRNMTDEEWKKLLERIDADIDDMVE
FT                   RVKEETEEAKEEQVKEALEKEAVFSQPLFMLSYLFPSLNLSSASFVNSGIG"
FT   CDS             757438..758295
FT                   /transl_table=11
FT                   /locus_tag="CIY_08230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73707"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R8"
FT                   /protein_id="CBK73707.1"
FT                   /translation="MRRLINSMVIFTFVMIAGLAMSTVEARAEEGGNAVHIESGLTEEE
FT                   RLSAQDAYLAELAAQDEAMYGPSSNSSSSETQSTSKTNNSSSTSQKASSAPKYTEAEIE
FT                   AAWSETGRTDATCSKDGVITYKNLLTGKTKTEVIPATGEHSYELSEHVDSTCINNGYDT
FT                   YTCTVCGDSYKDEIATTGHTEGEPQITKYASSFSTGESKTYCTTCGELVSTNTIPQTFP
FT                   LPLSIVGAFGAGAVVFLIGLLSLLGKKNKGETKHNIEFKNRSEDIQIYFFEKIHRMCSA
FT                   FSSP"
FT   CDS             complement(758663..758995)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08240"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73708"
FT                   /db_xref="GOA:D4J0R9"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0R9"
FT                   /protein_id="CBK73708.1"
FT                   /translation="MDKIIGTIVKGHIDRPLGSAHPDYPDMIYPINYGYVDDVFAADGE
FT                   EQDVYVFGTNEPLETFEGKVIAVYHRTNDNEDKWIVSLDGTDYSDEDILSAIEFQEQYF
FT                   EGELLR"
FT   tRNA            complement(760132..760216)
FT                   /locus_tag="CIY_T_35320"
FT   CDS             complement(760928..761830)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73709"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S0"
FT                   /protein_id="CBK73709.1"
FT                   /translation="MDEIANYGLSNHVVGKDAHIDYGKVYTGLGPFEDFVEVDATQRFN
FT                   YRNVYHNQWEDVHPPLYYCIFHTVCSFFPNSFSVWYGIGLNIFWMWCIVFVLYRLLMLM
FT                   TQNTYLSMGILLAFCTTPLFINLILFIRMYAQLTFVALALAYLIKIYWDKQLDKKFYFF
FT                   FSVLLLSGMLTQYYYMFFAFSLCFLFALHLHFEKRTKEIVTSLIVSGVDALIYLVVWRH
FT                   AIKHVFFGYRGEEAMASAFSLSTIKNVLLMIVSLNIYLFCGLYFIISIVLIVVFVKKLR
FT                   AKSIVFLMNMHWFIQPFSI"
FT   CDS             762064..763131
FT                   /transl_table=11
FT                   /locus_tag="CIY_08290"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73710"
FT                   /db_xref="GOA:D4J0S1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S1"
FT                   /protein_id="CBK73710.1"
FT                   /translation="MIKAKNELIIKDIKKAINSGKYEPGQKIPSENQLAKEYAVTRQTV
FT                   RKALGKLIDEGYLYAKHGSGTYVSKRLQKRGKSKNIAVVSTYMSDYIFPRVIQGINQVL
FT                   SENGYSILLKTTNNSRKGEAWCMEELLSKNIDGMIIEPSQSAISCQHQVLYDQMDAMGI
FT                   PYVFIQGCYESMMDRPHVMLDDVEGGRLITEHLIKLGHKHIAGIFKADDTQGILRHKGY
FT                   VKALQEAKIAYDPDLVIWYHTKDRTMKPMEGVLGLIEKGISFQAVVCYNDEIAADVIKG
FT                   LTNIGRSVPHDISVTGFDNSLLSQSRGITTISHPQQEFGHKAAQTLIGLIEGSISRKDA
FT                   HILLTPELVERKSTL"
FT   CDS             763369..764868
FT                   /transl_table=11
FT                   /locus_tag="CIY_08300"
FT                   /product="L-arabinose isomerase"
FT                   /function="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73711"
FT                   /db_xref="GOA:D4J0S2"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S2"
FT                   /protein_id="CBK73711.1"
FT                   /translation="MKTQLNYKFWFCTGSQDLYGDECLAHVAAHSKEIVECLNKSGVLP
FT                   FEVVWKPTMITNEVIRRTFNEANNDETCAGVITWMHTFSPAKSWILGHQELRKPLCHLH
FT                   TQYNREIPYETMDMDFMNENQAAHGDREYAHILSRMGIERKTIVGYWQDKEVQEKLASW
FT                   MRTAIGIVESSHIRVMRIADNMRNVAVTEGDKVEAQLKFGWEVDAYPVNEIAEAVAAVS
FT                   QSDINALVDEYYGKYDICLEGRNPEEFRRHVAVQAQIELGFERFLEEKNYQAIVTHFGD
FT                   LGALQQLPGLAIQRLMEKGYGFGAEGDWKVAAMIRLMKIMTTGMKDAKGTSMLEDYTYN
FT                   LVKGKEGIIQAHMLEICPTISDGPIQIKCQPLSMGDREDPARLVFQSKEGRGIATSLID
FT                   LGNRFRLIIQDVDCKKVEKPLPKLPTAINFWTPQPDFYTGTEAWLLAGGAHHTAFTYDL
FT                   TAEQMGDWAAAMGIEAVYIDADTKIRDFKRDLALGSLVYGK"
FT   CDS             765001..765657
FT                   /transl_table=11
FT                   /locus_tag="CIY_08310"
FT                   /product="transaldolase, putative, TalC family"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73712"
FT                   /db_xref="GOA:D4J0S3"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S3"
FT                   /protein_id="CBK73712.1"
FT                   /translation="MKLFVDTGKIEDIKKANDLGVICGVTTNPSLIAKEGGRSQEEILK
FT                   EIASIVDGPISGEVKATTVDAEGMIKEGREIAAMHPNMVVKIPMTAEGLKAVKVLSSEG
FT                   IKTNVTLIFSANQAILAANAGATYVSPFLGRLDDINMAGIDLIRDIAEIFDIYGYETEI
FT                   IAASVRNPIHVTDCALAGAHIATVPYSVIETMINHPLTTAGIEKFQKDYIAVFGE"
FT   CDS             765685..765906
FT                   /transl_table=11
FT                   /locus_tag="CIY_08320"
FT                   /product="Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73713"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S4"
FT                   /protein_id="CBK73713.1"
FT                   /translation="MNINEIIAEGKRTALGIEFGSTRIKAVLVDEDNKVLAQGDHEWEN
FT                   HLDNGIWTYPLEEVWAGVQDCYAKLKKM"
FT   CDS             765963..767279
FT                   /transl_table=11
FT                   /locus_tag="CIY_08330"
FT                   /product="Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73714"
FT                   /db_xref="GOA:D4J0S5"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S5"
FT                   /protein_id="CBK73714.1"
FT                   /translation="MHGYLAFDKDDNLLVPFRTWRNTITGEAAAELSKELNFNMPQRWS
FT                   ISHYYQCILNKEPHVPNVAYFMTLAVYVHYKMTGKKVAGVGEASGMFPIDSKTCQYDKA
FT                   MLEKFNKLAAAHGVNTKVEDLLPQVLVAGDDAGTLTEEGAKLLDPSGDLQPGCPLAPPE
FT                   GDAGTGMVATNAVSVGTGNVSAGTSVFSMVVLEKALSKPYEEIDMVTTPTGEAVAMVHC
FT                   NNCTSDLNSWIGIFKEFADAFGVDISMNDIYGTLYRKALTEDANCGGVLSYNYFGGEPV
FT                   VGVNEGRPMVVRQPDAKFTLANFMRSNLYGALGVLKIGNDILLKQEKVNIKSITGHGGF
FT                   FKTKGVGQSVLAAALNAPITVMATAGEGGAWGMAVLANYCIRDDKSQKLQSYLDEKVFA
FT                   GQESTTMEPDPEMVKGYDEWIAEYRKGLKAEAAAVDNWR"
FT   CDS             767284..767979
FT                   /transl_table=11
FT                   /locus_tag="CIY_08340"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /function="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73715"
FT                   /db_xref="GOA:D4J0S6"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S6"
FT                   /protein_id="CBK73715.1"
FT                   /translation="MLEELKKQVYEANMELPKRGLVTYTWGNVSGIDRASGIFAIKPSG
FT                   VEYEDLKPEDMVLVNLDGEVVEGKYRPSSDTATHCELYKKYENIGGVVHTHSTYAVAWA
FT                   QAGRDIPLYGTTHADYFCGTIPCTRNLTEKEIDEAYEVNTGKVIIETFEDRGINTKYVP
FT                   GVICKNHGPFTWGKDADQAVYNAVVLEEVAKMALFTEQVNPQVQPAPDCIRDKHFNRKH
FT                   GANAYYGQN"
FT   CDS             complement(768899..770053)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08360"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73716"
FT                   /db_xref="GOA:D4J0S7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S7"
FT                   /protein_id="CBK73716.1"
FT                   /translation="MRNLISIKKIISKFIVSFFIISLLMAFMPENKMCARAASYTITEG
FT                   NGSLLSCNGTEVFSDADPATFVTTLPVNTPVLVTGKTDNGYWRIDIKGVPYFVSQKALS
FT                   MQANTTAYKITSLDARAALVMNATTGKALYSQGATDILEPASTTKIMTALLTIEAIEAG
FT                   QISLETPVIVSPTAIAGMPLDASHVSPRIQAGEVFNIDQLLTAMMVSSDCHSCNVLAEV
FT                   VAGSVPDFVSMMNVKAAALGCTNTNFTNPSGYPDKNMYTNAYSLYLITANAIKHPLFNK
FT                   YFNVSNAVLPATNLCATPRVLENTDAIINPTSGYYNPYVIGGKTGTANRAGQCLVCVAK
FT                   QNEKTVISVVLGAKNRKMFDGNTISMRYYETNRLIDMGFTNYYL"
FT   CDS             770251..770793
FT                   /transl_table=11
FT                   /locus_tag="CIY_08370"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73717"
FT                   /db_xref="GOA:D4J0S8"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S8"
FT                   /protein_id="CBK73717.1"
FT                   /translation="MGFYDLSVEKTNGEMLSMKEFEGKVVMVVNTATGCGFTPHYKDIE
FT                   RIYETYHDKGFEVVDVPCNQFAGQTPGNDEEIHEFCQLNYNTQFPQMKKTDVNGENATE
FT                   LFKYLKSQKGFEGFGKGPAALAMGVMLKKIDKDYKNNPEIKWNFTKFIIDRQGNVVARF
FT                   EPTADMKKVEECVASLI"
FT   CDS             770863..772971
FT                   /transl_table=11
FT                   /locus_tag="CIY_08380"
FT                   /product="Glycogen debranching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73718"
FT                   /db_xref="GOA:D4J0S9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024742"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0S9"
FT                   /protein_id="CBK73718.1"
FT                   /translation="MKFEYIFDKLNNYKSNLSREWLLTNGLGGYAGSTVIGAHMRTHQG
FT                   YLIASLHPPVDRYLVFSKTNERLVCGSRIYDLTTAQHKGPYTSEFNQGNMHLKLFKYDG
FT                   AITYIYEAGGMRLTKTISLVYGKNQCVIAYTLENNGPAAGVVITPLMNFREHGEHMTVD
FT                   DLRWELPEEVFQEIRDEASGNVGFSYKPVGHSNVRISLVSAGCEMVKRNNIYDENMELQ
FT                   FELDNEADGLDCHLKPYDFVMEVDAGGVSKASFVCTVDVRESVGRKKGAFDAIPVIEKD
FT                   TAFIQVEKAKQRVADLIEKADFDEEDELAQLLTVAADQFIVSRRSTGEKTVMAGYPWFT
FT                   DWGRDTMIAFTGLCLETGRFDDAKSILISFSKYIKNGLVPNMFPDNGKEPLYNTADASL
FT                   WYFYAVYNYLKYVNTDEAWKFVEDEIFPGLQEIMGAYRKGTLFSIGMDDDALMRAGSGL
FT                   DQVTWMDVRIGDEVVTPRHGKPVEINALWYNALMTMEEISRGIARRTHNKPENYLAYAG
FT                   GCSQLAMWVKEAFNEEFWYEEGGYLYDVVGDDFKDASLRPNQIFAVSLPFTMLDPAKEK
FT                   SVVRVLKDRLYVGVGLRSLDVDDPQYVGVYQGALEKRDHAYHQGTAWGFLLGAFIESYL
FT                   KVGGGSPQSIEEAKAFFEPVEKHLLQNCIGSISEIFDGNEPHYGRGCYAQAWSVGEVLR
FT                   AYALLKSK"
FT   CDS             773063..773329
FT                   /transl_table=11
FT                   /locus_tag="CIY_08390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73719"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T0"
FT                   /protein_id="CBK73719.1"
FT                   /translation="MLPEQTIEFRYDTQLLIEGEDLDEDAINDYITENFKGDCLLAVGD
FT                   EELIKIHYHTNEPWKVLEYCRSLGEIYDIVVEDMDRQARGLQG"
FT   CDS             773532..774716
FT                   /transl_table=11
FT                   /locus_tag="CIY_08400"
FT                   /product="Cytosine deaminase and related metal-dependent
FT                   hydrolases"
FT                   /EC_number="3.5.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73720"
FT                   /db_xref="GOA:D4J0T1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T1"
FT                   /protein_id="CBK73720.1"
FT                   /translation="MGAFPSLPEEYKDLKLYDYGERLIIPGMTDLHVHAPQYTFRGIGM
FT                   DEELLEWLSTYTFPEEAKYADMEYAKKAYSYFSEDLRRCFSTRAVVFGTLHNDATIELM
FT                   DQLDETGVITYVGKVNMDRNGGVDLQEADADASLAATKEWLEKIKGRYTNTFPILTPRF
FT                   IPSCSDELMKGLGELSKETGLRIQSHLSENKSEIAWVKELVPSSTSYANAYELFDTMGT
FT                   PECPTIMAHCVHSDDEEMNILKKHGAYIAHCADSNMNLTSGIAPIRKFLDAGVNIGLGT
FT                   DVAAGSSMNMVKTMLITLQASKMYYRLVDQNVKPLTFEEVFYLATEGGGSYFGKVGSFK
FT                   PGYDFDAVVVDDSKMYSMRDMSIRERIERMCYNDADAIIKDKYVKGRKVYTRTE"
FT   CDS             775640..775861
FT                   /transl_table=11
FT                   /locus_tag="CIY_08420"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /function="ATP synthase F0 subcomplex C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73721"
FT                   /db_xref="GOA:D4J0T2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T2"
FT                   /protein_id="CBK73721.1"
FT                   /translation="MNTLIAVGAGIAVVTGLGAGIGIGIATGKACEGIARQPEAESKIQ
FT                   KNLILGCALAEATAIYGFVIALMIMFVL"
FT   CDS             778395..779405
FT                   /transl_table=11
FT                   /locus_tag="CIY_08450"
FT                   /product="ATP synthase, F1 gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73722"
FT                   /db_xref="GOA:D4J0T3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR023633"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T3"
FT                   /protein_id="CBK73722.1"
FT                   /translation="MASTKEIQNRINSIQDTMKITNAMYMMSSMKLRKAKQKLADTEPF
FT                   FEAVQRGIAENLVRFPDMRHIYFDNRVEDEQEEIKHRGFVVFTGDKGMAGAYNHNAIKM
FT                   TLDRIANLNKDEYMLFVVGEVGRAFFINNGYNVDENFRFSSNNPSMHRARVISEYMIEK
FT                   YNQGELDRIDVIYTKMLNSVTEETCVERLLPLKTHKFIKEQAKEIQEDVDGTGKAASEL
FT                   KSGVKHVHSINSYELEAVTKGGDSWYPFYPSLSVVLEHLVHNNFTGFIYGALVECSASE
FT                   ENARMMAMQSATDNAEAILRELSIEYNRVRQAAITQEITEVIGGAKALKKKKAKR"
FT   CDS             779409..780809
FT                   /transl_table=11
FT                   /locus_tag="CIY_08460"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /function="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73723"
FT                   /db_xref="GOA:D4J0T4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T4"
FT                   /protein_id="CBK73723.1"
FT                   /translation="MSELKGRIVQVSGPVVDVEFTENDLPAIRDALYVKVGEEKRVMEV
FT                   SQHIGLGVVRCIMLAPSEGLCRDMEVIATGESISVPVGEKTLGRLFNVLGDTLDGGENL
FT                   DSAEHWSIHREPPTFEEQSPVVEMLETGIKVIDLLAPYAKGGKVGLFGGAGVGKTVLIQ
FT                   ELIHNIATESGGYSIFTGVGERSREGNDLWTEMAESGVLDKTALVFGQMNEPPGARMRV
FT                   AETGLTMAEYFRDVKNQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLANDLGE
FT                   LQERIASTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRKIVEQGIYPAVDP
FT                   LESTSRILEPDVVGEEHYNTARGVQEILQKYKELQDIIAILGMEELSDEDKLTVYRARK
FT                   VQRFLSQPFSVAENFTGVKGQFVSVHDTVNGFKAILNGEMDEYPEAAFFNVGTLEDVKR
FT                   KAAALAKE"
FT   CDS             780813..781238
FT                   /transl_table=11
FT                   /locus_tag="CIY_08470"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /function="ATP synthase F1 subcomplex epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73724"
FT                   /db_xref="GOA:D4J0T5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T5"
FT                   /protein_id="CBK73724.1"
FT                   /translation="MASLFDLKIVACDGVFYDGKCEILVFPGADGEMAIMNHHEVFTGI
FT                   VEIGNIRFKTEDGEMRNAIISDGLVSVYPDGSVKVVAYSCERPEDIDTFRAQEALERAQ
FT                   EQLQQTQSRIEYQISTNNMARAMARLKGAGAKNLYKI"
FT   CDS             781351..782295
FT                   /transl_table=11
FT                   /locus_tag="CIY_08480"
FT                   /product="Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73725"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T6"
FT                   /protein_id="CBK73725.1"
FT                   /translation="MVTQQEYTFNSADGHSVIHCRKWIPEGEPVAVLQLVHGMLEYIER
FT                   YNEFATFLAEKGFVVVGHDHIGHGHSVASDDELGVMTGVHPSDDMVEDIYTHYSLTRKA
FT                   YPSLKYFILGHSMGSYMVRKFLSVKSAYIEAMSGAIIMGTGQESAATCNGGLAVIKLLS
FT                   LFKGKNFRSALVRDMSYSAPYKQFDCYGQDYANSWLTKNVEEVERYFHDKYCTFMFTVN
FT                   AYKGLVEAVKYDGTAECVSKMRQSMPIFVVSGDSDPVGNLGQGPKAVAESFKNAGIKDV
FT                   TLKLYTGDRHEILHEIDKEQVFTDLYHWLETHR"
FT   CDS             782312..783355
FT                   /transl_table=11
FT                   /locus_tag="CIY_08490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73726"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T7"
FT                   /protein_id="CBK73726.1"
FT                   /translation="MDSLEHLITRSIKSYYKNRLYAPIIFLVILLVLAVIFPVGHMLFP
FT                   KTYSEENVSLYQLYNRKESFAKFSLNNLYFTGYTSKWLDRNRGYYYYTMVNSECVIVLL
FT                   DPITCDQGTPVIDSLTVKGQIIYDSEAARSLLSNLARDLNWSEEGILSTVSSYTISEPD
FT                   ATGLVSTAFELFYVVFGIYSILCVVICGLFIAFPVLSVPVQKTRAYGKPAEILAEAEEE
FT                   LATLPQLATEDMFITEHYFIETSSYGVAIVPIDAIIWIYKYSTMHKFLWHHFSITYTLH
FT                   ITAGKRHYIKCPKNIKSDIDGIMDYLSEANHDILVGFSEENRLKVEEIQDDFEIIKKIT
FT                   SFLSKRV"
FT   CDS             783359..784102
FT                   /transl_table=11
FT                   /locus_tag="CIY_08500"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73727"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T8"
FT                   /protein_id="CBK73727.1"
FT                   /translation="MEAYTGFASVYDRYMDNVPYDTWAENIKTLFQKYNMPMEIVCDLG
FT                   CGTGQITRRLKAAGYDMIGIDVSYDMLMEAMANEDSDGILYLCQDMRQFELYGTVGAVV
FT                   SLCDSINYLRDTDELLTVCKLANNYLDPKGLFIFDIKTEHFYQQLGSSTIAENREEGSF
FT                   IWENDYDPDSRDNAYYLTIYEENEEGTFDRYEEEHLQHAFTVDEIKAAIKDSGLELLDI
FT                   IDVATMSAPAEDSDRLYFIAREVTK"
FT   CDS             784099..784968
FT                   /transl_table=11
FT                   /locus_tag="CIY_08510"
FT                   /product="Disulfide bond chaperones of the HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73728"
FT                   /db_xref="GOA:D4J0T9"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0T9"
FT                   /protein_id="CBK73728.1"
FT                   /translation="MSDYIVRATAANDAIRAFAITSKDIVEEARVRHNTSPIVTAALGR
FT                   MLSAGSMMGVMLKGEDDLVTLQIQGSGPLKGITVTANSKGEVKGFPNVSVVDLPPKNGK
FT                   LDVGGAIDLGIMRVIKDMGLKEPYVGTVELQTGEIAEDLTYYYAVSEQIPSSVGLGVLM
FT                   NKDNTVNCAGGFIIQLMPFTSEEVIAQLEENLKTLPSVTDMLSSGKTPEQMLETVLAGL
FT                   DVDFKETYPAAYKCDCSRERVIKSLASLGKEDMDDIIADGKPVEVKCQFCNEAYEFTID
FT                   EIKSFRKN"
FT   CDS             784940..785107
FT                   /transl_table=11
FT                   /locus_tag="CIY_08520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73729"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U0"
FT                   /protein_id="CBK73729.1"
FT                   /translation="MKLKALGKINDNRLFTGETLVDFTFKNPVNYHTEQFYIFLEDYCN
FT                   ECGKEESKST"
FT   CDS             787935..788393
FT                   /transl_table=11
FT                   /locus_tag="CIY_08560"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73730"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U1"
FT                   /protein_id="CBK73730.1"
FT                   /translation="MVPLVELRGAIPWAYGYKAADPTFNLLAAYIIIAIGNMIPMPIIY
FT                   FFARKVLEWGKDKPVIGGFFTFCLEKGEKGGKKLQEKAGKGLFVALLLFVGIPVPGTGA
FT                   WTGTLAASILDMDFKSTILAVIGGIALAGCIIGLVCTLGLGAYIGVTA"
FT   CDS             788395..788571
FT                   /transl_table=11
FT                   /locus_tag="CIY_08570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73731"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U2"
FT                   /protein_id="CBK73731.1"
FT                   /translation="MDTANMLINVAAILAGLVLYIFVTNTKWGKDHEQYQYMIMLGTIL
FT                   VAVIVGGLLRWLM"
FT   CDS             788559..788738
FT                   /transl_table=11
FT                   /locus_tag="CIY_08580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73732"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U3"
FT                   /protein_id="CBK73732.1"
FT                   /translation="MANVACEYCNNFVWDEEDEQYYCEIDMDEDDYVRLVSGHYKECPY
FT                   FVDGDEYKVVRHQN"
FT   CDS             complement(790426..790881)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08600"
FT                   /product="Aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73733"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U4"
FT                   /protein_id="CBK73733.1"
FT                   /translation="MLNISGIHQGFVLDHIKAGESMTIYNDLHLANLGCDCTVAMIMNA
FT                   KSNKMGRKDIIKIECPIERVDLDILGFIDHNITCNIIKDDAIVEKRKLTLPKEIKNVIS
FT                   CKNPRCISTVEQELDQVFILTDEENEVYRCKYCEEKYTGKNKKWAGF"
FT   CDS             complement(790895..791038)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08610"
FT                   /product="Aspartate carbamoyltransferase, catalytic chain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73734"
FT                   /db_xref="GOA:D4J0U5"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U5"
FT                   /protein_id="CBK73734.1"
FT                   /translation="MMVLHPLPRVNEISVDVDDDPRAMYFTQAKYGVFIRMALILTLLE
FT                   LV"
FT   CDS             complement(791035..791796)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08620"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73735"
FT                   /db_xref="GOA:D4J0U6"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U6"
FT                   /protein_id="CBK73735.1"
FT                   /translation="MSPLDFTREELEQLMDLADDIKAHPDSYSEKCHGKKLATCFYEPS
FT                   TRTRLSFEAAMLNLGGSVLGFSSADSSSAAKGESVSDTIRVISSYADICAMRHPKEGAP
FT                   LVASQRSLIPVINAGDGGHQHPTQTLTDLFTIRSLRGEIKDLTIGLCGDLKFGRTVHSL
FT                   INALVRYPGIKFVLISPEELKVPEYIREDVLEKNGYEYKEVDSLDDVMGELDILYMTRV
FT                   QRERFFNEEDYIRLKDFFILTPEKMRLAKKI"
FT   CDS             791903..792352
FT                   /transl_table=11
FT                   /locus_tag="CIY_08630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73736"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U7"
FT                   /protein_id="CBK73736.1"
FT                   /translation="MKYADVIIDISHERLDKTFEYIVPDDLEEQVVEGVQVVIPFGQGN
FT                   RAITGYVVGLHDKPGFDVTKLKPIARVVKDSIAIESQLISLAAFLKRNYGSTMNQALKT
FT                   VIPIKKKESEKLKKKSLWLFQLSRQKSSLMSFLLTNVTPLEKSVC"
FT   CDS             792636..794132
FT                   /transl_table=11
FT                   /locus_tag="CIY_08650"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73737"
FT                   /db_xref="GOA:D4J0U8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U8"
FT                   /protein_id="CBK73737.1"
FT                   /translation="MDVMEHVINMGQQVIVLIPEIALTYQTVMRFYTRFGDKVSILNSR
FT                   MSPGERFDQFERAKSGEISIMVGPRSALFTPFANLGLIIIDEEHEPSYKSEVIPRYHAR
FT                   ETAVYRAKLSGATVILGSATPSLEAYTRATEGEYQLITLHNRAMGHDMASCEIVDLRTE
FT                   LQEGNRSMLSRRLKELMADRLAKKQQIMLFLNRRGLMGFVSCRACGHVLKCPHCDVALH
FT                   LHSGGIMKCHYCGFTTKTTKTCPSCGSKYIGSFKAGTQRLEEIVKESFPQARVLRMDAD
FT                   TTSGKNGHEEILSAFAAHEADVLIGTQMIVKGHDFANVTLVGIIAADISLNESDFHSGE
FT                   RTFQLLTQAVGRAGRGVEPGIAVIQTYQPENYAVVSSANQDYDSFYAQEIAYRRLLSYP
FT                   PCGHILGIQVSCDKQKDAIAQADILAALIRRMDPEIVIMGPEDAYIGKLKDVYRRVIYL
FT                   RADDYDRLVNIKDAIDKFLLEQKQYRNTSTWFDFDPINTL"
FT   CDS             794157..794651
FT                   /transl_table=11
FT                   /locus_tag="CIY_08660"
FT                   /product="peptide deformylase"
FT                   /function="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73738"
FT                   /db_xref="GOA:D4J0U9"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0U9"
FT                   /protein_id="CBK73738.1"
FT                   /translation="MAVLEIREYGKDDVLLKTCKPVKELTPKLRTLIDDMYDTMYDADG
FT                   VGLAAPQVGVLRRICVIDIGEGPVTLINPVVLETSGEQTGNEGCLSVPGKTGIVTRPNY
FT                   AKVKALNEDMEEFIVEGEELMARALLHEIDHLDGHIYTEKVEGELYNVEDLVEEIEDEE
FT                   E"
FT   CDS             794652..795587
FT                   /transl_table=11
FT                   /locus_tag="CIY_08670"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73739"
FT                   /db_xref="GOA:D4J0V0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V0"
FT                   /protein_id="CBK73739.1"
FT                   /translation="MKVVFMGTPDFAVETLKAIYEAGHEVILVVSQPDKPKGRSGKLAP
FT                   TPVKEFAVEHDIPVYQPVKIRAEESVEYLRKYEADVFVVAAFGQILPKVILDMPRIGCV
FT                   NVHGSLLPKYRGAAPIQWAVINGEKVSGNTTMLMGPGLDDGDMLLKSEVVLSEDETGGS
FT                   LFDKLAIDGGKLAVKTIEALERGEITPIPQDESQATHVGMIKKEMGLVDWTKPAAEIER
FT                   LIRGLNPWPSAFTFIDGKQLKLWKGTVVEKSGEPGTIIDVDKNGFTVACGKGSLVINEL
FT                   QLEGKKRMAAGDFLRGYSIETGKRFVNGRD"
FT   CDS             795574..796845
FT                   /transl_table=11
FT                   /locus_tag="CIY_08680"
FT                   /product="ribosomal RNA small subunit methyltransferase
FT                   RsmB"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73740"
FT                   /db_xref="GOA:D4J0V1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V1"
FT                   /protein_id="CBK73740.1"
FT                   /translation="MAGINLREIAMETVIEILENGQFSHIYLKAVLDKYGYLEKNERAF
FT                   LNRLVNGTVERKLQLDYIIDSFSKTKVKKMKPLIRTVMRLGVYEIYYMDAVPDSATCNE
FT                   YVKLAKKRGFAGLSGFVNGVLRNISREKGKLEFKDLSVKYSMPQWIVDKWSADYGVEKT
FT                   EEILAGFLSSEDLCIRVNLGKISREDLSERLKKQGISVRICDTVVSACYISDYDSLASI
FT                   PEFNEGLFYVQDYSSQLVPYAAKISRSQNILDVCAAPGGKALHCGELAYKGQVVARDLT
FT                   EQKVSLIQENINRTGALNVTAQQWDATVLDEDSIRKYDTVIADLPCSGLGIIRKKPDIK
FT                   YNQTEESLSELTQLQKKILDTVCQYVKDGGVLSYSTCTINKSENENQIEDFLSSHKEFK
FT                   VESMTQLFPNEEHDGFFICVMKKN"
FT   CDS             796824..797909
FT                   /transl_table=11
FT                   /locus_tag="CIY_08690"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /function="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73741"
FT                   /db_xref="GOA:D4J0V2"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V2"
FT                   /protein_id="CBK73741.1"
FT                   /translation="MCNEKELTDIRSLNLTELTDFVTTDLGEPKFRAKQLYEWMHQHLA
FT                   LDYDEMKNIPKSLKEKLVANCNYHPLKKVDLQISKIDGTRKYLFELYDGQMVESVWMSY
FT                   KHGNSVCISSQVGCKMGCRFCASTLDGWVRNLTPSEMLGQIYAIQRDTGERVSNLVVMG
FT                   TGEPMDNYDNIVKFVRLLSDENGLNISQRNITVSTCGIVPRIKQLAEEDLTITLAISLH
FT                   APNQQKRAELMPVANKYEIHELIDACEYYFNKTGRRITFEYSLVGGVNDRDEDAAELGQ
FT                   LIGHLNCHVNLIPVNPIKERDFVSPSMDRAYAFQKRLKNMLIMLLLEGKWAEILTVPVD
FT                   NLESVKWTLRKGLINDKLWNY"
FT   CDS             797887..798606
FT                   /transl_table=11
FT                   /locus_tag="CIY_08700"
FT                   /product="Serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73742"
FT                   /db_xref="GOA:D4J0V3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V3"
FT                   /protein_id="CBK73742.1"
FT                   /translation="MISYGITDVGIKRKVNQDTVYASDSGVGNLPNLYIVADGMGGELA
FT                   GDYASAKCVEIVIDGITSSKETEPVKILEKAIQSANQIIFNESKNDPDKAGMGTTLVLA
FT                   TVSDGHLYVANVGDSRLYVATGTKLLQITKDHSVVAELVRTGELDEDDARTDKRKNMIT
FT                   RAIGAEGKITPDYFDVILKGKEKILLCSDGLTNMVEDKDIYSVITSSEPLESRAKKLIQ
FT                   LANGNGGKDNISAIVIE"
FT   CDS             798630..800495
FT                   /transl_table=11
FT                   /locus_tag="CIY_08710"
FT                   /product="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73743"
FT                   /db_xref="GOA:D4J0V4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V4"
FT                   /protein_id="CBK73743.1"
FT                   /translation="MITQGMFIADRYEIIDKVGSGGMSDVYRAKDHILGREVAIKILKQ
FT                   EFSEDATFVAKFRTEAQSAAGLEHPNIVNIYDVGSENGMYFIVMEYVEGITLKTYIEKK
FT                   GQLNFKEAISIAIQVGRGIEAAHQKGIIHRDIKPQNIIISTEGKVKVTDFGIARAASSN
FT                   TIHADVMGSVHYSSPEQARNGFVDGKSDIYSLGIVMYEMVTGRVPFDGDNTVAIAIQHL
FT                   QEEMVAPSAYAPDLPISLEKIILKATMKKADRRYATISDLLMDLKKALVSPNDDFVTIV
FT                   EPDLGHTRVMHKVTPEQEENLTKRAAEVLIEDDYDDEYYDDEYYDDEYYDDDYDDEDEE
FT                   EDSKMDKVLTIAGVVAAFAIVAIVVAILGNISGLFSFGSKKVTMINVVGTQYEEALQQL
FT                   EELGLTEKNVVVSYEDGDEVEDGIVTQQSVPADKEFSLNDTLRLTVEGSDGSGSSDKSE
FT                   SKESKSEKSGSEGTVSVPSVVGLSQAEATQTLSNAQIVVTSTTQEFSDEVPSGSVISQS
FT                   IEAGEMVSPNSSITLVISKGKEEVTYSYSISNPYDGECTYEIAELGKSGTIPKNGAINI
FT                   SEVKVDTLTVTLTYTPLYLSGDGTMKPNPNATETSTQAVKGKPNN"
FT   CDS             800499..801386
FT                   /transl_table=11
FT                   /locus_tag="CIY_08720"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73744"
FT                   /db_xref="GOA:D4J0V5"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V5"
FT                   /protein_id="CBK73744.1"
FT                   /translation="MVGKIIKGIAGFYYVQVADSCVYECKAKGAFRKDKIKPLVGDDVE
FT                   IDVISEEEMTGNVIRILPRKSELIRPAVANVDQALLIFATKSPEPNLNLLDRFLCMMEE
FT                   QELPITICFNKDDLADEGFQQQMRDTYEPAGYKVIFTSAKEEAGIEIIKDVLKGKTSTV
FT                   AGPSGVGKSSIVNLLTQGQVMETGEVSEKIGRGKHTTRHSELLYLGDDTYIMDTPGFSS
FT                   LFVPKVEPTDLYRLFPEFVGPAENCRFTGCAHHKEPDCGVKAAVESGEIAASRYENYLQ
FT                   IYSEMVQEQNNKYR"
FT   CDS             801396..802049
FT                   /transl_table=11
FT                   /locus_tag="CIY_08730"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73745"
FT                   /db_xref="GOA:D4J0V6"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V6"
FT                   /protein_id="CBK73745.1"
FT                   /translation="MEKCLAPSILSADFGILKEQLQLIDQAGAQYVHFDVMDGVFVPSI
FT                   SFGLPVLRTIRKYTDRLFDVHLMIVDPERYVKEFAEAGADIITVHAEACKHLDATIDLI
FT                   KSSGVMAGVAINPATPLSDIMHVLEKVDMVLIMTVNPGFGGQSMIPYTLDKVRELSVMA
FT                   RQKKLKIDIEVDGGVNENTIEDVLEAGANIIVAGSAVFNGDAKLNAERLLEKMQ"
FT   CDS             802046..802708
FT                   /transl_table=11
FT                   /locus_tag="CIY_08740"
FT                   /product="thiamine pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73746"
FT                   /db_xref="GOA:D4J0V7"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V7"
FT                   /protein_id="CBK73746.1"
FT                   /translation="MIVVIIAGGDIDEEFTGGFIADLDESSLFLIACDKGYEACERMGI
FT                   KPDVLIGDFDSAVGNVSDRARAAGVNVIKLNPIKDDTDAEAAIDLAIAKTTEDDEIYLL
FT                   GANGTRLDHVLGNINLVAKGLKAHREVTMMDPHNSIQMIEPGETYIVEADYQFGKYISV
FT                   FPYMGKVSGLNMDGFKYPVKNGVIEGYNTLTVSNELAEDEGTITIEEGVLIVIESMD"
FT   CDS             802736..803461
FT                   /transl_table=11
FT                   /locus_tag="CIY_08750"
FT                   /product="Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73747"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V8"
FT                   /protein_id="CBK73747.1"
FT                   /translation="MDLRKIVRGLFERKMVVLLVAIVLLFAVLFNSGMFGGTDSRIHIS
FT                   CVGDSLTYGSGVLKTREIDSYPAQLQARLGTSYLVSNFGLRNATASTSGDLPYIESEQY
FT                   KESLKSNPDIVILMLGTNDTKTQNWNASEYRKGLTDLVETYKKLDSNPKVFLMRSPYCF
FT                   PIEGNDDAEYNVQASVVNGELGDIIGEVAEETDVSLIDLHKVTEGKEYLYTDGIHFLAK
FT                   GYTLIADTVYDSIKNAIEK"
FT   CDS             803557..803775
FT                   /transl_table=11
FT                   /locus_tag="CIY_08760"
FT                   /product="Heavy-metal-associated domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73748"
FT                   /db_xref="GOA:D4J0V9"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0V9"
FT                   /protein_id="CBK73748.1"
FT                   /translation="MKKTYKIDVDCANCANKMEQAAKNTAGVADATVNFMALKMSVEFE
FT                   EGADVKAVMDEVLKNCKKVEDDCEIFL"
FT   CDS             805806..806162
FT                   /transl_table=11
FT                   /locus_tag="CIY_08780"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /function="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73749"
FT                   /db_xref="GOA:D4J0W0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W0"
FT                   /protein_id="CBK73749.1"
FT                   /translation="MGKHAECCDEQCVHKDLVNKVMLEQPDEDSLYDLAELFKVFGDST
FT                   RVRILYALYRSELCVCDLSDALDMTQSAISHQLQILRTNKLVKSRREGKQIYYSLADEH
FT                   VVTIMAQGLDHILE"
FT   tRNA            806329..806403
FT                   /locus_tag="CIY_T_34890"
FT   tRNA            806425..806495
FT                   /locus_tag="CIY_T_34900"
FT   tRNA            806521..806594
FT                   /locus_tag="CIY_T_34910"
FT   tRNA            806601..806674
FT                   /locus_tag="CIY_T_34920"
FT   tRNA            806721..806792
FT                   /locus_tag="CIY_T_34930"
FT   tRNA            806847..806922
FT                   /locus_tag="CIY_T_34940"
FT   CDS             807127..807588
FT                   /transl_table=11
FT                   /locus_tag="CIY_08790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73750"
FT                   /db_xref="InterPro:IPR025051"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W1"
FT                   /protein_id="CBK73750.1"
FT                   /translation="MDQIMVFHGSNVEVSKPKILQNGFYKDFGYGFYCTKLEKQAKRWA
FT                   LTRKGNSIVNKYSYNENPNLKIKSFSDMTDEWLDFVVECRRGTLHDYDIVEGPMADDQI
FT                   WNFVEGFIEGRITRTAFWELVKFNYPTHQIVFCTEEALNTLEFEGSDSL"
FT   CDS             807585..808055
FT                   /transl_table=11
FT                   /locus_tag="CIY_08800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73751"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W2"
FT                   /protein_id="CBK73751.1"
FT                   /translation="MKNKYFPDEEIELNDLYFICYMIERVARHIHQKNKYVVNMIGKEG
FT                   LYHLISLANVLHCENPDKVEDDWINDYKLQNSDFDITDVDKELAEKIPSPLEMGEVYQR
FT                   LINDTLDSKEDYVDGIIRVYNNEICDTIDNYNCSAFYEPSYVIARAYQSGGF"
FT   CDS             808244..808780
FT                   /transl_table=11
FT                   /locus_tag="CIY_08810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73752"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W3"
FT                   /protein_id="CBK73752.1"
FT                   /translation="MKCPHCNADIAPNTNYCEFCGSQISYDMKREQEQLNKAGCPKCGS
FT                   SNVTFNREKQGEVKGKNASAVVRRTVGVCKDCGYTWFTDDTGENKKKAPIWLWVLGWIC
FT                   IFPVPLTIQMLRNKEMKPAVKYGIIAAAWIFYLCIGILVVLLMIQKLKMLLLLLRQLWQ
FT                   IQQMNLITKTMFRVL"
FT   CDS             810051..811145
FT                   /transl_table=11
FT                   /locus_tag="CIY_08840"
FT                   /product="Predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73753"
FT                   /db_xref="GOA:D4J0W4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W4"
FT                   /protein_id="CBK73753.1"
FT                   /translation="MKETSFDIQGYMTKGVERIVKDALRATFKDPAESIFMASFAKASK
FT                   KASATRLKFKEEGLHVPPFLITSITSNCNLHCAGCYSRQNEATKDCAPVDQMTGEEWGK
FT                   VFEEARELGISFILLAGGEPLLRKDVIQSAASYKDILFPIFTNGVFISDEYFTLFDKNR
FT                   NLVPIMSIEGHKEATDARRGEGIYDKLISNMEKFKEKHLIFGNSITVTTENFDDVLSDE
FT                   FVSMLGGYGCKSMIYVEYVPVSDESKHLALSEEQEEKLRARIDELRQKYEEIVFISFPG
FT                   DEKSSGGCVAAGRGFFHINSHGGAEPCPFSPFSDTNVRESSLRGAISSRLFKVLQDTDI
FT                   LLDDHVGGCVLFEKRDQVQAILQQ"
FT   CDS             811214..811714
FT                   /transl_table=11
FT                   /locus_tag="CIY_08850"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73754"
FT                   /db_xref="GOA:D4J0W5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W5"
FT                   /protein_id="CBK73754.1"
FT                   /translation="MNNIVLIGMPGVGKSTLGVVLAKELGYEFVDADLLIQKREKRLLK
FT                   EIIADEGVDGFLKIENDVNAEIQADKTVIATGGSVIYGAKAMEHLKEIGTVVYLKLDYE
FT                   TLDSRLGSLKGRGVVLKDGQNLKSLYDERIPLYEKYADIVVDEQGLDLEETLDSILKKL
FT                   QNA"
FT   CDS             complement(811711..812400)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73755"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W6"
FT                   /protein_id="CBK73755.1"
FT                   /translation="MLKLLHNEEPVLRAEITALYSVLDHKLGLHGAEVPITFGMDEKAL
FT                   GSYLPPSYDNEERFEFSLFFIGFCMNEQLTKNDRVNLYKHEYAHYMTRHINIPEKYNWQ
FT                   PGVHGSAWKYCCSLIGAIPSDYYIDGQNIQKVDYDSVLTRPNVDHKQVQMLDTYRTQKM
FT                   YANMENAKIKYEVGDTVTHPKFGEGTVQEIEQQPASVRLHIAFGDEVKIIDQKWLVKTG
FT                   YKKVAER"
FT   CDS             812608..813564
FT                   /transl_table=11
FT                   /locus_tag="CIY_08870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73756"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W7"
FT                   /protein_id="CBK73756.1"
FT                   /translation="MKNQKFFKRIMALATAVIILGAFVAEPITAEAAKKKGSGRATYAV
FT                   GDDVAFGALDGQILTWTILTYDDTTKIAFVTTRRPLNSKTITSYRMAIDQIYKNKGTTA
FT                   GYVRWSENYWRGWCNQVFYKQCFNAAERAMIQKTTLSEEAAQDSIMNYYHDTSMDAAFV
FT                   GGKAKNAVNMAIYNSQTTTSDYIFFLSTDEYTAYKDTMKNETKLMFPLRTNAYDDPVQG
FT                   LFGNDTDKLIYRMYYYAGDSIRPAMYVQLGTPEPQEDSSKTSSTDKNTSNTKTTDTTKT
FT                   TTTAKTTAAATTTNTAATTDTKKKAGSTKNMQITELI"
FT   CDS             813956..814666
FT                   /transl_table=11
FT                   /locus_tag="CIY_08890"
FT                   /product="Predicted Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73757"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W8"
FT                   /protein_id="CBK73757.1"
FT                   /translation="MYYGYGYGYGYDWTIILVIIGAIISGIASLNVRRTYAKYSKFRNY
FT                   RGITSNQVAEHILHAAGIYDVRIERIRGNLTDHYSPNEKVLRLSDAVYGQTSVAALGVA
FT                   AHECGHAIQHQEGYAPLKLRSASVPLANIGSWVSWPVILIGLLVGSTPLAQVGIFLFTF
FT                   VVAFQLITLPVEFDASARALRILDQDHILEGEEHKGATKVLKAAALTYVAALFTTILQL
FT                   LRLVLIVNGRSRRD"
FT   CDS             815419..816246
FT                   /transl_table=11
FT                   /locus_tag="CIY_08910"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73758"
FT                   /db_xref="GOA:D4J0W9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0W9"
FT                   /protein_id="CBK73758.1"
FT                   /translation="MDLKDYQHEVVVTDAGLPFKLFSFEGASGNYIRDKHWHRSIEIFA
FT                   VWEGKLDFTLHNKKFPLSNGEFVIVNSNEVHSIVAPNPNKTVVLQIPQDTFAEYFTDDQ
FT                   FIWFSHGDRESDHRVFTLLQEMYLIYTNGEEGNKLQVLSLYYELLYLLVTKYRKFNVNE
FT                   ELVKSNKQLKKLSSITRYMKDHYSEPLSLEMMAEQFNYSPSYLSRMFQKHAGINFKDYL
FT                   LGIRLEHAVRELEETGGQIVDIALGNGFPNSKAFSNAFRDKYGVLPSEYRKNN"
FT   CDS             complement(816243..817040)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08920"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components"
FT                   /EC_number="3.6.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73759"
FT                   /db_xref="GOA:D4J0X0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X0"
FT                   /protein_id="CBK73759.1"
FT                   /translation="MNQNSLKAKNITTGYGNNIILNSVNMAIPENKISVILGSNGSGKS
FT                   TMLKTFCRLLAPKSGEIALNDKPLHCIRSKDIAKAIGLLPQDSIAPAGISVAELVTRGR
FT                   FPYRKFMAPLSKEDYEAIEEALEAMNICKLADKSVDELSGGQRQRVFIALALAQQTDIL
FT                   FLDEPTTYLDIAYQIEILDLLKELNKKKKTTIVMVLHDINLSSKYADYIFAMKDGHLLK
FT                   EGKPEDIITPETIKEIYGLDSVVITDPVSNSPMIIPISSHDKA"
FT   CDS             complement(817306..818055)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08950"
FT                   /product="ABC-type enterobactin transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73760"
FT                   /db_xref="GOA:D4J0X1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X1"
FT                   /protein_id="CBK73760.1"
FT                   /translation="MIKNPTIFQGIKKRQKRYGIAITLMFILLMVLVCLNITIGEKNYS
FT                   LSDVAKIIINGENNYIIMKLRIPRTIAGIFCGVAFAIAGNTFQTLLGNPLASPDIIGVS
FT                   SGSTVAAVYCILFLNLNRGLVSAISVVTGLLSAFLIYKLSCKNGFSTNRLILTGIGAQA
FT                   FFTALINWMVMRAAEYDVPTAMRWMAGNLNGITTDTLPLLISVVVLSFIIMMYCNQSIR
FT                   SLELGDRYAKILGVNVGVIRTLLIFAQ"
FT   CDS             complement(819040..820086)
FT                   /transl_table=11
FT                   /locus_tag="CIY_08970"
FT                   /product="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73761"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X2"
FT                   /protein_id="CBK73761.1"
FT                   /translation="MKKRLLTLLLATTILTLFVGCGSTAQDSKESATTSTIETETDSQF
FT                   PITIKHAFGETVIESKPERIVNLGWANQDTTLALGVVPVGVSAANYGLMTENRLHPWSD
FT                   DAFKALGESKPNVFNDETGWDYEAIAASEPDIIIASYSGFTEEEYNLLSEIAPVVPFLE
FT                   VAWKTNWRQQTITNATAMGMKEEGEQLVEKTDTLIADKLAEYPALEGKTAGYFWISQDD
FT                   MSTFYAYLPNDPRASYLNDLGLATPDSILSLAETSEDFSVTISRENTDLLNDVDIMVVY
FT                   GDEGLLEALQADPLMSQIPAVKNGAVVLIDQTTALAAATTPSILSIPYALEDYLNVLNE
FT                   AANKIEAK"
FT   CDS             820531..821304
FT                   /transl_table=11
FT                   /locus_tag="CIY_08980"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73762"
FT                   /db_xref="GOA:D4J0X3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X3"
FT                   /protein_id="CBK73762.1"
FT                   /translation="MEDKTYMLRALELAKLGAGFVNPNPMVGAVIVKDGVIIGEGYHEK
FT                   YGQLHAERNALKDCRERGNDPAGATMYVTLEPCCHYGKTPPCTEAIVESRINRVVIGTL
FT                   DVNPVVAGKGADILREHGIRVEVGLLEKECKKLNRVFNKYMLSKRPYVVMKYAMTADGK
FT                   IATVTGESKWITSDEARENVHRLRKNLSGIMVGVTTVITDNPSLDCRLDEPAVNPVRII
FT                   CDSHLRTPLDSKVVETAGGIKTIIATSSDDEKKGR"
FT   CDS             821307..821630
FT                   /transl_table=11
FT                   /locus_tag="CIY_08990"
FT                   /product="Pyrimidine reductase, riboflavin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73763"
FT                   /db_xref="GOA:D4J0X4"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X4"
FT                   /protein_id="CBK73763.1"
FT                   /translation="MKKNGCVVVRVSQDKNGIDLNELMGKLGSLGIDSVLLEGGGTLNY
FT                   SALESKIVDEIHIHIAPKIFGGSSKSPVEGLGISDINKAIKLNPISTSWAGNDLIIENE
FT                   VIY"
FT   CDS             821630..822262
FT                   /transl_table=11
FT                   /locus_tag="CIY_09000"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73764"
FT                   /db_xref="GOA:D4J0X5"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X5"
FT                   /protein_id="CBK73764.1"
FT                   /translation="MFTGIIEELGKVQRITRGSKEQRLVINCKKILEDMHIGDSIAVNG
FT                   VCLTVVEFNINSFSADVMNETFSRSGLGELTLGSVVNLERAMAANGRFGGHIVSGHIDG
FT                   TGKIKSVRQDGNAVWFEISVDSKILRGIVEKGSIAIDGISLTVAAVGRDSFKVSIIPHT
FT                   LKVTVLGSKRVGDRVNLENDVIGKYISKFLGREEKCEESRLKELLMI"
FT   CDS             822223..823419
FT                   /transl_table=11
FT                   /locus_tag="CIY_09010"
FT                   /product="GTP cyclohydrolase II/3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /EC_number="4.1.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73765"
FT                   /db_xref="GOA:D4J0X6"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X6"
FT                   /protein_id="CBK73765.1"
FT                   /translation="MRRESIERAIDDLKNGKVILVMDDEGRENEGDFICAAEYATTENV
FT                   NLMASVGKGLICMPMSEELSYKLALPPMVRHNTDNHETAFTISIDYVGTTTGISAAERG
FT                   LTARSCVSDNVTPMDFRRPGHMFPLVAKAGGVIERPGHTEATVDLMKLAGLKECGLCCE
FT                   IMAEDGTMMRGEALRKLAKDLGITFITIPELVEYRKVYDKLVECVSIAKMPTRYGEFMA
FT                   HCYINKLNGEHHIALVKGDISSGENVLCRAHSECLTGDVFGSMRCDCGQQFDAAMKKIS
FT                   AEGRGVLLYMRQEGRGIGLVNKLKAYKLQDEGMDTLDANIALGFPGDMREYYTGAQILR
FT                   DLGIHSLQLLTNNPDKVYQLSDYGMEIAKRVPIEIEANKYDVFYLKTKKARMGHILEV"
FT   CDS             823434..823898
FT                   /transl_table=11
FT                   /locus_tag="CIY_09020"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /function="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.-"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73766"
FT                   /db_xref="GOA:D4J0X7"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X7"
FT                   /protein_id="CBK73766.1"
FT                   /translation="MKVYEGKLVSEGVKVGIAVARFNEFITSKLLGGAIDGLKRENVKE
FT                   EDIEVAWVPGAFEIPLIAKKMADSKKYDAVICLGAVIRGATSHYDYVCAEVSKGVAQVS
FT                   LGAEIPVMFGVLTTDTIEQAVERAGTKAGNKGFECAQGAIEMVNLIREMK"
FT   CDS             824089..825573
FT                   /transl_table=11
FT                   /locus_tag="CIY_09030"
FT                   /product="L-fucose isomerase and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73767"
FT                   /db_xref="GOA:D4J0X8"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X8"
FT                   /protein_id="CBK73767.1"
FT                   /translation="MTNMPNVKIGVVAVSRDCFPESLSVDRRKALIAAYTKKYGAEHIY
FT                   ECPVCIVESEIHMVQALEDIKKAGCNALCVYLGNFGPEISETLLAKHFDGPKMFCAAAE
FT                   ESGNSLLDGRGDAYCGMLNASYNLQLRNVKAYIPEYPVGDAEDCADMIHEFEPIARAVI
FT                   ALSDLKIISFGPRPMNFLACNAPIKQLYNLGVEIEENSELDLFEAFNKHAGDSRIPEVV
FT                   ADMEKELGAGNKKPEVLEKLAQYELTLKDWVRDHKGYRKYVAIAGKCWPAFQTQFGFVP
FT                   CYVNSRLTGEGIPVSCEVDIYGCLSEFIGTVVSEDVVTLLDINNSVPKDMYNEEIKGKT
FT                   DYTLEDTFMGFHCGNTCSRKLAFCEMRNQKIMARALPVEVTNGTLEGDIAPGEITFYRL
FT                   QSTADNKLRAYIAQGEVLDVRTKSFGSIGVFAIPEMGRFYRHWLIEKGFPHHGAVAFGH
FT                   YGKALFEVFKYIGVDVDEIGYNQPAGVRYPTENPWK"
FT   CDS             825758..827215
FT                   /transl_table=11
FT                   /locus_tag="CIY_09040"
FT                   /product="xylulokinase"
FT                   /function="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73768"
FT                   /db_xref="GOA:D4J0X9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0X9"
FT                   /protein_id="CBK73768.1"
FT                   /translation="MYYIGVDLGTSAVKLLLMSGDGTIAKIVSKEYDLSFPHPGWSEQK
FT                   PEDWWTQVIAGIKELTSEVDKTLVAGISFGGQMHGLVTLDADDNVIRPAILWNDGRTGK
FT                   ETEYLNNVIGKDKLSQYTANIAFAGFTAPKILWMQENEPELWKQVSKIMLPKDYIAYKL
FT                   SGSFCTDYSDASGMLLLDVKNRCWSKEMMDICKVSESQLPKLYESYEVVGTIKPEVAAE
FT                   LGFTNDVKIIAGAGDNAAAAVGTGTVGEGKCNLSIGTSGTIFISSKNFTVDPANALHSF
FT                   DHADGGYHLMGCMLSAASCNKWWMDEILKTKDYPAEQAGIKNLGENRVFYLPYLMGERS
FT                   PHNNPDARAMFIGMSMDTTREDMTQAVLEGVAFGLRDSLEVARSQGIVIERSKICGGGA
FT                   KSPLWQQIIASVMNLKLDILENEEGPGLGGAILAAVGCGEYASVEEACDKLVKVKTTVE
FT                   PDPELIRKYEERYQEFKKLYPTVKTLF"
FT   CDS             827718..828185
FT                   /transl_table=11
FT                   /locus_tag="CIY_09050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73769"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y0"
FT                   /protein_id="CBK73769.1"
FT                   /translation="MDKIKEVAGNNTNDLVEMNRSAIVRILQQTDGCSRADIAKMTGLT
FT                   QASVTKIVAVLIEMGIVSEVGFVRGSGNRRSIGLRLNAEENLVIGVKFSRHVFSIGVFD
FT                   ICGKNYTKQETEFGLDEFAEDVLAEMKNKFMNCLINTKTLLQLEWQYLGLI"
FT   CDS             828206..828934
FT                   /transl_table=11
FT                   /locus_tag="CIY_09060"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73770"
FT                   /db_xref="GOA:D4J0Y1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y1"
FT                   /protein_id="CBK73770.1"
FT                   /translation="MVTRMPSWHDVNFIDEFQNEFDKPFFIEQDANAGALAEWWFGNHG
FT                   RPLNSLTYFLVGEGVGSGIVDHDRLLLGNLGIASEIGHISIDVNGPACECGNRGCLELY
FT                   CSATAMLKKAKKLLPEIFQEEITNRWEACNKVFIAAKEGNEKALKLVDEIAEYIGYGCV
FT                   TLINGYDPEIIVIGDSISQGGNLLLPTINRIVKERILPEISSRVQIKISELTIDPTLYG
FT                   AAAIATDKMLRKPSEYLVRK"
FT   CDS             828974..830038
FT                   /transl_table=11
FT                   /locus_tag="CIY_09070"
FT                   /product="ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73771"
FT                   /db_xref="GOA:D4J0Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y2"
FT                   /protein_id="CBK73771.1"
FT                   /translation="MERNSYILQMQGITKEFPGVRALDDVNLNVHTGSIHAICGENGAG
FT                   KSTLMKVLSGVYPYGTYDGKIIYMGQEMKFKNIKESEHAGIAIIHQELTMIPELSITEN
FT                   IFMGNEITHKGLINWTEERAKTSEILKKVGLTINPDTLIKHLGVGQQQLVEIAKALSKN
FT                   VKLLILDEPTSALNEADSANLLELMKGLRDKGITCIMISHKLNEIAEVSDAVTVIRDGH
FT                   TVESYDVEAGKVDEDQIIKSMVGRSIENRYPEHEPKIGDVIFEVRNWCIEDPEVAGRMV
FT                   CKNSSFNVRAGEIVGFAGLMGAGRTELMRSIFGKNYGIYRSGTIKIKGREVRLNSVEQA
FT                   IKNGIAYVPEDRKT"
FT   CDS             830125..830511
FT                   /transl_table=11
FT                   /locus_tag="CIY_09080"
FT                   /product="ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73772"
FT                   /db_xref="GOA:D4J0Y3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y3"
FT                   /protein_id="CBK73772.1"
FT                   /translation="MEQSAAEEYRKSLKIKTSSIDVGVTTLSGGNQQKVVLSKWMFTEP
FT                   DILILDEPTRGIDVGAKYEIYKLIHQLADQGKAVILVSSELPELLGMADRIYTIFEGTI
FT                   TGEMMSYEANQESLMKKMTITSNS"
FT   CDS             830551..831753
FT                   /transl_table=11
FT                   /locus_tag="CIY_09090"
FT                   /product="ABC-type xylose transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73773"
FT                   /db_xref="GOA:D4J0Y4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y4"
FT                   /protein_id="CBK73773.1"
FT                   /translation="MKYIKQVLGGDLRQYTMVVALGLLILIFNVISDGRMLTSSNFQNL
FT                   LSGNAYVLVLALGMLMVIVIGQIDLSVGSVAGFAGMVMALVAKNYNLPWWVAVLIALAI
FT                   GILAGAWHGFFLSQLGIPGFITTLGGMMIFRGGVIWISRSISVPAPEELKWFGAGYLPE
FT                   WGPSFTGMNNSTLVLGLIGIVCFAVGQIRKYNRSKNSPVGVTPLWAVVVRIILMTALIG
FT                   YFTYLFGSGRVGTSFPVPGLILLLLTIIYHIITQCTKFGRHVYAVGGNKAAAALSGVNV
FT                   KRTYFLTMMNMSFLAAVAGILFVGRSTAAGPADGTSWEMDAIASVFIGGAAVSGGVGTI
FT                   LATIVGGMVMAVLNNGLMLMGVGADKTQVIKGFVLLAAVAFDVYNKKNGKSSIIGRIFS
FT                   K"
FT   CDS             831773..832924
FT                   /transl_table=11
FT                   /locus_tag="CIY_09100"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73774"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y5"
FT                   /protein_id="CBK73774.1"
FT                   /translation="MKRRTLLSMAMVATMALATFTGCGGSREGAAPTETAAETTETTET
FT                   TDTTEATSEESFPGFEDGATIGVSLPWLGTQNWKEAEEMFTAQLEEAGYKPIVQAADQK
FT                   VTQQQQQIESMIENGAKVIVVGPVDGSQLGAVLEQAKEAGVYVIGYDRLLENTSGVDGV
FT                   VQFGSVKTGELQAQALLQGLEEKKGEAPYNIELFGGGPADPNAPNFFTGAMSVLQPKID
FT                   DGTLVVVSGQTDFTQCATVDWDNAKAQSRMDSLLAGNYSDKEIDGVLSPNDGIARAIIT
FT                   SCENAGQDIPVVSGLDAENESVEWVWSGRQYSTVAKPTQDLVAKTIEIIDSLKAGNGMP
FT                   ATDVEVDNGVKNVRVYELPPVVVTKDNAKEVFANDPSRLELLK"
FT   CDS             833038..833838
FT                   /transl_table=11
FT                   /locus_tag="CIY_09110"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73775"
FT                   /db_xref="GOA:D4J0Y6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y6"
FT                   /protein_id="CBK73775.1"
FT                   /translation="MNYKIVFSDIDGTLLNSNHRMSENTENAIKNLKRQGIPFVIVTAR
FT                   GPSGVYPIFRRYNFVAPIICYSGALILGEDGEIIFSKGISKSTVSSLIKVITEEGWDCT
FT                   WNVYTLDDWIVNDKSDERVIIEENIVEVQSTKGSVDDIPNGMEIGKFLCMCNPNEIDEI
FT                   EGVLKTKYPSLSIVKSSDILLEVMEKGVNKGIAVEMFCDKLNINKNDAVAFGDHYNDSE
FT                   MLKTVGTPFLMENAPEDMKADFNITSSNDEEGVFKALKKIGLLD"
FT   CDS             833869..835101
FT                   /transl_table=11
FT                   /locus_tag="CIY_09120"
FT                   /product="N-acyl-D-glucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73776"
FT                   /db_xref="GOA:D4J0Y7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y7"
FT                   /protein_id="CBK73776.1"
FT                   /translation="MGKYELDTPENKAFVREMRNSLLSFGHQFPSPGGGSYYLGDDGTP
FT                   WKDRPRETWITSRMAHVYSLGVMLGHEGSEALADAAIKGLLGELYDDDHGGWYAGITSD
FT                   GEYLPNKQCYAHAFVILAATSAYLAKRPKAKELLKAAIAAYDAHFWEGDKGLSVDTWNT
FT                   EFTKLDDYRGMNANMHSVEAFLAVADALEDENYRIRAGRIITFMIGWAKDNDYRIPEHF
FT                   TSDWIPDLECNKDKPDDNFKPYGATPGHGIEWARLIVQWAISTYGTDNENVADYIRIAE
FT                   KLYNRAIEDGWNVDGAPGICYTTDWNGKPIVHDRMHWTLAEAINTSAVLFRVTGNEKYK
FT                   EDYAAFMEYLDTCVYDHETGSWFHQLDENNQLLTTVWPGKSDIYHALQATMIPYNEMVG
FT                   VSIATAISRNM"
FT   tRNA            complement(835135..835209)
FT                   /locus_tag="CIY_T_35310"
FT   CDS             835470..836609
FT                   /transl_table=11
FT                   /locus_tag="CIY_09130"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73777"
FT                   /db_xref="GOA:D4J0Y8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y8"
FT                   /protein_id="CBK73777.1"
FT                   /translation="MAQTSMLAMILAGGRGSRLHDLTNKVAKPAVSYGGKYRIIDFPLS
FT                   NCANSGVDIVGVLTQYESVLLNSYVAAGGRWGLDTKDSGVFVLTPREKADCGLDVYRGT
FT                   ADAISQNIDFVDAYDPEYILILSGDHIYKMNYDKMLSYHKEQGADATIAVRGVPMKEAS
FT                   RFGIMNTDGNGRIIEFEEKPAKPKSNLASMGIYIFTWKTLRKLLVEDMKNPDSDHDFGK
FT                   DIIPIMLDGGKKLCAYEFSGYWKDVGTIDSLWEANMDLLDSDNELDLDDTSWKIYTEDS
FT                   GITPQYIASSAKIDGAYINQGAAVGGTVQRSVIFTNCKIAPGAKVIDSVLMPGAIVEEG
FT                   AVVTRALVAENVRIGKNAKVGEKKSEEILLVAKNVKGED"
FT   CDS             836613..837203
FT                   /transl_table=11
FT                   /locus_tag="CIY_09140"
FT                   /product="ADP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73778"
FT                   /db_xref="GOA:D4J0Y9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Y9"
FT                   /protein_id="CBK73778.1"
FT                   /translation="MANKAFGVINSAPNYIRVEGLHEYRPIGAFTFIGRFRVIDFPLSN
FT                   MSNSGINRIHVYLNSRPRSLVEHIGSGRHYNINSKRGNLQLLFTQQNGANSIYNTDITA
FT                   YMENLEQIERMPQDYVIVAPSYMVYKQDYQQLLDDHVAAGNDITLLYHKVDQAKEYYRA
FT                   CNVVELNKQKGVESLARNMGTAKEKISAWIPML"
FT   CDS             837185..837730
FT                   /transl_table=11
FT                   /locus_tag="CIY_09150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73779"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z0"
FT                   /protein_id="CBK73779.1"
FT                   /translation="MDTYVMKKDLFIALIKKAKRESSAYSFADIVGLSCDTLDIRGYQH
FT                   KGYFAAITSLDDFYRANMELLDYGTAMDFFKQDWPFYTKTTDACPTHYHPGGKVTNSLV
FT                   CNAASIEGIVENSIIGRHVHIGKGAIVKNSIILSYADISDGTYIENAVIDKWVKVKNVK
FT                   KIVSDSVTPAYIKRNDVL"
FT   CDS             837928..844803
FT                   /transl_table=11
FT                   /locus_tag="CIY_09160"
FT                   /product="Predicted beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73780"
FT                   /db_xref="GOA:D4J0Z1"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR007934"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z1"
FT                   /protein_id="CBK73780.1"
FT                   /translation="MKHEKKLKRATALLLALALAWSGSIPDAGLSLVRATEATDAAVDD
FT                   VDSTDETTADATVDEESESTDEATEDQKEPEDEETEENNVNEDVEDSDEQSEDELLSEE
FT                   LLDEEILKDEEEEEKEKTELKLIADFDFEGLSAGETMTGAAAKASGSYSLTTSYDGSQA
FT                   LSLNGSNQYLKVTTKDGDSLLGGYDSVSISADVQFLRTDANWLFYAAPDSNAQSYPYEH
FT                   YIGAFLEKGSDFKAEQYNNNGSRPGCAATSLSLNTWNHIEAVYSKDVTTIYVDGEKKAT
FT                   FESGFALEDILKDSPIALIGRANWGSGEYCKAYVDNFKIYSGSLSDGDVKDLYQAYLDR
FT                   KVGEKTEVDFSLNAGYVTDDINLPAEYDGKKISWETSDDKAITADGKVTRSNKNKEVTL
FT                   TANIDGDKKDFKVVVLKEGKDVITYTNSKPAVGQDGGMMIAAEENGGFSPLHKNQPILY
FT                   TALGNKSYSSPVILREADGEGFFMVATSGGQLLTYKSEDLITYTDENGVALGNVSSVRK
FT                   AAAVYDMTDERYEIYLKTDDGLYLVASKDMKKFDTPLLINDDAFEFDTVKNSPNTAISP
FT                   SAIGLTNEEYEKVVEKFTNPYNTSLSDLPTDEIKVDALTSKEEFREVLQKYIKKNTVKA
FT                   EYSDGTKNTYSLRFTEESIDNVDLELPGTYTLDGVIGGSGNFTDAADPLIPERADPYVV
FT                   YNEDDGYYYFTASYPMVGNGDKDGYDRVILRRAKTIEGLATAEEVSIWDENTSKELGRF
FT                   IWAPEMHKIGDSWYLVATAGLNTGSGTTFNIRPFMIKFQGNAKKDDLYDLDKWGDPVLV
FT                   KPVKGDNVLNAMSLDMTYFEAGGNHYLIWADETKNSQNPDGLSYLFIATIDPENPTQLT
FT                   SKAQLLTKPEFNWELVRYKVNEGPGVFHKDGKVYMTFSASGTGSEYCVGLMYADEKADL
FT                   TDISNWTKLPYPILTSSDFDDEVSGPGHNSFTYDENGNLVIVYHARESKSHATHSGDPL
FT                   YDPCRNAYVKTVLFDEDGLPIFNLSSEDFIKGGDTFKVNVVVEGEEIKAEPVLEYNFNE
FT                   TLSKGVVKDVSGNGNDGYAHKGEYVSDDDYGKVLYLSGDDSVGGNNSYLEFPKGFFDGR
FT                   NKMTISFDVKEVTRTGNYFTFTFGQDNSKYLFYKAMPTAEKLAITQNGGGAESKVEASA
FT                   KYPNTASTWINITIVVDGTKMSLYRDGKLIGTNKNTGVKVSDLGEDLLGYLGKSFYSAD
FT                   EYFRGYFDNVKVYNRAYKKDDVARLYTAGRVARAEEVGDVNYVANNYVIPNMNKIKGNI
FT                   SLPSEVNGVNISWTSSNEKVISTKTKSNTGYDSTPAGVVTRQDADVNVTLTATFSKGDE
FT                   KVTKTYDCKVIKAPKAVDEYVGYLFVHFTGTEGAASDEQVYFSVSKDGFNWEDLNNNNP
FT                   IITSTIGESGLRDMYIARTPEGDKFYMISTDLSIYHNKSNAWPAAGSNGSHSIVVWESS
FT                   DLVHWSKPWLAEIAPENAGCTWAPEFVYDDVTGEYVVYWSATRLEVDENEKITQDYENH
FT                   AIYYAKTRDFVHFTEPKLYHEGGRNSNGVIIKVIDSTMIKGNDGKYYRYTKNESNGSIK
FT                   IDVADRVLGNFTDIDSKFLDKTLPNKVGAVEGPIIFKLNEKNEAGEDQWCLLIDRFARG
FT                   QGYYPVVTTDLASGDFQFVEDSKLGSYNKIKYRHGYVMPITADEYAALTDSDWNDFDDE
FT                   AEEIVLEKSNSGNPMLGFDENSDILYGGDPSILVDGDTVYAYVGHDTSTNESYKMPDWR
FT                   CYSSQDMKNWKYEGEFLNDSDISWVQDKNSAWAGQVVKHDGKYYFYYCSEAKSSYGGGK
FT                   CIGVAVSDSPTGGFKDIGHPLVRNVDTYNGVSTWEDIDPTFWIEKDEDGKEHRILGWGN
FT                   VRFFNCELNEDMISIVDKDGDEDKLSVEKAADQKDADIKVGVIKGMPSGHQYTEAPYYY
FT                   KHKLANGKERYYMFFAYDWREQMAYAYCDSLEDFLNNQWTFGDVVMEPSATSNTNHMAV
FT                   FDFKGHTYFVYHDGSLPHGSGFRRVACCEEFKVNADGTIPYIKKTAVGLTGTVSKIYDS
FT                   KKNTIFVKEFKNTLVDADYPMTGKAVGCDFVYDGENAEWEINPGKLNKNNEALVSIESN
FT                   YKPGMYLTVGKADKDGNYTVVLSQDVNGTKDEAKAMTFRTIKGLSGKGVTFESALHHGY
FT                   YLASVNGKLILTEEPEADEATFFTEKVAEGTVKASEVIKSSRVQKSVRMYVVGETVKTD
FT                   DIRIRATLENGKRVTIKDNLNITVPEDITAETGKKTITVSYEFCGTEYEGQVTINVVDK
FT                   DYRK"
FT   CDS             844821..847466
FT                   /transl_table=11
FT                   /locus_tag="CIY_09170"
FT                   /product="Bacterial Ig-like domain (group 2)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73781"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z2"
FT                   /protein_id="CBK73781.1"
FT                   /translation="MRKNKKYYGLIACVSALALATPFVGYNIAKADKLYDDVVAWYDFD
FT                   GSALTNVKGGSQAVAIVSGLGDYSGEVKYDANRDATKEGKSLKLDGSYGLKLNQQNLGE
FT                   NFSVSLWVKPETKLAENQSVLFLGYHDPEKWYAVSGDRNNTLMKFWYDAKPEFSWVTKT
FT                   FATYAPNEWHHIVITGDGNTIKSYYDGARISEGNEAVLPVMSGENQDVYIGANNWDRCF
FT                   NGLVDDVMVYDRTISETDIERLYTGKSLKEIEEETGVVDYDNYLVDSYSFENSIGDAKP
FT                   IVKGLGAYDGELKFVKGANGKALLTDGYGLDLGNKVQGTDFTISFLAKPNDTQAENQVM
FT                   MLMGYHNPEHWTAISGDGGNQSYKLWGRTDGAKTVGNAAPMSWTTIGNPTISNNVWSLV
FT                   TLVGTDGHLDMYVNGEKAASGAFNNPLCGENESILFGANFWDPCFNGAIDEIRIYNRAM
FT                   DEAAIKASAEDFLDNRLQTSLDAACDFEAIKGLNTDKNHIRYNLELPTSVVDTAINWTS
FT                   SNPEVISEKGVVTVSDKSAEVKLTAEASLAGKKAIVEIDLVVDALDKTELNALIDRAKA
FT                   FDLTYMSIESAERLNQIIAEAEAAATFDEIDSATVRLTKAIETLELADEYVDPFDVIPE
FT                   AEVTVSIEAGSNKDLFVLPETILDKVTVEYASEDTDVATYQDGKLAANKAGKTIVTATV
FT                   KALSDGFEMEYATAVDVKEKAPAPAPQPGTSGGGSSSGSQSGGSSSGSGSSSGSSASAG
FT                   SQTPQPTPAETTITDPQAPAAGQQPSAGASTKTGQTTKPETTEPAEEEETTIEDEQTPT
FT                   TGEATEENTESTETVEDNTEDEVVELIDPPAPEAASGIGAGVVAIIVAAAVVLLGLLAY
FT                   LLKIFGVFKK"
FT   CDS             847665..849080
FT                   /transl_table=11
FT                   /locus_tag="CIY_09180"
FT                   /product="pyruvate kinase"
FT                   /function="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73782"
FT                   /db_xref="GOA:D4J0Z3"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z3"
FT                   /protein_id="CBK73782.1"
FT                   /translation="MRKTKIICTIGPASMNEETLTAMAKAGMNVARMNFSHGDHEEQGM
FT                   KMDLVKKVRKKLNLPIAILLDTKGPEYRIKTFKDGSVTVKEGDTFIFTTDDVEGDQTRV
FT                   SVTHKNLHNDLKVGDTLSVCNGIVFFEVTDIKGHDVITKCTAGGTMSNKKSMSFPNKVM
FT                   SGPYLSEQDKKDILFGIENDIDFVAASFVSTKQDMVELRTFLDENGGKDVVVIAKIENQ
FT                   PGVDNVEEILEVANGIMVARGDLGVEIPFVKLPAVQKELISKARALGKSVVTATEMLES
FT                   MISNPRPTRAEISDVANAVYDGTSAIMLSGESAQGKFPVQAVATMAEIAETTENDINYE
FT                   GRFRKEDIGVVNTADAVCHSTCSMAIDVNAKAIVACTMSGYTAKRVSRFRCPVDVIAMT
FT                   TDKKVWRRLALSWGVTPVLVDKYKALDVMFARAVERTKEMLGLNKGDLVVLTGGPIDGS
FT                   VGNTNTIKVETIQ"
FT   CDS             complement(849349..851208)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09190"
FT                   /product="Cellobiohydrolase A (1,4-beta-cellobiosidase A)"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73783"
FT                   /db_xref="GOA:D4J0Z4"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z4"
FT                   /protein_id="CBK73783.1"
FT                   /translation="MKRKIAGFLSASLAAGLFLSSSATIMAAPSINPYNTVQAERAITK
FT                   NGVDVATDGTNVYITSLEKGDSFSTTPLNFTNGLTGFEASFRSAGVGLVEVRLDKEDGE
FT                   SLGSFKISNTNGAFKSFTTKATQNISGQHTLYFVGKLGDVDVDFFNATATGEVAPTPTP
FT                   TPVVTPTPVVTGEVNPYSTVEVEKVAELKDAMVTPNKSAVMIKYNGYALIKNVNFVDGA
FT                   AIITVNGKTTSDLSILDIRVDGNDAANSIGNAKFSKSNEGAKTIQVKKDITGVHDVYLV
FT                   NAFKDSNVTIDSIVAKAAPTKPTPTPVVTPTPTPVPTPTPTPVPTPTPTPVVTPTPTPV
FT                   VVESVNPYETVEVEKVAELKDAMVTPNKTAVMIKYNGYALIKNVNFVDGAAIITVNGKT
FT                   TSDLSILDIRVDGNDAANSIGNAKFSKSNEGAKTIQVKKDITGVHDVYLVNTFANSNVT
FT                   IDSIVAKAAPTKPTPTPVVTPTPTPVPTPTPTPVPTPTPTPVPTPTPTPVPTPTPTPVP
FT                   TPTPVVEKDLALEYQINSWGTGYTVNFKVANNSGQQVKGWTLKIKKSDCKIDSSWCVNV
FT                   KEAGDYYVITPMDWNSTINANDGAFFGIQGSGSIGTTIGYVLE"
FT   CDS             complement(851488..851742)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09200"
FT                   /product="Protein of unknown function (DUF2442)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73784"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z5"
FT                   /protein_id="CBK73784.1"
FT                   /translation="MFHIIKEIQTLPDYKLNISFMEGQRKIYDIKRLAEQESIFKELID
FT                   DEQLFNSVKIDAGGYGIIWNNELDLSCEELWDNGEPKAS"
FT   CDS             complement(851908..853755)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09210"
FT                   /product="Bacterial surface proteins containing Ig-like
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73785"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z6"
FT                   /protein_id="CBK73785.1"
FT                   /translation="MARNKTLVRFMAIAVAATTLSTSAPAYAAFDADYYAKQNPDVVAA
FT                   FGSSAKALENHYNLFGKNEGRAGSSEDLKNSPLRQLFDASFYAKQNPDVVAAFGNNEDA
FT                   LFQHFLIFGIKEGRQINQYFDVKAYKAAYPDLSEKFGDNMELYYKHFVAYGQKEHRTLG
FT                   GFPSENILPSGKTAVATASAAKTSGSSSSSSSGGSSSKPTPTPAVDPDKTTLSDLTIAV
FT                   GEKATLSINNPPAGATAAYESSDTEIADFDSDDKLVGKKAGTATITVTFDDEDSTKCSC
FT                   TVTVNEGYVKLSTNTLTVAVGGNESLTATGFVGSNITSDIILTTNDPSVAKISSGSVQG
FT                   IKAGTATITARYVSADGIEYTDTCAVTVTAPSIKLDKTSLTVEVGKDTDIHAITLPTSE
FT                   TVAWKSDNTNIVTVASGKVTGVAAGTATIIASIQSGKYEARCNVTVQAPTPKIELAKDK
FT                   ATLKVGENVDLGQDKTTVPASGLLITWSSSSSSVATVDSAGVVTGKTVGKATITASITV
FT                   NGKTYTDSCEVTVEPTPEVKLSKNTETVIVGNTITLSATTIPADEEITWTSDDTDIATV
FT                   SGGVVTGVAAGTATITATITVDGSDYTDTCAVTVTATTP"
FT   CDS             854069..854272
FT                   /transl_table=11
FT                   /locus_tag="CIY_09220"
FT                   /product="transcriptional regulator, XRE family"
FT                   /function="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73786"
FT                   /db_xref="GOA:D4J0Z7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z7"
FT                   /protein_id="CBK73786.1"
FT                   /translation="MYLKRLEDLRIDHDLSQQAVADILFCQREVYRRYEKGERELPLSY
FT                   AVKLAEFYRVSLDYLVGRSDKR"
FT   CDS             854435..854602
FT                   /transl_table=11
FT                   /locus_tag="CIY_09230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73787"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z8"
FT                   /protein_id="CBK73787.1"
FT                   /translation="MGKSDVLSCNVMDNPAYFADTINNGLFGGKEIVKPENLKELDSKE
FT                   NVVLYNAFKK"
FT   CDS             855203..855358
FT                   /transl_table=11
FT                   /locus_tag="CIY_09250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73788"
FT                   /db_xref="UniProtKB/TrEMBL:D4J0Z9"
FT                   /protein_id="CBK73788.1"
FT                   /translation="MCYAWESSMDEAKVEGESNLIDLYSWLKTAGRNDEAEAIMKKENE
FT                   KLRKII"
FT   CDS             complement(855806..857446)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09270"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73789"
FT                   /db_xref="GOA:D4J100"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J100"
FT                   /protein_id="CBK73789.1"
FT                   /translation="MIQANNVTLRFGKKALFEEVNIKFTEGNCYGIIGANGAGKSTFLK
FT                   ILSGQLEPTSGEITMSPGNRLSFLEQDHFKYDEFTALDTVIMGNQRLYDIMKEKDAIYM
FT                   KEDFSDEDGIRAAELETEFAEMDGWNAESDAAQLLNGLGVDTEFHYTLMSELPGALKVK
FT                   ILLARALFGSPDVLLLDEPTNHLDLDAIGWLEEFLINFENTVIVVSHDRYFLNKVCTHT
FT                   ADIDYGKIQLYAGNYDFWYQSSQLIIQQRKEANKKKEEQIKELQEFIQRFSANASKSKQ
FT                   ATSRKRALEKIQLDDIRPSSRKYPYIDFRPAREIGNEVLSVENLTKTIDGELILDHLTF
FT                   NVGREDKIALVGSNEKAKTVLFQILAGEMEPDEGSYKWGVTTSQSYFPKDNTEIFATDL
FT                   LIVDWLTQFSEIKDATYVRGFLGRMLFAGDDGAKKMKVLSGGEKVRVLLSRMMIENSNV
FT                   LMLDEPTDHLDMESITALNTGLQKFSGVILFSSRDHEIVQTTANRIIEILPNGQMIDKM
FT                   TTYDEYLESDEMARKRTILELSSDELADD"
FT   CDS             857445..857663
FT                   /transl_table=11
FT                   /locus_tag="CIY_09280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73790"
FT                   /db_xref="UniProtKB/TrEMBL:D4J101"
FT                   /protein_id="CBK73790.1"
FT                   /translation="MYFPFYIQKNKLETKARQSKSNLKFKNRCYDTKKIADLYRWVKIL
FT                   DEWVYLWTHKSYTIIIVLSVRLQLIDS"
FT   CDS             857707..858039
FT                   /transl_table=11
FT                   /locus_tag="CIY_09290"
FT                   /product="Phage derived protein Gp49-like (DUF891)."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73791"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D4J102"
FT                   /protein_id="CBK73791.1"
FT                   /translation="MFRIDFYRTVRGDCDVEDFLEDLEKRADTNKDARIQYKQAIQYIQ
FT                   FLEDYGTQLGENVTKHLEEDIWELRPGNNRVLFFFFKDSTFVLLHHFRKNTENSSSRDR
FT                   KGKSRT"
FT   CDS             858070..858351
FT                   /transl_table=11
FT                   /locus_tag="CIY_09300"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73792"
FT                   /db_xref="GOA:D4J103"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J103"
FT                   /protein_id="CBK73792.1"
FT                   /translation="MSDWTKYKEKVRNTNPKLGRDIDEAEEISAIVGAMIQQRHNLHLS
FT                   QRELASLCGIPHSSVARIESGVSIPNLATMLKIFKQLELSFTVQPVRK"
FT   CDS             858451..860754
FT                   /transl_table=11
FT                   /locus_tag="CIY_09310"
FT                   /product="(p)ppGpp synthetase, RelA/SpoT family"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73793"
FT                   /db_xref="GOA:D4J104"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:D4J104"
FT                   /protein_id="CBK73793.1"
FT                   /translation="MSTQNKNDEEKFSQNESFESHGVIATEDFVNPDELYKELIERVRK
FT                   YHPNTDISMIEKGYLIARNAHEGQCRKSGEPYIIHPLCVAIILADLELDKETIVAGLLH
FT                   DVVEDTICTKEEIAQEFSEEVAELVDGVTKLGQLNYDADKVEIQAENLRKMFLAMAKDI
FT                   RVILIKLADRLHNMRTLKYMTPEKQKEKARETMEIYAPLAQRLGISKVKIELDDLSLKY
FT                   LEPDAYYDLVEKIALRKSQRTDYINSLVDDVRKHIDAAEIQAEVYGRAKHFFSIYKKMV
FT                   NQHKTIDQIYDLFAVRIIVDSIKDCYAALGVIHEMYTPIPGRFKDYIAMPKPNMYQSLH
FT                   TTVIGPNGAPFEIQIRTYDMHRTSEYGIAAHWKYKESGEGSSVVGEEEKLSWLREILEW
FT                   QQEISDNKEFSSLLKSDLNLFSDTVFCFTPSGDVKNLPNGSTPIDFAYSIHSAVGNRMI
FT                   GAKVNGKLVPIDYVIQNGDRIEIVTSQNTNGPSRDWLSIVKSSQAKNKINQWFRTQSKD
FT                   ENIAKGKELLLNSAKQKGVDMGEINKPKYQELIKNKYGFHSWEDTLAAVGQGAIKEGAV
FT                   INRMFTAWQKDHPVKMTDEEVLAEHSGSAEKIRPKSKNGITVSGLYDVSVRFSKCCNPV
FT                   PGDEIVGFVTRGRGVSIHRTDCINMINLPDFEKERLIEAEWAAGAEAEGRSGGVYLTEI
FT                   NIYGNNRTGLLVDITRIFTEREIDIDSIHSKTSKQGVATITIKFGTQSKEQLRALVEKI
FT                   KQVESIIDVERPRG"
FT   CDS             860755..861189
FT                   /transl_table=11
FT                   /locus_tag="CIY_09320"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73794"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4J105"
FT                   /protein_id="CBK73794.1"
FT                   /translation="MKVGKVLLPAAMENCYLAINDKTNESIIIDPGSAFDRIKSAVEQT
FT                   GTTPVAILLTHGHFDHAGEAASTAKEYGIKVYASASQERELKDPNLNLSGDMFGNSESY
FT                   SADVYLQDDEELDLAGLHIKCLYTPGHTPGGCCFYFLMKR"
FT   CDS             861252..861377
FT                   /transl_table=11
FT                   /locus_tag="CIY_09330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73795"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4J106"
FT                   /protein_id="CBK73795.1"
FT                   /translation="MSQLVNSIKSKLMTLSDDTICYPGHNEPTTIGNERLYNPFL"
FT   CDS             861374..862813
FT                   /transl_table=11
FT                   /locus_tag="CIY_09340"
FT                   /product="Coproporphyrinogen III oxidase and related Fe-S
FT                   oxidoreductases"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73796"
FT                   /db_xref="GOA:D4J107"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="UniProtKB/TrEMBL:D4J107"
FT                   /protein_id="CBK73796.1"
FT                   /translation="MIYVKLNEDNFEYDIYSLVKAFYPKEDVRIGTSPAPEDEELLFCM
FT                   EVKYEDNVLTLDGRKIEIDYSNRPDTKNRLKLAIYESLHARTGKDLPWGTLTGIRPTKI
FT                   SLGMIEEGASDEDVTAYMRSTYLTSQEKINLSLQVSHKEHQLLSKIDYDNGYSVYIGIP
FT                   FCPSTCLYCSFTSYPIGLWTKKLDDYIDALEKEMAFTAEACKGKSLTTIYIGGGTPTSL
FT                   DAEHLERLLTLVDRYFNTSDLLEYTIEAGRPDSITLEKLQVMKNHPVTRISINPQTMNQ
FT                   KTLDLIGRFHKVEDIHRVFGWARELGFKNINMDLILGLPGETIEDVAYTLSEVEKLAPD
FT                   NLTVHSLALKHSARLNYDKEAYEDYLIDNSQKHMDICLEAAKRMGMAPYYLYRQKNMAA
FT                   NLENIGYSTPGNEGLYNILIMEEKQTIMALGCGTACKFVTDHGKTVTRCENVKDVQLYM
FT                   DRIDEMIERKRERLREDLKWL"
FT   CDS             862804..864063
FT                   /transl_table=11
FT                   /locus_tag="CIY_09350"
FT                   /product="histidyl-tRNA synthetase"
FT                   /function="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73797"
FT                   /db_xref="GOA:D4J108"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniProtKB/TrEMBL:D4J108"
FT                   /protein_id="CBK73797.1"
FT                   /translation="MALNKKPVNGMKDILPYEMEVRDYVTSIIKDTYRSFGFTPIETPA
FT                   MESIGNLSNKQGGENEKLIFKVMKRGEKLNIPEAQSEEDVVDFGMRYDLTVPLCRFYSN
FT                   HANELSSPFKALQIGSVWRADRPQRGRYRQFTQCDIDILGEPSNLAEIELILATTTTLG
FT                   RIGFKNFEIRINERRILKAMAAYAGFSEEDYDSIFITLDKMDKIGLDGVSAELLEAGYS
FT                   KESIDKYVELFALLDDVKDVAAGMDVLLNKLGEFLDTEVADWMREIAAAVNATKEAQFE
FT                   LVFDPTLVRGMSYYTGTIFEIAIPEFGGSCGGGGRYDKMIGNFTGQNTPACGFSIGFER
FT                   IILLLMEQGFKVPGASKKVAYLVEKGYPAEKLAEVMSQAKAARADGQTVLVVRMNKNKK
FT                   FQKEQLTNDGYEEFVEFFNR"
FT   CDS             complement(864699..866606)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09370"
FT                   /product="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73798"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D4J109"
FT                   /protein_id="CBK73798.1"
FT                   /translation="MNIYTQVCGLVIITMLLFFYGKQPTMGLSSERKFKITLLIILGCV
FT                   LLDIASCYFIVYNRRYSPDVINVICKLYLLSLQCVAFSALGYSVSDIFEFIGSKQEKFL
FT                   AVCFQAFCVCGLIVTMYLPLNYYYDGMLLYSYGPAAILTYVLVAIYILSIIVSAFILKH
FT                   HLKEKKVYALLVWMAIWSISAIIQFLNPKLLIVSFASCIGALIMYFELENPQSSISRKT
FT                   GHFSSAVIHEYLDYLYQSKQHFSVMRISFKTVGETSDENKLLRKTIEMLSDFLFTIDSA
FT                   KVFDTAEGYFLLIFENTDFMESTKYQISTYFQAIENNSDVDKAITLLRPYYTIIPDCTI
FT                   SENADELMMLLANYVPSNHGITAKNEVIVDLDVMADVRRKKDIEKLLVDAIENNRIEVH
FT                   YQPIYDVSTETFSSAEALVRIKLIDGTYLQPNEFIPVAEITGRIIPLSDAIYRKALSFI
FT                   KSYHIERIGVNHIELNLSVKQGESPTFTSKILQMLEEFQLDPNIINLEITETNSLRSKE
FT                   SLYTNMKLLQEHGLSFSLDDFGSGSSNLNYIIDMPFTKVKLDRLLSEEYLKNSKAQAIV
FT                   NAVIEMAHSMDIKIVAEGIETEAQFEAMKALGVDYIQGFYFSKPLPEHEFLKFMQKNNL
FT                   "
FT   CDS             866869..867858
FT                   /transl_table=11
FT                   /locus_tag="CIY_09380"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /function="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73799"
FT                   /db_xref="GOA:D4J110"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="UniProtKB/TrEMBL:D4J110"
FT                   /protein_id="CBK73799.1"
FT                   /translation="MTDYMFICDWDREIGWHDARIVPEGPIEMDPACMTLHYAQETFEG
FT                   MKAYRREDGKIQIFRPEMNAKRMINSNERLCMPAFPVEDFVAAVKALVKTEEAWVPSEK
FT                   DTSLYIRPFMFATEAALGVHMAKSYKFMILCCPVGAYYATGLDPVKILVENELVRAVAG
FT                   GTGFTKCGGNYAGSIAGQVKAEKLGYSQVLWLDGNERKYVEEVGTMNIMFKIDGEIWTA
FT                   PTVGTVLPGVTRDSMIHLLRDWGYTVREERLAIDDLMKAGHDGKLEEVFGTGTAAVISP
FT                   VGELRYNDDVVVINGGKTGELTQKLYDTLTGIQWGRLPDNYGWTQLVE"
FT   CDS             867858..868148
FT                   /transl_table=11
FT                   /locus_tag="CIY_09390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73800"
FT                   /db_xref="UniProtKB/TrEMBL:D4J111"
FT                   /protein_id="CBK73800.1"
FT                   /translation="MYELEVNNDELQSLQDSFCKANDLYMICVSRKHGQLTSFSGSKPE
FT                   EDFVDSNFPESLKKEIIDSFVDGAPENIVEPASAEDYFYTEVLPSEVTRMR"
FT   CDS             868154..869611
FT                   /transl_table=11
FT                   /locus_tag="CIY_09400"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73801"
FT                   /db_xref="GOA:D4J112"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4J112"
FT                   /protein_id="CBK73801.1"
FT                   /translation="MWLCFAIDKEKTPSTMMLPSSLRTTSSAQFDKAIALIETLSKHFV
FT                   VEKLRNQKLLKQLSQTQSEEKEVENKLIKNELMTSILRLMESEESFTRVAEEILSFSGK
FT                   YIECTNTALVQMSVDGLSADMIIEWTNGDNKISPEFQNIPIKELPFMNGKPYTISSDAS
FT                   LPEAFVEFFEKYSINSGIFLPLNVDDSAAMYLCFLSINEDRQWSVDEIRFTNDVKNVLH
FT                   TILIKKITANSLAGSYSALESILQNSGYGVVVVDADKRQILYRNDTFEAMFENQIDKVA
FT                   VEELIFGKEYNLSELNGYSANGSGKWFDLSTANIKWVDSREVKLITFYDTTDIRNYQKK
FT                   AEKQAQRDSLTGLFNRQACEKDIAMEFHIAKKLDKEFAVLMFDIDDFTNMNEGLGFRIG
FT                   DDLLEFVAHSINEISSIKGKCYRIGGDEFAVLVDHENIKNLDLIIKRIMNLFENPWALG
FT                   DKEYNCTISMGGTQGTCGYFRCHSHFA"
FT   CDS             870534..871799
FT                   /transl_table=11
FT                   /locus_tag="CIY_09420"
FT                   /product="serine hydroxymethyltransferase"
FT                   /function="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73802"
FT                   /db_xref="GOA:D4J113"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:D4J113"
FT                   /protein_id="CBK73802.1"
FT                   /translation="MYTLKDIKNTDPEIAEAIVKEFNRQSEHIELIASENWVSPAVMSA
FT                   MGSVLTNKYAEGYPGKRYYGGCGEVDVVEELARERAKELFGCDYVNVQPHSGAQANMAV
FT                   QFAVLKPGDTVMGMNLDHGGHLTHGSPANFSGVYFNIVPYGVNDEGVIDYDDVERIALE
FT                   CKPKMIIAGASAYCRKIDFKRFREICDKVGAVLFVDMAHIAGLVAAGVHESPIPYADIV
FT                   TTTTHKTLRGPRGGMIMATAEANEKYNFNKAVFPGIQGGPLMHVLAGKAVCFKEALDPS
FT                   FKEYGQQIVKNAQALCKGLQNRGIKIVSDGTDNHLMLIDLTPFELTGKVVEKLLDEAHI
FT                   TANKNTIPNDPKSPFVTSGIRLGTPAATTRGLKEDDFDKVAEAISIVIKEQETGVEKAR
FT                   AIIKELTDKYPLPGEAEFRAEQ"
FT   CDS             871981..874230
FT                   /transl_table=11
FT                   /locus_tag="CIY_09430"
FT                   /product="Collagen binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73803"
FT                   /db_xref="GOA:D4J114"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:D4J114"
FT                   /protein_id="CBK73803.1"
FT                   /translation="MFNAISPNFIVQAAETDNEATETYLKSVSFTSKGKEISEGDTISL
FT                   EDGFKVEYKLKSPLYMNYEEDEKEEDQLYLSKGDELYLPAIIDTAFDLSQVESFDVKLD
FT                   DDTEFGKASITPDRQVKVDVTYEDYAKVYDVVVGLEFGLDEEAIGEKEEYTFTIPGMEP
FT                   KTLTLKIKENNPEEPKPVVPTDVTTLTKDGGEFDAEGKANWNISLGNNGVELTDVVLYD
FT                   AFVVDNNTDMDFLKNSLVITDESGEKLKADKDYELIYKKGESGVSEGGKKYTWAIKFGK
FT                   ISGEKNYQISYDTQLGSYDKYLFENHSVPANKAWVEYNYIPEEGADPAFIVGVGVYKKA
FT                   TGEGIVGKSAIDKALYSAEPALHQLTWRIVVNRNYRPLTNASVTEKLGDGQKLVSISDV
FT                   TITNTDGENQVVTMTPSKNEEGSLVFDFGDSLNNSRAVFYVVTELTDEEIPVWEADSTK
FT                   KYKNFITLQSDQQEPILDTASGRLRWKDDALEKTASVDKKTKKVSYTVNINKGKQLLPS
FT                   KLQIKDTLGKNLVLYPESVKLFIGTVDASGKVTATEELETGYKTAVSMEGDNEVLAITL
FT                   PEKADNRNVYVLKYEAIPDEIIEDGDYTNRIQLLGYGYDYSNRDKIAISYKAFGGGWIE
FT                   KHDRPKRPGEKAPTPKPSSNNKPSGNNSGSSSNPSAKPASSDVVGFGEVVISVGANTGA
FT                   NPDMTEENITAASNGANTLAKTGGFIGTVIGYMVGAVFVIAGLFMVFGKRKRIVK"
FT   CDS             874227..874820
FT                   /transl_table=11
FT                   /locus_tag="CIY_09440"
FT                   /product="LPXTG-site transpeptidase (sortase) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73804"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4J115"
FT                   /protein_id="CBK73804.1"
FT                   /translation="MRNRVILKKIIGLVFIGFGLSILFASILVNIRQQVSQKQLIEQFN
FT                   EMVQKTASSETEEEYSTLNPADEGELIYNLRIPSIDSENPVCEGTSREVLRDSLGHQTG
FT                   TAYIGENGNCVIAGHRNYTFGKFFNRLDEVRVGDIIYVDTKNDTREYRVKEIKVVEPTD
FT                   TSVLDDTENEQLTLYTCTPIYVATHRLVIISEPL"
FT   CDS             875072..875746
FT                   /transl_table=11
FT                   /locus_tag="CIY_09450"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73805"
FT                   /db_xref="GOA:D4J116"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J116"
FT                   /protein_id="CBK73805.1"
FT                   /translation="MEDYKVIEVKQSIFEDNDADAEKLRGEIKAQKTFLVNLMSAPGSG
FT                   KTTTLCQTIARLKDELRIGVMEADIDSDVDAATIQKAGARAIQIHTGGMCHLDADMTRQ
FT                   GLKEFGTEDLDIVFLENVGNLVCPAEFDTGSSKNAMILSVPEGDDKPLKYPLMFSVCDV
FT                   VLINKCDTLPVFTEFSKEAVKERIHKLNPNAHIIFVSAKTGEGFDEWVDWLRGQVDSWN
FT                   ND"
FT   CDS             875804..878587
FT                   /transl_table=11
FT                   /locus_tag="CIY_09460"
FT                   /product="NADPH-dependent glutamate synthase beta chain and
FT                   related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73806"
FT                   /db_xref="GOA:D4J117"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="UniProtKB/TrEMBL:D4J117"
FT                   /protein_id="CBK73806.1"
FT                   /translation="MGIGPDNLGDFYPDWVNDLKDEDLRPEILKLGKVITDRAKIKLGL
FT                   QKITKYDPEYWAVANLAPTKEIAELALSMGGIRKPKTFKQLLEITGLDEKTLEERLEKA
FT                   SWTGLLEWNYENEAHEKQWVLPMFVPGSAEFSNMNQDFLAEHPEMGRFFERMSRLPLEG
FT                   LTHMVPPGGAGIGMHVIPVEDAISMEQEAIGLEKISYWLDKYEGKYAKSPCSCRLSRKT
FT                   YDEGCADDPEGWCIAVGDMADYVVETNKGGVYITREEALEIFKQAEDNGFVHQITNIDG
FT                   ENKIFAICNCNVNVCYALRTSQLFNTPNMSRSAYVAHVTAEDCVACGKCVENCPAGAVK
FT                   LGQKLCTADGKQVEYPKQVLPTERKWSTDEWNDNYRDTNRINCYDTGTAPCKTACPAHI
FT                   AIQGYLRMAAQGRYKEALALIKQDNPLPAICGRVCNRRCEAACTRGTVDEAIAIDEVKR
FT                   FLAEMDLKAETRYIPKKIVPSQKGEFTEKVAIVGAGPAGLSCAYYLALKGYKPTIFEKS
FT                   NHPGGMLRYGIPSFVLENNVIDAEIEIIKELGVEIKCGVEVGKDITLDELRSQGYKAFY
FT                   VAIGCQGGNLPNVPGDKAIGTATAVDFLHECSENEAYDIKGDLVVIGGGNVAIDVARSA
FT                   RRVGNEKVSMFCLESRDIMPASPEEIEIVEAEGVELNCGWGPKEVLVDEAGAVKGIVLK
FT                   KCTRVKDETGRFNPQYDENDTITVECKHVIFSVGQRSVYGDLFKGSKVVIERGPKADAL
FT                   TYQTDEPDIFVGGDMYTGPRFAIDAIAAGREGAISIHRFVQPHSSLTIGRNRRDFIELD
FT                   KENLAIGDYDHSPRQIPGVSKTTVDGELTFRDKTVELTEEQIKIETARCLKCGASVVDE
FT                   NKCIGCGVCTTKCEFDAIKLYREHPECSKMTPSEDKLKYVLPNGLKQRVKVAFKHR"
FT   CDS             878703..879701
FT                   /transl_table=11
FT                   /locus_tag="CIY_09470"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73807"
FT                   /db_xref="GOA:D4J118"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4J118"
FT                   /protein_id="CBK73807.1"
FT                   /translation="MKDIYLFANGLAETIRTFIIAYLILTFVFTVYSIARMYYIEHRSN
FT                   DVKSGLARVKSLRSVGRFMQFPVYSMEEMAANKHKRDVKLMYFPADNPKSKRFMVVLPG
FT                   GGYAHLCTKQEGYPVAAALNRKGVNAFVLEYRTGCDCEPFAPMEDLGVALRFIQDNLDR
FT                   FNVEMEGYGLIGFSAGGNLAGIFASHKFGYLDYQLPKPGTVILGYPWTCVNDWLHHPYW
FT                   NIWIGLLGIWLSNRGSFYMFGLRHIRKGRTMLDVQKYIEADYPPTFMYSGSWDVLVPAS
FT                   RHADVFDAALTENGVKHLYEKYFGVPHGIGLGLHTKAEGWLDRAVEFWEEN"
FT   CDS             879869..880624
FT                   /transl_table=11
FT                   /locus_tag="CIY_09480"
FT                   /product="Predicted transcription factor, homolog of
FT                   eukaryotic MBF1"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73808"
FT                   /db_xref="GOA:D4J119"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J119"
FT                   /protein_id="CBK73808.1"
FT                   /translation="MLDLTKTGSFISEMRKEKGLTQKQLADLVGVSDKAVSRWETGKGL
FT                   PDTSIMPELCKALDININELLSGERLNPEAYRGKAEEIMVDLVKDVQNNSKARKAELLG
FT                   LIFGVLLLLIGLFGIMIVGGSQIVYFIDAPSFVMVLAIQLIILAAGGQIGSFVKAFKLV
FT                   FRSKSLAESELMENVAKCEYAIKIAQKAAILGGVISSIIGFVTVFAIVWRKAYDVLGPN
FT                   MAVAVLSLFYGVLFALLLIPIQGRLHNMK"
FT   CDS             complement(880891..881493)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09490"
FT                   /product="Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73809"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J120"
FT                   /protein_id="CBK73809.1"
FT                   /translation="MYPVITISREFGSGGHSIGEAVANKLNIPFYDGEIVNRVAIESGY
FT                   AKELIETQGEYTSSTAMWFDISAAGTMYFQSPQDEIFIAQKKVILECAKKGPCVIVGRC
FT                   ADYILRKEGIRCMNVMIHADMEHRKKRVLERYENIENVSIEKRLAKKDKQRKTYYKYYT
FT                   DKNWGDFREYDVILDSGSLGEETCVKTICELAEAFPE"
FT   CDS             complement(881531..882184)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73810"
FT                   /db_xref="UniProtKB/TrEMBL:D4J121"
FT                   /protein_id="CBK73810.1"
FT                   /translation="MNTVIMKMTEAYELQSFYKSINNCHILDCRSIEGTRCYLDDLAKE
FT                   TIISQLVPFSAEGIHFIDSGNYHYLSLLWLMKVDTDFNLVLFDHHPDNQPPSFGMITSC
FT                   GGWVLEATETLPHLKNVYTYGVGEEVPINDIPTDLPLYISIDKDVLSTDDAITDWDQGN
FT                   MSLTTMLDMLSQLSVNRKIIGVDICGDSGENASSGAEINNLTNATLFDFLSENY"
FT   CDS             complement(882188..883147)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09510"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73811"
FT                   /db_xref="GOA:D4J122"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D4J122"
FT                   /protein_id="CBK73811.1"
FT                   /translation="MLYLIYLGLCALEIILLLLAGMTPFEAINTGIATAGTGGFGIYSS
FT                   SIGGFNVACQWIVAIFMFIFGVNFNFYYYVLFHHARDAFRMEEVRMYSLLTLISIGIIT
FT                   VNTLSCSAGLFDALTKAAFQVTSIQSSTGFSTADFAAWPQTSRCVLVLLMFIGACAGST
FT                   GGGIKVSRFILMGKAVHKELISYIHPRSVRKTLMDGKPVTHDTVRSNNVFFGTFMLVFF
FT                   VSAFILSFENLDFSTIFTAVIACMSNIGPGLSMVGPTKNFLFFTDLSKIILIIDMLAGR
FT                   LELFPILMLFHPNIWQDLFAKRRLKELKHAGKVLNEDF"
FT   CDS             complement(883135..883689)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73812"
FT                   /db_xref="UniProtKB/TrEMBL:D4J123"
FT                   /protein_id="CBK73812.1"
FT                   /translation="MNTSIIRFILLYVVGFIGLFLLLPVIVALIYHENVWSNYLVVAIP
FT                   CIIAGIINSYLKPKESSFYLKEGFFCTGAAWVILSALGAIPLWLSNEIPHYIDALFETV
FT                   SGFTTTGASILENVEALSHASLFWRSFTHLVGGMGVLVFLLSVIPLAGGDGSFNLMKAE
FT                   SPGPSVGKLVPKLKIQLRCFI"
FT   CDS             complement(883696..885084)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09530"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73813"
FT                   /db_xref="GOA:D4J124"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J124"
FT                   /protein_id="CBK73813.1"
FT                   /translation="MLFNSSQKRGLKIIIVGCGKVGRTLVDRLSNEGHDIVVIDQNQDR
FT                   IDNLTNLYDIMGIQGNGASYSIQLEAGIKDADLIIAVTNSDELNLLCCTIAKQVGDCAS
FT                   IARVRNPDYSKEISYLQEKLGLVMIINPEFEAAREISSILSLPSTLEVSSFAHGQAEMV
FT                   EFKIEEGNILNGLAIKNLNSNTSGKVLITAVKRGSEVIIPTGDFVLQTNDIVCAVGARR
FT                   FARTFLNEIGFKTRQVKDCLIVGGGKASFYLAKLLLQARINVRIIERNKERCEELSIAL
FT                   PKATIINGDGGDESLLHEEGIEYVESFVPLTGIDEENILLTLYANQVSNAKVVTKVNRI
FT                   NFDNVLSQLNLGSVVYPRHITAESIIAYVRAKSASGDGNDILTLYHLFDRKVEAIEFNI
FT                   KEKSNATGVPFSVLQFKDNVLIAFINRNGTIIIPSGSDTIEVGDTVMVVTTHTGFGTIL
FT                   DTLR"
FT   CDS             complement(885208..885666)
FT                   /transl_table=11
FT                   /locus_tag="CIY_09540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73814"
FT                   /db_xref="UniProtKB/TrEMBL:D4J125"
FT                   /protein_id="CBK73814.1"
FT                   /translation="MSISVTNSLSLRLYYGRYSPLVKGSQRNDATKGTLSFADASALRN
FT                   AVRKLQDYSFSDATDEHVQEKLTAFADAVNNTISSGAKYASNSTSVKNAVSKIKSLNKE
FT                   YASQLQKIGITVTKDGSLSVYESASKNYSKEKFDNFFDKDSKYLKLPL"
FT   CDS             885820..887367
FT                   /transl_table=11
FT                   /locus_tag="CIY_09550"
FT                   /product="GMP synthase (glutamine-hydrolyzing), C-terminal
FT                   domain or B subunit/GMP synthase (glutamine-hydrolyzing),
FT                   N-terminal domain or A subunit"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:CIY_09550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK73815"
FT                   /db_xref="GOA:D4J126"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4J126"
FT                   /protein_id="