
EBI Dbfetch

ID   FP929032; SV 1; linear; genomic DNA; STD; PRO; 3763317 BP.
AC   FP929032;
PR   Project:PRJNA45913;
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
DE   Alistipes shahii WAL 8301 draft genome.
KW   .
OS   Alistipes shahii WAL 8301
OC   Bacteria; Bacteroidetes; Bacteroidia; Bacteroidales; Rikenellaceae;
OC   Alistipes.
RN   [1]
RG   metaHIT consortium --
RA   Pajon A., Turner K., Parkhill J.;
RT   "The genome sequence of Alistipes shahii WAL 8301";
RL   Unpublished.
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
DR   MD5; 25a998a3690484ad88c85711360f7c4e.
DR   BioSample; SAMEA3138370.
DR   EnsemblGenomes-Gn; AL1_R_07740.
DR   EnsemblGenomes-Gn; AL1_R_07750.
DR   EnsemblGenomes-Gn; AL1_R_07760.
DR   EnsemblGenomes-Gn; AL1_T_00640.
DR   EnsemblGenomes-Gn; AL1_T_07100.
DR   EnsemblGenomes-Gn; AL1_T_07110.
DR   EnsemblGenomes-Gn; AL1_T_07120.
DR   EnsemblGenomes-Gn; AL1_T_07130.
DR   EnsemblGenomes-Gn; AL1_T_07140.
DR   EnsemblGenomes-Gn; AL1_T_07150.
DR   EnsemblGenomes-Gn; AL1_T_07160.
DR   EnsemblGenomes-Gn; AL1_T_07170.
DR   EnsemblGenomes-Gn; AL1_T_07180.
DR   EnsemblGenomes-Gn; AL1_T_07720.
DR   EnsemblGenomes-Gn; AL1_T_07730.
DR   EnsemblGenomes-Gn; AL1_T_11190.
DR   EnsemblGenomes-Gn; AL1_T_12170.
DR   EnsemblGenomes-Gn; AL1_T_14680.
DR   EnsemblGenomes-Gn; AL1_T_14690.
DR   EnsemblGenomes-Gn; AL1_T_19490.
DR   EnsemblGenomes-Gn; AL1_T_19500.
DR   EnsemblGenomes-Gn; AL1_T_19510.
DR   EnsemblGenomes-Gn; AL1_T_19520.
DR   EnsemblGenomes-Gn; AL1_T_19530.
DR   EnsemblGenomes-Gn; AL1_T_21170.
DR   EnsemblGenomes-Gn; AL1_T_26920.
DR   EnsemblGenomes-Gn; AL1_T_26930.
DR   EnsemblGenomes-Gn; AL1_T_26940.
DR   EnsemblGenomes-Gn; AL1_T_26950.
DR   EnsemblGenomes-Gn; AL1_T_26960.
DR   EnsemblGenomes-Gn; AL1_T_26970.
DR   EnsemblGenomes-Gn; AL1_T_26980.
DR   EnsemblGenomes-Gn; AL1_T_26990.
DR   EnsemblGenomes-Gn; AL1_T_27000.
DR   EnsemblGenomes-Gn; AL1_T_27010.
DR   EnsemblGenomes-Gn; AL1_T_27020.
DR   EnsemblGenomes-Gn; AL1_T_27030.
DR   EnsemblGenomes-Gn; AL1_T_27040.
DR   EnsemblGenomes-Gn; AL1_T_27530.
DR   EnsemblGenomes-Gn; AL1_T_29340.
DR   EnsemblGenomes-Gn; AL1_T_32520.
DR   EnsemblGenomes-Gn; AL1_T_32530.
DR   EnsemblGenomes-Gn; AL1_T_32540.
DR   EnsemblGenomes-Gn; AL1_T_32550.
DR   EnsemblGenomes-Gn; AL1_T_32560.
DR   EnsemblGenomes-Gn; AL1_T_32570.
DR   EnsemblGenomes-Tr; AL1_R_07740.
DR   EnsemblGenomes-Tr; AL1_R_07750.
DR   EnsemblGenomes-Tr; AL1_R_07760.
DR   EnsemblGenomes-Tr; AL1_T_00640.
DR   EnsemblGenomes-Tr; AL1_T_07100.
DR   EnsemblGenomes-Tr; AL1_T_07110.
DR   EnsemblGenomes-Tr; AL1_T_07120.
DR   EnsemblGenomes-Tr; AL1_T_07130.
DR   EnsemblGenomes-Tr; AL1_T_07140.
DR   EnsemblGenomes-Tr; AL1_T_07150.
DR   EnsemblGenomes-Tr; AL1_T_07160.
DR   EnsemblGenomes-Tr; AL1_T_07170.
DR   EnsemblGenomes-Tr; AL1_T_07180.
DR   EnsemblGenomes-Tr; AL1_T_07720.
DR   EnsemblGenomes-Tr; AL1_T_07730.
DR   EnsemblGenomes-Tr; AL1_T_11190.
DR   EnsemblGenomes-Tr; AL1_T_12170.
DR   EnsemblGenomes-Tr; AL1_T_14680.
DR   EnsemblGenomes-Tr; AL1_T_14690.
DR   EnsemblGenomes-Tr; AL1_T_19490.
DR   EnsemblGenomes-Tr; AL1_T_19500.
DR   EnsemblGenomes-Tr; AL1_T_19510.
DR   EnsemblGenomes-Tr; AL1_T_19520.
DR   EnsemblGenomes-Tr; AL1_T_19530.
DR   EnsemblGenomes-Tr; AL1_T_21170.
DR   EnsemblGenomes-Tr; AL1_T_26920.
DR   EnsemblGenomes-Tr; AL1_T_26930.
DR   EnsemblGenomes-Tr; AL1_T_26940.
DR   EnsemblGenomes-Tr; AL1_T_26950.
DR   EnsemblGenomes-Tr; AL1_T_26960.
DR   EnsemblGenomes-Tr; AL1_T_26970.
DR   EnsemblGenomes-Tr; AL1_T_26980.
DR   EnsemblGenomes-Tr; AL1_T_26990.
DR   EnsemblGenomes-Tr; AL1_T_27000.
DR   EnsemblGenomes-Tr; AL1_T_27010.
DR   EnsemblGenomes-Tr; AL1_T_27020.
DR   EnsemblGenomes-Tr; AL1_T_27030.
DR   EnsemblGenomes-Tr; AL1_T_27040.
DR   EnsemblGenomes-Tr; AL1_T_27530.
DR   EnsemblGenomes-Tr; AL1_T_29340.
DR   EnsemblGenomes-Tr; AL1_T_32520.
DR   EnsemblGenomes-Tr; AL1_T_32530.
DR   EnsemblGenomes-Tr; AL1_T_32540.
DR   EnsemblGenomes-Tr; AL1_T_32550.
DR   EnsemblGenomes-Tr; AL1_T_32560.
DR   EnsemblGenomes-Tr; AL1_T_32570.
DR   EuropePMC; PMC3386201; 22761886.
DR   EuropePMC; PMC3558960; 23408657.
DR   EuropePMC; PMC3764931; 24019990.
DR   EuropePMC; PMC4149002; 25197494.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01705; Flavo-1.
DR   RFAM; RF01726; SAM-II_long_loops.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; FP929032.
DR   SILVA-SSU; FP929032.
DR   StrainInfo; 689450; 1.
CC   This is a reference genome for the metaHIT project
CC   DNA source: German Collection of Microorganisms and Cell Cultures --
CC   Sequencing technology: 454
CC   Genome coverage: 22x
CC   Annotation was added using ab initio prediction IMG/ER --
CC (Markowitz, Szeto et al. 2007).
FH   Key             Location/Qualifiers
FT   source          1..3763317
FT                   /organism="Alistipes shahii WAL 8301"
FT                   /strain="WAL 8301"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:717959"
FT   CDS             complement(<1..174)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62756"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIJ4"
FT                   /protein_id="CBK62756.1"
FT                   MLWEVSGGRAKGR"
FT   gap             3562..3928
FT                   /estimated_length=367
FT   CDS             6120..8423
FT                   /transl_table=11
FT                   /locus_tag="AL1_00130"
FT                   /product="penicillin-binding protein 1C"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62757"
FT                   /db_xref="GOA:D4IIJ5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIJ5"
FT                   /protein_id="CBK62757.1"
FT                   DEHGASRSVAFSCR"
FT   gap             9682..9970
FT                   /estimated_length=289
FT   CDS             13210..14613
FT                   /transl_table=11
FT                   /locus_tag="AL1_00180"
FT                   /product="Arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62758"
FT                   /db_xref="GOA:D4IIJ6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIJ6"
FT                   /protein_id="CBK62758.1"
FT                   PAEWRVTKP"
FT   CDS             complement(14682..18617)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00190"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62759"
FT                   /db_xref="GOA:D4IIJ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIJ7"
FT                   /protein_id="CBK62759.1"
FT   CDS             complement(20408..22453)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00210"
FT                   /product="Heparinase II/III-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62760"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIJ8"
FT                   /protein_id="CBK62760.1"
FT   CDS             complement(22464..24401)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00220"
FT                   /product="Heparinase II/III-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62761"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIJ9"
FT                   /protein_id="CBK62761.1"
FT                   TFTVTLSPNE"
FT   CDS             complement(24476..26497)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62762"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK0"
FT                   /protein_id="CBK62762.1"
FT   CDS             complement(27014..28837)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00250"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62763"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK1"
FT                   /protein_id="CBK62763.1"
FT   CDS             complement(28843..32118)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00260"
FT                   /product="TonB-dependent Receptor Plug Domain./TonB
FT                   dependent receptor."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62764"
FT                   /db_xref="GOA:D4IIK2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK2"
FT                   /protein_id="CBK62764.1"
FT   CDS             complement(32133..33266)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00270"
FT                   /product="Glycosyl Hydrolase Family 88."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62765"
FT                   /db_xref="GOA:D4IIK3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK3"
FT                   /protein_id="CBK62765.1"
FT   CDS             33569..35614
FT                   /transl_table=11
FT                   /locus_tag="AL1_00280"
FT                   /product="Polysaccharide lyase family 8, N terminal
FT                   alpha-helical domain./Polysaccharide lyase family 8,
FT                   super-sandwich domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62766"
FT                   /db_xref="GOA:D4IIK4"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012329"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK4"
FT                   /protein_id="CBK62766.1"
FT   CDS             complement(35690..36544)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00290"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62767"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK5"
FT                   /protein_id="CBK62767.1"
FT                   HIQ"
FT   CDS             36783..36890
FT                   /transl_table=11
FT                   /locus_tag="AL1_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62768"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK6"
FT                   /protein_id="CBK62768.1"
FT   CDS             36980..38647
FT                   /transl_table=11
FT                   /locus_tag="AL1_00310"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62769"
FT                   /db_xref="GOA:D4IIK7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK7"
FT                   /protein_id="CBK62769.1"
FT   CDS             38879..40948
FT                   /transl_table=11
FT                   /locus_tag="AL1_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62770"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL1"
FT                   /protein_id="CBK62770.1"
FT   CDS             40971..44012
FT                   /transl_table=11
FT                   /locus_tag="AL1_00330"
FT                   /product="Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62771"
FT                   /db_xref="GOA:D4IIL2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL2"
FT                   /protein_id="CBK62771.1"
FT   CDS             44025..45704
FT                   /transl_table=11
FT                   /locus_tag="AL1_00340"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62772"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL3"
FT                   /protein_id="CBK62772.1"
FT   gap             45739..46852
FT                   /estimated_length=1114
FT   CDS             46857..48077
FT                   /transl_table=11
FT                   /locus_tag="AL1_00350"
FT                   /product="Metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62773"
FT                   /db_xref="GOA:D4IIL4"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL4"
FT                   /protein_id="CBK62773.1"
FT                   ELNFFYE"
FT   CDS             48081..50243
FT                   /transl_table=11
FT                   /locus_tag="AL1_00360"
FT                   /product="Fibrobacter succinogenes major domain
FT                   (Fib_succ_major)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62774"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL5"
FT                   /protein_id="CBK62774.1"
FT   CDS             50306..53755
FT                   /transl_table=11
FT                   /locus_tag="AL1_00370"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62775"
FT                   /db_xref="GOA:D4IIL6"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL6"
FT                   /protein_id="CBK62775.1"
FT   CDS             53760..55952
FT                   /transl_table=11
FT                   /locus_tag="AL1_00380"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62776"
FT                   /db_xref="GOA:D4IIL7"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL7"
FT                   /protein_id="CBK62776.1"
FT   CDS             58500..59513
FT                   /transl_table=11
FT                   /locus_tag="AL1_00410"
FT                   /product="Domain of unknown function (DUF1814)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62777"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL8"
FT                   /protein_id="CBK62777.1"
FT   CDS             59768..60259
FT                   /transl_table=11
FT                   /locus_tag="AL1_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62778"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL9"
FT                   /protein_id="CBK62778.1"
FT                   "
FT   CDS             60473..60778
FT                   /transl_table=11
FT                   /locus_tag="AL1_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62779"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM0"
FT                   /protein_id="CBK62779.1"
FT   CDS             62172..63029
FT                   /transl_table=11
FT                   /locus_tag="AL1_00450"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62780"
FT                   /db_xref="GOA:D4IIM1"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM1"
FT                   /protein_id="CBK62780.1"
FT                   FTRT"
FT   CDS             63298..63666
FT                   /transl_table=11
FT                   /locus_tag="AL1_00460"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62781"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM2"
FT                   /protein_id="CBK62781.1"
FT                   AAIVTAIEKLLKQICDGR"
FT   CDS             63656..64726
FT                   /transl_table=11
FT                   /locus_tag="AL1_00470"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62782"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM3"
FT                   /protein_id="CBK62782.1"
FT                   HRRRMEEQKRRAKIKL"
FT   CDS             64751..65509
FT                   /transl_table=11
FT                   /locus_tag="AL1_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62783"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM4"
FT                   /protein_id="CBK62783.1"
FT   CDS             complement(65760..67955)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00490"
FT                   /product="Glycoside hydrolase 97."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62784"
FT                   /db_xref="GOA:D4IIM6"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019563"
FT                   /db_xref="InterPro:IPR029483"
FT                   /db_xref="InterPro:IPR029486"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM6"
FT                   /protein_id="CBK62784.1"
FT   CDS             complement(70054..71361)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00510"
FT                   /product="Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62785"
FT                   /db_xref="GOA:D4IIM7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM7"
FT                   /protein_id="CBK62785.1"
FT   CDS             complement(71402..73720)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00520"
FT                   /product="Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62786"
FT                   /db_xref="GOA:D4IIM8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM8"
FT                   /protein_id="CBK62786.1"
FT   CDS             complement(73828..75642)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62787"
FT                   /db_xref="InterPro:IPR025970"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM9"
FT                   /protein_id="CBK62787.1"
FT   CDS             complement(75666..77324)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00540"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62788"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN0"
FT                   /protein_id="CBK62788.1"
FT   CDS             complement(77338..80259)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00550"
FT                   /product="Outer membrane receptor for ferrienterochelin and
FT                   colicins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62789"
FT                   /db_xref="GOA:D4IIN1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN1"
FT                   /protein_id="CBK62789.1"
FT   CDS             81952..83337
FT                   /transl_table=11
FT                   /locus_tag="AL1_00570"
FT                   /product="Putative regulator of cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62790"
FT                   /db_xref="GOA:D4IIN2"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN2"
FT                   /protein_id="CBK62790.1"
FT                   PLL"
FT   CDS             83339..84091
FT                   /transl_table=11
FT                   /locus_tag="AL1_00580"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62791"
FT                   /db_xref="GOA:D4IIN3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN3"
FT                   /protein_id="CBK62791.1"
FT   CDS             complement(84466..87069)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00590"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62792"
FT                   /db_xref="GOA:D4IIN4"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN4"
FT                   /protein_id="CBK62792.1"
FT   tRNA            complement(88933..89017)
FT                   /locus_tag="AL1_T_00640"
FT   CDS             complement(89087..89701)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00620"
FT                   /product="Lipoprotein signal peptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62793"
FT                   /db_xref="GOA:D4IIN5"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN5"
FT                   /protein_id="CBK62793.1"
FT   CDS             89836..91920
FT                   /transl_table=11
FT                   /locus_tag="AL1_00630"
FT                   /product="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62794"
FT                   /db_xref="GOA:D4IIN6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN6"
FT                   /protein_id="CBK62794.1"
FT                   "
FT   CDS             complement(92730..93125)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62795"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN7"
FT                   /protein_id="CBK62795.1"
FT   CDS             complement(93812..94363)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62796"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK8"
FT                   /protein_id="CBK62796.1"
FT   CDS             94530..95111
FT                   /transl_table=11
FT                   /locus_tag="AL1_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62797"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIK9"
FT                   /protein_id="CBK62797.1"
FT   CDS             96623..96757
FT                   /transl_table=11
FT                   /locus_tag="AL1_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62798"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIL0"
FT                   /protein_id="CBK62798.1"
FT   gap             99001..99421
FT                   /estimated_length=421
FT   CDS             complement(99909..101138)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00730"
FT                   /product="transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62799"
FT                   /db_xref="GOA:D4IIM5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR028620"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIM5"
FT                   /protein_id="CBK62799.1"
FT                   VVEILKAEFE"
FT   CDS             complement(101165..101632)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00740"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62800"
FT                   /db_xref="GOA:D4IIN8"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN8"
FT                   /protein_id="CBK62800.1"
FT   CDS             complement(101761..102555)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00750"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62801"
FT                   /db_xref="GOA:D4IIN9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIN9"
FT                   /protein_id="CBK62801.1"
FT   CDS             complement(102561..103952)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00760"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase /3-hydroxyacyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /function="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /function="3-hydroxyacyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="3.5.1.-"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62802"
FT                   /db_xref="GOA:D4IIP0"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP0"
FT                   /protein_id="CBK62802.1"
FT                   VKNKK"
FT   CDS             104039..104842
FT                   /transl_table=11
FT                   /locus_tag="AL1_00770"
FT                   /product="TonB family C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62803"
FT                   /db_xref="GOA:D4IIP1"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP1"
FT                   /protein_id="CBK62803.1"
FT   CDS             105124..105519
FT                   /transl_table=11
FT                   /locus_tag="AL1_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP2"
FT                   /protein_id="CBK62804.1"
FT   CDS             105617..106111
FT                   /transl_table=11
FT                   /locus_tag="AL1_00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62805"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP3"
FT                   /protein_id="CBK62805.1"
FT                   A"
FT   CDS             complement(107704..108030)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62806"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP4"
FT                   /protein_id="CBK62806.1"
FT                   RPGP"
FT   CDS             108029..109681
FT                   /transl_table=11
FT                   /locus_tag="AL1_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62807"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP5"
FT                   /protein_id="CBK62807.1"
FT   CDS             109943..110977
FT                   /transl_table=11
FT                   /locus_tag="AL1_00830"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62808"
FT                   /db_xref="GOA:D4IIP6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP6"
FT                   /protein_id="CBK62808.1"
FT                   RKHA"
FT   CDS             111008..111172
FT                   /transl_table=11
FT                   /locus_tag="AL1_00840"
FT                   /product="twin arginine-targeting protein translocase,
FT                   TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62809"
FT                   /db_xref="GOA:D4IIP7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP7"
FT                   /protein_id="CBK62809.1"
FT                   VDNIEKNIK"
FT   CDS             111218..112678
FT                   /transl_table=11
FT                   /locus_tag="AL1_00850"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62810"
FT                   /db_xref="GOA:D4IIP8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP8"
FT                   /protein_id="CBK62810.1"
FT   CDS             112720..113595
FT                   /transl_table=11
FT                   /locus_tag="AL1_00860"
FT                   /product="Domain of Unknown Function (DUF1080)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62811"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIP9"
FT                   /protein_id="CBK62811.1"
FT                   FRNIRVKILD"
FT   CDS             113656..114516
FT                   /transl_table=11
FT                   /locus_tag="AL1_00870"
FT                   /product="Xylose isomerase-like TIM barrel."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62812"
FT                   /db_xref="GOA:D4IIQ0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ0"
FT                   /protein_id="CBK62812.1"
FT                   FFRDK"
FT   tRNA            complement(114739..114815)
FT                   /locus_tag="AL1_T_07180"
FT   CDS             115086..115190
FT                   /transl_table=11
FT                   /locus_tag="AL1_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62813"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ1"
FT                   /protein_id="CBK62813.1"
FT   CDS             complement(115348..116379)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00900"
FT                   /product="Pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62814"
FT                   /db_xref="GOA:D4IIQ2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ2"
FT                   /protein_id="CBK62814.1"
FT                   EVE"
FT   CDS             118633..120246
FT                   /transl_table=11
FT                   /locus_tag="AL1_00920"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62815"
FT                   /db_xref="GOA:D4IIQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ3"
FT                   /protein_id="CBK62815.1"
FT   CDS             complement(120330..121124)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00930"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62816"
FT                   /db_xref="GOA:D4IIQ4"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ4"
FT                   /protein_id="CBK62816.1"
FT   CDS             complement(121155..121997)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00940"
FT                   /product="5-keto 4-deoxyuronate isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62817"
FT                   /db_xref="GOA:D4IIQ5"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027447"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ5"
FT                   /protein_id="CBK62817.1"
FT   CDS             complement(122197..122868)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00950"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62818"
FT                   /db_xref="GOA:D4IIQ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ6"
FT                   /protein_id="CBK62818.1"
FT                   R"
FT   CDS             123013..123297
FT                   /transl_table=11
FT                   /locus_tag="AL1_00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62819"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ7"
FT                   /protein_id="CBK62819.1"
FT   CDS             123415..125004
FT                   /transl_table=11
FT                   /locus_tag="AL1_00970"
FT                   /product="phage uncharacterized protein (putative large
FT                   terminase), C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62820"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ8"
FT                   /protein_id="CBK62820.1"
FT                   RGQKRVRGIRFL"
FT   CDS             125148..126227
FT                   /transl_table=11
FT                   /locus_tag="AL1_00980"
FT                   /product="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62821"
FT                   /db_xref="GOA:D4IIQ9"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIQ9"
FT                   /protein_id="CBK62821.1"
FT   CDS             complement(126305..127177)
FT                   /transl_table=11
FT                   /locus_tag="AL1_00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62822"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR0"
FT                   /protein_id="CBK62822.1"
FT                   LKLVYAAAK"
FT   CDS             complement(127223..128245)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01000"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /function="O-sialoglycoprotein endopeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62823"
FT                   /db_xref="GOA:D4IIR1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR1"
FT                   /protein_id="CBK62823.1"
FT                   "
FT   gap             130787..131118
FT                   /estimated_length=332
FT   CDS             133489..134109
FT                   /transl_table=11
FT                   /locus_tag="AL1_01030"
FT                   /product="outer membrane transport energization protein
FT                   ExbB (TC 2.C.1.1.1)"
FT                   /function="outer membrane transport energization protein
FT                   ExbB (TC 2.C.1.1.1)"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62824"
FT                   /db_xref="GOA:D4IIR2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR2"
FT                   /protein_id="CBK62824.1"
FT   CDS             134116..134523
FT                   /transl_table=11
FT                   /locus_tag="AL1_01040"
FT                   /product="Biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62825"
FT                   /db_xref="GOA:D4IIR3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR3"
FT                   /protein_id="CBK62825.1"
FT   CDS             134673..135317
FT                   /transl_table=11
FT                   /locus_tag="AL1_01050"
FT                   /product="TonB family C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62826"
FT                   /db_xref="GOA:D4IIR4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR4"
FT                   /protein_id="CBK62826.1"
FT   CDS             135425..135865
FT                   /transl_table=11
FT                   /locus_tag="AL1_01060"
FT                   /product="Protein of unknown function (DUF1573)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62827"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR5"
FT                   /protein_id="CBK62827.1"
FT   CDS             136047..137333
FT                   /transl_table=11
FT                   /locus_tag="AL1_01070"
FT                   /product="Cytosine deaminase and related metal-dependent
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62828"
FT                   /db_xref="GOA:D4IIR6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR6"
FT                   /protein_id="CBK62828.1"
FT   CDS             137440..137949
FT                   /transl_table=11
FT                   /locus_tag="AL1_01080"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /function="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62829"
FT                   /db_xref="GOA:D4IIR7"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR7"
FT                   /protein_id="CBK62829.1"
FT                   ARELAK"
FT   CDS             complement(138014..138853)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01090"
FT                   /product="Short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62830"
FT                   /db_xref="GOA:D4IIR8"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR8"
FT                   /protein_id="CBK62830.1"
FT   CDS             complement(138950..139729)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01100"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62831"
FT                   /db_xref="GOA:D4IIR9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIR9"
FT                   /protein_id="CBK62831.1"
FT   CDS             complement(140313..143453)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01120"
FT                   /product="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62832"
FT                   /db_xref="GOA:D4IIS0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS0"
FT                   /protein_id="CBK62832.1"
FT   CDS             complement(143469..144482)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01130"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62833"
FT                   /db_xref="GOA:D4IIS1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS1"
FT                   /protein_id="CBK62833.1"
FT   CDS             complement(145731..147056)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01150"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62834"
FT                   /db_xref="GOA:D4IIS2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS2"
FT                   /protein_id="CBK62834.1"
FT   CDS             complement(147141..147776)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01160"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62835"
FT                   /db_xref="GOA:D4IIS3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS3"
FT                   /protein_id="CBK62835.1"
FT   CDS             149745..151781
FT                   /transl_table=11
FT                   /locus_tag="AL1_01180"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62836"
FT                   /db_xref="GOA:D4IIS4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS4"
FT                   /protein_id="CBK62836.1"
FT   CDS             152741..153937
FT                   /transl_table=11
FT                   /locus_tag="AL1_01200"
FT                   /product="Highly conserved protein containing a thioredoxin
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62837"
FT                   /db_xref="GOA:D4IIS5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS5"
FT                   /protein_id="CBK62837.1"
FT   CDS             153974..156868
FT                   /transl_table=11
FT                   /locus_tag="AL1_01210"
FT                   /product="Heparinase II/III-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62838"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS6"
FT                   /protein_id="CBK62838.1"
FT   CDS             159025..162177
FT                   /transl_table=11
FT                   /locus_tag="AL1_01230"
FT                   /product="Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62839"
FT                   /db_xref="GOA:D4IIS7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS7"
FT                   /protein_id="CBK62839.1"
FT                   TF"
FT   CDS             162191..163834
FT                   /transl_table=11
FT                   /locus_tag="AL1_01240"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62840"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS8"
FT                   /protein_id="CBK62840.1"
FT   CDS             complement(163936..165072)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62841"
FT                   /db_xref="InterPro:IPR025975"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIS9"
FT                   /protein_id="CBK62841.1"
FT   CDS             complement(165089..167092)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01260"
FT                   /product="Heparinase II/III-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62842"
FT                   /db_xref="GOA:D4IIT0"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT0"
FT                   /protein_id="CBK62842.1"
FT   CDS             complement(167098..167967)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01270"
FT                   /product="Heparinase II/III-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62843"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT1"
FT                   /protein_id="CBK62843.1"
FT                   NGTKYNLK"
FT   CDS             complement(168077..168697)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62844"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT2"
FT                   /protein_id="CBK62844.1"
FT   CDS             complement(168694..169122)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62845"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT3"
FT                   /protein_id="CBK62845.1"
FT   CDS             complement(169106..169597)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT4"
FT                   /protein_id="CBK62846.1"
FT                   "
FT   CDS             complement(169986..170996)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01320"
FT                   /product="Retron-type reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62847"
FT                   /db_xref="GOA:D4IIT5"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT5"
FT                   /protein_id="CBK62847.1"
FT   CDS             complement(171242..171607)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62848"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT6"
FT                   /protein_id="CBK62848.1"
FT                   FPRKVTMRASGTRYYFE"
FT   CDS             complement(171684..172853)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62849"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT7"
FT                   /protein_id="CBK62849.1"
FT   CDS             complement(173017..173286)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62850"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT8"
FT                   /protein_id="CBK62850.1"
FT   CDS             complement(173364..176282)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62851"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIT9"
FT                   /protein_id="CBK62851.1"
FT   CDS             complement(176267..177475)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01370"
FT                   /product="Phage tail protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62852"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU0"
FT                   /protein_id="CBK62852.1"
FT                   NKL"
FT   CDS             complement(177477..177995)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU1"
FT                   /protein_id="CBK62853.1"
FT                   VIRKTTKTY"
FT   CDS             complement(178000..181938)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62854"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU2"
FT                   /protein_id="CBK62854.1"
FT   CDS             complement(182165..182746)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62855"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU3"
FT                   /protein_id="CBK62855.1"
FT   CDS             complement(182821..183357)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62856"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU4"
FT                   /protein_id="CBK62856.1"
FT                   KKITATLMTAADVQA"
FT   CDS             complement(183369..183782)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62857"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU5"
FT                   /protein_id="CBK62857.1"
FT   CDS             complement(183794..184183)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62858"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU6"
FT                   /protein_id="CBK62858.1"
FT   CDS             complement(184177..184488)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62859"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU7"
FT                   /protein_id="CBK62859.1"
FT   CDS             complement(184540..185643)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01460"
FT                   /product="Phage major capsid protein E."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62860"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU8"
FT                   /protein_id="CBK62860.1"
FT   CDS             complement(185661..186242)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62861"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIU9"
FT                   /protein_id="CBK62861.1"
FT   CDS             complement(186261..186980)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62862"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV0"
FT                   /protein_id="CBK62862.1"
FT                   QAKAAEAANKGLGGKEV"
FT   CDS             188073..188672
FT                   /transl_table=11
FT                   /locus_tag="AL1_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62863"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV1"
FT                   /protein_id="CBK62863.1"
FT   CDS             188674..189198
FT                   /transl_table=11
FT                   /locus_tag="AL1_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62864"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV2"
FT                   /protein_id="CBK62864.1"
FT                   LKLLSKTKEPF"
FT   CDS             complement(189316..189507)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62865"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV3"
FT                   /protein_id="CBK62865.1"
FT                   QAETDAMAEDDDTDEKKE"
FT   CDS             complement(189504..191201)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62866"
FT                   /db_xref="GOA:D4IIV4"
FT                   /db_xref="InterPro:IPR003540"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV4"
FT                   /protein_id="CBK62866.1"
FT   CDS             complement(191201..191656)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62867"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV5"
FT                   /protein_id="CBK62867.1"
FT   CDS             complement(191683..193173)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01540"
FT                   /product="Phage portal protein, SPP1 Gp6-like."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62868"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV6"
FT                   /protein_id="CBK62868.1"
FT   CDS             complement(193199..194662)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01550"
FT                   /product="phage uncharacterized protein (putative large
FT                   terminase), C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62869"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV7"
FT                   /protein_id="CBK62869.1"
FT   CDS             complement(194659..195177)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62870"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV8"
FT                   /protein_id="CBK62870.1"
FT                   AELEKKLDK"
FT   CDS             complement(195185..196756)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62871"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIV9"
FT                   /protein_id="CBK62871.1"
FT                   GDDLPQ"
FT   CDS             complement(196762..197052)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62872"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW0"
FT                   /protein_id="CBK62872.1"
FT   CDS             complement(197152..197517)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01590"
FT                   /product="VRR-NUC domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62873"
FT                   /db_xref="GOA:D4IIW1"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW1"
FT                   /protein_id="CBK62873.1"
FT                   LEDFQQVIRAYIPHLCW"
FT   CDS             complement(197678..198058)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62874"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW2"
FT                   /protein_id="CBK62874.1"
FT   CDS             complement(198838..199431)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62875"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW3"
FT                   /protein_id="CBK62875.1"
FT   CDS             complement(199437..199739)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62876"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW4"
FT                   /protein_id="CBK62876.1"
FT   CDS             complement(199920..200462)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62877"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW5"
FT                   /protein_id="CBK62877.1"
FT                   SAVTIDFAIIHFTKRRY"
FT   CDS             complement(200717..201010)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62878"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW6"
FT                   /protein_id="CBK62878.1"
FT   CDS             complement(201022..201444)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01660"
FT                   /product="single stranded DNA-binding protein (ssb)"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62879"
FT                   /db_xref="GOA:D4IIW7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW7"
FT                   /protein_id="CBK62879.1"
FT   CDS             complement(201998..203623)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01670"
FT                   /product="Site-specific DNA methylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62880"
FT                   /db_xref="GOA:D4IIW8"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW8"
FT                   /protein_id="CBK62880.1"
FT   CDS             complement(203656..204231)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01680"
FT                   /product="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62881"
FT                   /db_xref="GOA:D4IIW9"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR025518"
FT                   /db_xref="InterPro:IPR027269"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIW9"
FT                   /protein_id="CBK62881.1"
FT   CDS             complement(204240..204743)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01690"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62882"
FT                   /db_xref="GOA:D4IIX0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX0"
FT                   /protein_id="CBK62882.1"
FT                   SYRK"
FT   CDS             complement(204817..205539)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62883"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX1"
FT                   /protein_id="CBK62883.1"
FT                   RLGAVPGGTSKKKYTDTL"
FT   CDS             complement(205598..206344)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62884"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX2"
FT                   /protein_id="CBK62884.1"
FT   CDS             complement(206351..206620)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01720"
FT                   /product="Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62885"
FT                   /db_xref="GOA:D4IIX3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX3"
FT                   /protein_id="CBK62885.1"
FT   CDS             complement(206632..207063)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62886"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX4"
FT                   /protein_id="CBK62886.1"
FT   CDS             complement(207070..207603)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62887"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX5"
FT                   /protein_id="CBK62887.1"
FT                   QFEGLYNDFLLIKK"
FT   CDS             complement(207608..208009)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62888"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX6"
FT                   /protein_id="CBK62888.1"
FT   CDS             complement(208011..208751)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01760"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62889"
FT                   /db_xref="GOA:D4IIX7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX7"
FT                   /protein_id="CBK62889.1"
FT   CDS             complement(208757..208987)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62890"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX8"
FT                   /protein_id="CBK62890.1"
FT   CDS             complement(208989..209774)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62891"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIX9"
FT                   /protein_id="CBK62891.1"
FT   CDS             complement(209797..210099)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62892"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY0"
FT                   /protein_id="CBK62892.1"
FT   CDS             complement(210111..212150)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62893"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY1"
FT                   /protein_id="CBK62893.1"
FT   CDS             complement(212157..212462)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62894"
FT                   /db_xref="InterPro:IPR024363"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY2"
FT                   /protein_id="CBK62894.1"
FT   CDS             complement(212465..212671)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62895"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY3"
FT                   /protein_id="CBK62895.1"
FT   CDS             complement(213079..213309)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62896"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY4"
FT                   /protein_id="CBK62896.1"
FT   CDS             complement(213306..213596)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62897"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY5"
FT                   /protein_id="CBK62897.1"
FT   CDS             214015..214404
FT                   /transl_table=11
FT                   /locus_tag="AL1_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62898"
FT                   /db_xref="GOA:D4IIY6"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY6"
FT                   /protein_id="CBK62898.1"
FT   CDS             214575..214766
FT                   /transl_table=11
FT                   /locus_tag="AL1_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62899"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY7"
FT                   /protein_id="CBK62899.1"
FT                   KTAFEMMLMSFENGRKEA"
FT   gap             215496..215839
FT                   /estimated_length=344
FT   CDS             complement(216762..217907)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62900"
FT                   /db_xref="GOA:D4IIY8"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY8"
FT                   /protein_id="CBK62900.1"
FT   CDS             218180..219583
FT                   /transl_table=11
FT                   /locus_tag="AL1_01900"
FT                   /product="Arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62901"
FT                   /db_xref="GOA:D4IIY9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIY9"
FT                   /protein_id="CBK62901.1"
FT                   LRPFAETRN"
FT   CDS             221298..222941
FT                   /transl_table=11
FT                   /locus_tag="AL1_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62902"
FT                   /db_xref="GOA:D4IIZ0"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ0"
FT                   /protein_id="CBK62902.1"
FT   CDS             222945..223880
FT                   /transl_table=11
FT                   /locus_tag="AL1_01930"
FT                   /product="glucokinase"
FT                   /function="glucokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62903"
FT                   /db_xref="GOA:D4IIZ1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ1"
FT                   /protein_id="CBK62903.1"
FT   gap             224034..224220
FT                   /estimated_length=187
FT   CDS             226629..228221
FT                   /transl_table=11
FT                   /locus_tag="AL1_01970"
FT                   /product="Predicted periplasmic ligand-binding sensor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62904"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ2"
FT                   /protein_id="CBK62904.1"
FT                   VKDETSPPAGISP"
FT   CDS             228221..230659
FT                   /transl_table=11
FT                   /locus_tag="AL1_01980"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62905"
FT                   /db_xref="GOA:D4IIZ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ3"
FT                   /protein_id="CBK62905.1"
FT                   "
FT   CDS             complement(230740..231681)
FT                   /transl_table=11
FT                   /locus_tag="AL1_01990"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62906"
FT                   /db_xref="GOA:D4IIZ4"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ4"
FT                   /protein_id="CBK62906.1"
FT   CDS             complement(231843..232439)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02000"
FT                   /product="ribosome biogenesis GTP-binding protein
FT                   YsxC/EngB"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62907"
FT                   /db_xref="GOA:D4IIZ5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ5"
FT                   /protein_id="CBK62907.1"
FT   gap             232511..233031
FT                   /estimated_length=521
FT   CDS             234016..235059
FT                   /transl_table=11
FT                   /locus_tag="AL1_02020"
FT                   /product="penicillin amidase . Cysteine peptidase. MEROPS
FT                   family C59"
FT                   /function="penicillin amidase . Cysteine peptidase. MEROPS
FT                   family C59"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62908"
FT                   /db_xref="GOA:D4IIZ6"
FT                   /db_xref="InterPro:IPR003199"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ6"
FT                   /protein_id="CBK62908.1"
FT                   FVFLFGV"
FT   CDS             complement(235198..236646)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02030"
FT                   /product="Lipid A 3-O-deacylase (PagL)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62909"
FT                   /db_xref="GOA:D4IIZ7"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR017690"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ7"
FT                   /protein_id="CBK62909.1"
FT   CDS             236954..237292
FT                   /transl_table=11
FT                   /locus_tag="AL1_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62910"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ8"
FT                   /protein_id="CBK62910.1"
FT                   LIAWRYLR"
FT   gap             237335..237747
FT                   /estimated_length=413
FT   CDS             complement(237817..239211)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02050"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62911"
FT                   /db_xref="GOA:D4IIZ9"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIZ9"
FT                   /protein_id="CBK62911.1"
FT                   LRILGY"
FT   CDS             240133..241356
FT                   /transl_table=11
FT                   /locus_tag="AL1_02070"
FT                   /product="transcriptional regulator"
FT                   /function="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62912"
FT                   /db_xref="GOA:D4IJ00"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ00"
FT                   /protein_id="CBK62912.1"
FT                   ELGIEDNS"
FT   CDS             241934..242428
FT                   /transl_table=11
FT                   /locus_tag="AL1_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62913"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ01"
FT                   /protein_id="CBK62913.1"
FT                   I"
FT   CDS             242435..242800
FT                   /transl_table=11
FT                   /locus_tag="AL1_02100"
FT                   /product="protein translocase, SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62914"
FT                   /db_xref="GOA:D4IJ02"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ02"
FT                   /protein_id="CBK62914.1"
FT                   PQAEIPSAGQTEQQQAE"
FT   CDS             complement(243155..244816)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62915"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ03"
FT                   /protein_id="CBK62915.1"
FT   CDS             245354..245611
FT                   /transl_table=11
FT                   /locus_tag="AL1_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62916"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ04"
FT                   /protein_id="CBK62916.1"
FT   CDS             248495..249958
FT                   /transl_table=11
FT                   /locus_tag="AL1_02140"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62917"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ05"
FT                   /protein_id="CBK62917.1"
FT   CDS             249980..251494
FT                   /transl_table=11
FT                   /locus_tag="AL1_02150"
FT                   /product="O-Glycosyl hydrolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62918"
FT                   /db_xref="GOA:D4IJ06"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ06"
FT                   /protein_id="CBK62918.1"
FT   CDS             251514..253577
FT                   /transl_table=11
FT                   /locus_tag="AL1_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62919"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ07"
FT                   /protein_id="CBK62919.1"
FT   CDS             253656..255968
FT                   /transl_table=11
FT                   /locus_tag="AL1_02170"
FT                   /product="Beta-glucosidase-related glycosidases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62920"
FT                   /db_xref="GOA:D4IJ08"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR026892"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ08"
FT                   /protein_id="CBK62920.1"
FT                   PRPLTGRGLFHCSVRMR"
FT   CDS             256036..256158
FT                   /transl_table=11
FT                   /locus_tag="AL1_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62921"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ09"
FT                   /protein_id="CBK62921.1"
FT   CDS             complement(256573..257373)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02190"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62922"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ10"
FT                   /protein_id="CBK62922.1"
FT   CDS             complement(257569..258156)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02200"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62923"
FT                   /db_xref="GOA:D4IJ11"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ11"
FT                   /protein_id="CBK62923.1"
FT   CDS             258256..258837
FT                   /transl_table=11
FT                   /locus_tag="AL1_02210"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /function="Holliday junction DNA helicase subunit RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62924"
FT                   /db_xref="GOA:D4IJ12"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ12"
FT                   /protein_id="CBK62924.1"
FT   CDS             258862..259134
FT                   /transl_table=11
FT                   /locus_tag="AL1_02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62925"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ13"
FT                   /protein_id="CBK62925.1"
FT   CDS             259882..261459
FT                   /transl_table=11
FT                   /locus_tag="AL1_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62926"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ14"
FT                   /protein_id="CBK62926.1"
FT                   IYIEPDGK"
FT   CDS             261663..261902
FT                   /transl_table=11
FT                   /locus_tag="AL1_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62927"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ15"
FT                   /protein_id="CBK62927.1"
FT   gap             262768..263242
FT                   /estimated_length=475
FT   gap             265381..265887
FT                   /estimated_length=507
FT   CDS             266106..266426
FT                   /transl_table=11
FT                   /locus_tag="AL1_02290"
FT                   /product="Membrane transporters of cations and cationic
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62928"
FT                   /db_xref="GOA:D4IJ16"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ16"
FT                   /protein_id="CBK62928.1"
FT                   VH"
FT   CDS             complement(266423..267301)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02300"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62929"
FT                   /db_xref="GOA:D4IJ17"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ17"
FT                   /protein_id="CBK62929.1"
FT                   ILYGMWRAERA"
FT   gap             268293..268486
FT                   /estimated_length=194
FT   CDS             270870..271268
FT                   /transl_table=11
FT                   /locus_tag="AL1_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62930"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ18"
FT                   /protein_id="CBK62930.1"
FT   CDS             271265..271858
FT                   /transl_table=11
FT                   /locus_tag="AL1_02340"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62931"
FT                   /db_xref="GOA:D4IJ19"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ19"
FT                   /protein_id="CBK62931.1"
FT   CDS             271848..272663
FT                   /transl_table=11
FT                   /locus_tag="AL1_02350"
FT                   /product="Dihydropteroate synthase"
FT                   /function="Dihydropteroate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62932"
FT                   /db_xref="GOA:D4IJ20"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ20"
FT                   /protein_id="CBK62932.1"
FT   CDS             272660..273328
FT                   /transl_table=11
FT                   /locus_tag="AL1_02360"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62933"
FT                   /db_xref="GOA:D4IJ21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ21"
FT                   /protein_id="CBK62933.1"
FT                   "
FT   CDS             273330..274316
FT                   /transl_table=11
FT                   /locus_tag="AL1_02370"
FT                   /product="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62934"
FT                   /db_xref="GOA:D4IJ22"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ22"
FT                   /protein_id="CBK62934.1"
FT   CDS             274313..275086
FT                   /transl_table=11
FT                   /locus_tag="AL1_02380"
FT                   /product="conserved hypothetical protein TIGR02757"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62935"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ23"
FT                   /protein_id="CBK62935.1"
FT   CDS             275163..275843
FT                   /transl_table=11
FT                   /locus_tag="AL1_02390"
FT                   /product="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62936"
FT                   /db_xref="GOA:D4IJ24"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ24"
FT                   /protein_id="CBK62936.1"
FT                   YLKF"
FT   CDS             275896..276789
FT                   /transl_table=11
FT                   /locus_tag="AL1_02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62937"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ25"
FT                   /protein_id="CBK62937.1"
FT                   VFEFGRTINVALPRRK"
FT   CDS             276797..277453
FT                   /transl_table=11
FT                   /locus_tag="AL1_02410"
FT                   /product="Predicted DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62938"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ26"
FT                   /protein_id="CBK62938.1"
FT   CDS             complement(277450..277782)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02420"
FT                   /product="Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62939"
FT                   /db_xref="GOA:D4IJ27"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ27"
FT                   /protein_id="CBK62939.1"
FT                   EQVMQP"
FT   CDS             complement(277792..278796)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02430"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62940"
FT                   /db_xref="GOA:D4IJ28"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ28"
FT                   /protein_id="CBK62940.1"
FT   gap             278886..279188
FT                   /estimated_length=303
FT   CDS             complement(279239..280606)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02440"
FT                   /product="DNA replication and repair protein RadA"
FT                   /function="DNA replication and repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62941"
FT                   /db_xref="GOA:D4IJ29"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ29"
FT                   /protein_id="CBK62941.1"
FT   CDS             complement(280615..281202)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62942"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ30"
FT                   /protein_id="CBK62942.1"
FT   CDS             complement(281199..281840)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02460"
FT                   /product="Uncharacterised ACR, YkgG family COG1556."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62943"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ31"
FT                   /protein_id="CBK62943.1"
FT   CDS             complement(283178..284335)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02480"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /function="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62944"
FT                   /db_xref="GOA:D4IJ32"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ32"
FT                   /protein_id="CBK62944.1"
FT   CDS             complement(284343..285209)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02490"
FT                   /product="Membrane-bound metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62945"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ33"
FT                   /protein_id="CBK62945.1"
FT                   PEGYIVF"
FT   CDS             285376..286251
FT                   /transl_table=11
FT                   /locus_tag="AL1_02500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62946"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ34"
FT                   /protein_id="CBK62946.1"
FT                   EGKYPRNLWA"
FT   gap             286700..286974
FT                   /estimated_length=275
FT   CDS             complement(287031..287420)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62947"
FT                   /db_xref="InterPro:IPR016769"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ35"
FT                   /protein_id="CBK62947.1"
FT   CDS             complement(287423..289879)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02530"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62948"
FT                   /db_xref="GOA:D4IJ36"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ36"
FT                   /protein_id="CBK62948.1"
FT                   AHKVKR"
FT   CDS             complement(289889..290686)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02540"
FT                   /product="Periplasmic protein involved in polysaccharide
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62949"
FT                   /db_xref="GOA:D4IJ37"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ37"
FT                   /protein_id="CBK62949.1"
FT   CDS             290850..291512
FT                   /transl_table=11
FT                   /locus_tag="AL1_02550"
FT                   /product="beta-phosphoglucomutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62950"
FT                   /db_xref="GOA:D4IJ38"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ38"
FT                   /protein_id="CBK62950.1"
FT   CDS             291584..293866
FT                   /transl_table=11
FT                   /locus_tag="AL1_02560"
FT                   /product="maltose phosphorylase"
FT                   /function="maltose phosphorylase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62951"
FT                   /db_xref="GOA:D4IJ39"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ39"
FT                   /protein_id="CBK62951.1"
FT                   VIMNCEL"
FT   CDS             293899..295134
FT                   /transl_table=11
FT                   /locus_tag="AL1_02570"
FT                   /product="Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62952"
FT                   /db_xref="GOA:D4IJ40"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ40"
FT                   /protein_id="CBK62952.1"
FT                   DMAPWSYRILCN"
FT   gap             296131..297040
FT                   /estimated_length=910
FT   CDS             complement(297052..299412)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62953"
FT                   /db_xref="GOA:D4IJ41"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ41"
FT                   /protein_id="CBK62953.1"
FT   CDS             300750..302630
FT                   /transl_table=11
FT                   /locus_tag="AL1_02610"
FT                   /product="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62954"
FT                   /db_xref="GOA:D4IJ42"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ42"
FT                   /protein_id="CBK62954.1"
FT   CDS             302665..305529
FT                   /transl_table=11
FT                   /locus_tag="AL1_02620"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /function="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62955"
FT                   /db_xref="GOA:D4IJ43"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ43"
FT                   /protein_id="CBK62955.1"
FT   CDS             305543..306070
FT                   /transl_table=11
FT                   /locus_tag="AL1_02630"
FT                   /product="Shikimate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62956"
FT                   /db_xref="GOA:D4IJ44"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ44"
FT                   /protein_id="CBK62956.1"
FT                   VEHIVQTFSDRG"
FT   CDS             306982..309711
FT                   /transl_table=11
FT                   /locus_tag="AL1_02650"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62957"
FT                   /db_xref="GOA:D4IJ45"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ45"
FT                   /protein_id="CBK62957.1"
FT   CDS             309919..310413
FT                   /transl_table=11
FT                   /locus_tag="AL1_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62958"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ46"
FT                   /protein_id="CBK62958.1"
FT                   R"
FT   CDS             310514..311437
FT                   /transl_table=11
FT                   /locus_tag="AL1_02670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62959"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ47"
FT                   /protein_id="CBK62959.1"
FT   gap             311522..311949
FT                   /estimated_length=428
FT   CDS             312382..312927
FT                   /transl_table=11
FT                   /locus_tag="AL1_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62960"
FT                   /db_xref="InterPro:IPR017690"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ48"
FT                   /protein_id="CBK62960.1"
FT                   FFYATVGFSIRWHRMKGR"
FT   CDS             313198..313644
FT                   /transl_table=11
FT                   /locus_tag="AL1_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62961"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ49"
FT                   /protein_id="CBK62961.1"
FT   gap             313740..314037
FT                   /estimated_length=298
FT   CDS             316929..318275
FT                   /transl_table=11
FT                   /locus_tag="AL1_02710"
FT                   /product="Tetratricopeptide repeat."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62962"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ50"
FT                   /protein_id="CBK62962.1"
FT   CDS             complement(318535..319581)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02720"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62963"
FT                   /db_xref="GOA:D4IJ51"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ51"
FT                   /protein_id="CBK62963.1"
FT                   SVSGRIAR"
FT   CDS             321062..322474
FT                   /transl_table=11
FT                   /locus_tag="AL1_02740"
FT                   /product="D-glucuronate isomerase"
FT                   /function="D-glucuronate isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62964"
FT                   /db_xref="GOA:D4IJ52"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR023177"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ52"
FT                   /protein_id="CBK62964.1"
FT                   ICYRNAKDYFKF"
FT   CDS             322516..323508
FT                   /transl_table=11
FT                   /locus_tag="AL1_02750"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62965"
FT                   /db_xref="GOA:D4IJ53"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ53"
FT                   /protein_id="CBK62965.1"
FT   gap             324128..324447
FT                   /estimated_length=320
FT   CDS             324638..326062
FT                   /transl_table=11
FT                   /locus_tag="AL1_02780"
FT                   /product="Nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62966"
FT                   /db_xref="GOA:D4IJ54"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ54"
FT                   /protein_id="CBK62966.1"
FT                   IVMKTLVPKYKPIVLD"
FT   CDS             326082..327539
FT                   /transl_table=11
FT                   /locus_tag="AL1_02790"
FT                   /product="Mannitol-1-phosphate/altronate dehydrogenases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62967"
FT                   /db_xref="GOA:D4IJ55"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ55"
FT                   /protein_id="CBK62967.1"
FT   CDS             327677..329167
FT                   /transl_table=11
FT                   /locus_tag="AL1_02800"
FT                   /product="D-altronate dehydratase"
FT                   /function="D-altronate dehydratase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62968"
FT                   /db_xref="GOA:D4IJ56"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ56"
FT                   /protein_id="CBK62968.1"
FT   CDS             329192..330172
FT                   /transl_table=11
FT                   /locus_tag="AL1_02810"
FT                   /product="Pectin methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62969"
FT                   /db_xref="GOA:D4IJ57"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR018040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ57"
FT                   /protein_id="CBK62969.1"
FT   CDS             complement(330295..331617)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02820"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62970"
FT                   /db_xref="GOA:D4IJ58"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ58"
FT                   /protein_id="CBK62970.1"
FT   CDS             332060..333253
FT                   /transl_table=11
FT                   /locus_tag="AL1_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62971"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ59"
FT                   /protein_id="CBK62971.1"
FT   CDS             333288..333398
FT                   /transl_table=11
FT                   /locus_tag="AL1_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62972"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ60"
FT                   /protein_id="CBK62972.1"
FT   CDS             333474..333722
FT                   /transl_table=11
FT                   /locus_tag="AL1_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62973"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ61"
FT                   /protein_id="CBK62973.1"
FT   CDS             334107..335474
FT                   /transl_table=11
FT                   /locus_tag="AL1_02860"
FT                   /product="pseudouridine synthase family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62974"
FT                   /db_xref="GOA:D4IJ62"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ62"
FT                   /protein_id="CBK62974.1"
FT   CDS             complement(335538..337010)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02870"
FT                   /product="Clostripain family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62975"
FT                   /db_xref="InterPro:IPR005077"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ63"
FT                   /protein_id="CBK62975.1"
FT   CDS             complement(337007..337744)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62976"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ64"
FT                   /protein_id="CBK62976.1"
FT   CDS             complement(337773..338627)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02890"
FT                   /product="dihydrodipicolinate synthase"
FT                   /function="dihydrodipicolinate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62977"
FT                   /db_xref="GOA:D4IJ65"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ65"
FT                   /protein_id="CBK62977.1"
FT                   DLR"
FT   CDS             complement(338733..340757)
FT                   /transl_table=11
FT                   /locus_tag="AL1_02900"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62978"
FT                   /db_xref="GOA:D4IJ66"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ66"
FT                   /protein_id="CBK62978.1"
FT   CDS             341252..341860
FT                   /transl_table=11
FT                   /locus_tag="AL1_02920"
FT                   /product="Leucine Rich Repeat."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62979"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ67"
FT                   /protein_id="CBK62979.1"
FT   CDS             342094..343359
FT                   /transl_table=11
FT                   /locus_tag="AL1_02930"
FT                   /product="Adenylosuccinate synthetase"
FT                   /function="Adenylosuccinate synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62980"
FT                   /db_xref="GOA:D4IJ68"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ68"
FT                   /protein_id="CBK62980.1"
FT   CDS             344546..345580
FT                   /transl_table=11
FT                   /locus_tag="AL1_02950"
FT                   /product="Electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62981"
FT                   /db_xref="GOA:D4IJ69"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ69"
FT                   /protein_id="CBK62981.1"
FT                   QNSK"
FT   CDS             345583..346296
FT                   /transl_table=11
FT                   /locus_tag="AL1_02960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62982"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ70"
FT                   /protein_id="CBK62982.1"
FT                   IEFTPKQEPTNLKNN"
FT   CDS             346356..348023
FT                   /transl_table=11
FT                   /locus_tag="AL1_02970"
FT                   /product="Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62983"
FT                   /db_xref="GOA:D4IJ71"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020964"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ71"
FT                   /protein_id="CBK62983.1"
FT   CDS             349407..349961
FT                   /transl_table=11
FT                   /locus_tag="AL1_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62984"
FT                   /db_xref="GOA:D4IJ72"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR017690"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ72"
FT                   /protein_id="CBK62984.1"
FT   CDS             complement(350045..351028)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03000"
FT                   /product="L-glutaminase"
FT                   /function="L-glutaminase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62985"
FT                   /db_xref="GOA:D4IJ73"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ73"
FT                   /protein_id="CBK62985.1"
FT   CDS             complement(351176..352642)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03010"
FT                   /product="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62986"
FT                   /db_xref="GOA:D4IJ74"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR022520"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ74"
FT                   /protein_id="CBK62986.1"
FT   CDS             352839..353777
FT                   /transl_table=11
FT                   /locus_tag="AL1_03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ75"
FT                   /protein_id="CBK62987.1"
FT   CDS             354108..354587
FT                   /transl_table=11
FT                   /locus_tag="AL1_03030"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62988"
FT                   /db_xref="GOA:D4IJ76"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ76"
FT                   /protein_id="CBK62988.1"
FT   CDS             complement(354819..355154)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03040"
FT                   /product="Protein of unknown function (DUF1469)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62989"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ77"
FT                   /protein_id="CBK62989.1"
FT                   REELQKK"
FT   CDS             complement(355176..355385)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62990"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ78"
FT                   /protein_id="CBK62990.1"
FT   CDS             355454..355963
FT                   /transl_table=11
FT                   /locus_tag="AL1_03060"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62991"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ79"
FT                   /protein_id="CBK62991.1"
FT                   EPTLFG"
FT   CDS             complement(356310..357218)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62992"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ80"
FT                   /protein_id="CBK62992.1"
FT   CDS             complement(357336..358571)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03080"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62993"
FT                   /db_xref="GOA:D4IJ81"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011403"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ81"
FT                   /protein_id="CBK62993.1"
FT                   EEYDFHKILNWK"
FT   CDS             complement(358723..358923)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03090"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /function="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62994"
FT                   /db_xref="GOA:D4IJ82"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ82"
FT                   /protein_id="CBK62994.1"
FT   CDS             359063..359359
FT                   /transl_table=11
FT                   /locus_tag="AL1_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62995"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ83"
FT                   /protein_id="CBK62995.1"
FT   CDS             359363..360436
FT                   /transl_table=11
FT                   /locus_tag="AL1_03110"
FT                   /product="Predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62996"
FT                   /db_xref="GOA:D4IJ84"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR026404"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ84"
FT                   /protein_id="CBK62996.1"
FT                   HLRGDDGELLYCHYRRL"
FT   CDS             complement(360441..361106)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03120"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62997"
FT                   /db_xref="GOA:D4IJ85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ85"
FT                   /protein_id="CBK62997.1"
FT   CDS             complement(361093..361413)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62998"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ86"
FT                   /protein_id="CBK62998.1"
FT                   AR"
FT   tRNA            361734..361811
FT                   /locus_tag="AL1_T_07100"
FT   tRNA            361877..361950
FT                   /locus_tag="AL1_T_07110"
FT   CDS             complement(362249..362890)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03150"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK62999"
FT                   /db_xref="GOA:D4IJ87"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ87"
FT                   /protein_id="CBK62999.1"
FT   gap             363743..364176
FT                   /estimated_length=434
FT   CDS             complement(364256..365470)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03170"
FT                   /product="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63000"
FT                   /db_xref="GOA:D4IJ88"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ88"
FT                   /protein_id="CBK63000.1"
FT                   LKRLP"
FT   CDS             complement(365649..366410)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03180"
FT                   /product="3-oxo-5-alpha-steroid 4-dehydrogenase."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63001"
FT                   /db_xref="GOA:D4IJ89"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR016636"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ89"
FT                   /protein_id="CBK63001.1"
FT   gap             366455..366878
FT                   /estimated_length=424
FT   CDS             complement(366989..368404)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03190"
FT                   /product="glutamate decarboxylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63002"
FT                   /db_xref="GOA:D4IJ90"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ90"
FT                   /protein_id="CBK63002.1"
FT                   ENKEHQKGKVYTH"
FT   CDS             368500..369231
FT                   /transl_table=11
FT                   /locus_tag="AL1_03200"
FT                   /product="NAD-dependent protein deacetylases, SIR2 family"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63003"
FT                   /db_xref="GOA:D4IJ91"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ91"
FT                   /protein_id="CBK63003.1"
FT   CDS             369508..369609
FT                   /transl_table=11
FT                   /locus_tag="AL1_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63004"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ92"
FT                   /protein_id="CBK63004.1"
FT   gap             369801..370883
FT                   /estimated_length=1083
FT   CDS             371035..371334
FT                   /transl_table=11
FT                   /locus_tag="AL1_03220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63005"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ93"
FT                   /protein_id="CBK63005.1"
FT   CDS             371383..371700
FT                   /transl_table=11
FT                   /locus_tag="AL1_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63006"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ94"
FT                   /protein_id="CBK63006.1"
FT                   S"
FT   CDS             371706..372143
FT                   /transl_table=11
FT                   /locus_tag="AL1_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63007"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ95"
FT                   /protein_id="CBK63007.1"
FT   gap             372223..373210
FT                   /estimated_length=988
FT   CDS             complement(373826..374002)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03270"
FT                   /product="Histone H1-like protein Hc1."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63008"
FT                   /db_xref="GOA:D4IJ96"
FT                   /db_xref="InterPro:IPR010886"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ96"
FT                   /protein_id="CBK63008.1"
FT                   KEFRKTSLAAAAK"
FT   CDS             complement(374194..374535)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63009"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ97"
FT                   /protein_id="CBK63009.1"
FT                   HRRQWNLEL"
FT   gap             375145..375417
FT                   /estimated_length=273
FT   CDS             complement(375426..375827)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63010"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ98"
FT                   /protein_id="CBK63010.1"
FT   CDS             376432..378381
FT                   /transl_table=11
FT                   /locus_tag="AL1_03300"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63011"
FT                   /db_xref="GOA:D4IJ99"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJ99"
FT                   /protein_id="CBK63011.1"
FT                   EPDTRMPEEMKTAA"
FT   CDS             378453..378884
FT                   /transl_table=11
FT                   /locus_tag="AL1_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63012"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA0"
FT                   /protein_id="CBK63012.1"
FT   CDS             378901..379890
FT                   /transl_table=11
FT                   /locus_tag="AL1_03320"
FT                   /product="Antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63013"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA1"
FT                   /protein_id="CBK63013.1"
FT   CDS             complement(379887..380354)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63014"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA2"
FT                   /protein_id="CBK63014.1"
FT   CDS             380801..381850
FT                   /transl_table=11
FT                   /locus_tag="AL1_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63015"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA3"
FT                   /protein_id="CBK63015.1"
FT                   KLRDTTNPK"
FT   CDS             381971..382465
FT                   /transl_table=11
FT                   /locus_tag="AL1_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63016"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA4"
FT                   /protein_id="CBK63016.1"
FT                   Q"
FT   CDS             382661..383026
FT                   /transl_table=11
FT                   /locus_tag="AL1_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63017"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA5"
FT                   /protein_id="CBK63017.1"
FT                   RTAWKWDGQPLRCSWYA"
FT   CDS             383183..383500
FT                   /transl_table=11
FT                   /locus_tag="AL1_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63018"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA6"
FT                   /protein_id="CBK63018.1"
FT                   K"
FT   CDS             complement(383510..383743)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63019"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA7"
FT                   /protein_id="CBK63019.1"
FT   CDS             384151..384453
FT                   /transl_table=11
FT                   /locus_tag="AL1_03410"
FT                   /product="Plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63020"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA8"
FT                   /protein_id="CBK63020.1"
FT   misc_RNA        complement(384737..384813)
FT                   /locus_tag="AL1_07190"
FT                   /product="Group II catalytic intron"
FT   CDS             complement(384929..386641)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03430"
FT                   /product="Retron-type reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63021"
FT                   /db_xref="GOA:D4IJA9"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR024937"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJA9"
FT                   /protein_id="CBK63021.1"
FT   CDS             complement(387259..387555)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63022"
FT                   /db_xref="InterPro:IPR025408"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB0"
FT                   /protein_id="CBK63022.1"
FT   CDS             complement(387699..387944)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63023"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB1"
FT                   /protein_id="CBK63023.1"
FT   gap             388109..389254
FT                   /estimated_length=1146
FT   CDS             complement(389451..389687)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03460"
FT                   /product="Protein of unknown function (DUF3408)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63024"
FT                   /db_xref="InterPro:IPR021823"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB2"
FT                   /protein_id="CBK63024.1"
FT   CDS             complement(390544..391299)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03480"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63025"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB3"
FT                   /protein_id="CBK63025.1"
FT   CDS             391816..392235
FT                   /transl_table=11
FT                   /locus_tag="AL1_03490"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63026"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB4"
FT                   /protein_id="CBK63026.1"
FT   CDS             394953..395408
FT                   /transl_table=11
FT                   /locus_tag="AL1_03530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63027"
FT                   /db_xref="InterPro:IPR025219"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB5"
FT                   /protein_id="CBK63027.1"
FT   CDS             complement(395536..396597)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03540"
FT                   /product="Bacterial regulatory proteins, luxR family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63028"
FT                   /db_xref="GOA:D4IJB6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB6"
FT                   /protein_id="CBK63028.1"
FT                   EEHHRQEEFSAMR"
FT   CDS             396892..398121
FT                   /transl_table=11
FT                   /locus_tag="AL1_03550"
FT                   /product="Protein of unknown function (DUF3575)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63029"
FT                   /db_xref="InterPro:IPR021958"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB7"
FT                   /protein_id="CBK63029.1"
FT                   NYNEKKGGRQ"
FT   CDS             399057..400205
FT                   /transl_table=11
FT                   /locus_tag="AL1_03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63030"
FT                   /db_xref="InterPro:IPR025049"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB8"
FT                   /protein_id="CBK63030.1"
FT   CDS             complement(400394..400651)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63031"
FT                   /db_xref="GOA:D4IJB9"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJB9"
FT                   /protein_id="CBK63031.1"
FT   CDS             complement(401006..401416)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03600"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63032"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC0"
FT                   /protein_id="CBK63032.1"
FT   CDS             401704..402033
FT                   /transl_table=11
FT                   /locus_tag="AL1_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63033"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC1"
FT                   /protein_id="CBK63033.1"
FT                   LRKGK"
FT   CDS             complement(402058..402240)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63034"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC2"
FT                   /protein_id="CBK63034.1"
FT                   IFQPHFQLDRFIRLV"
FT   CDS             complement(402409..402831)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03630"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63035"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC3"
FT                   /protein_id="CBK63035.1"
FT   CDS             complement(403128..403505)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03640"
FT                   /product="Protein of unknown function (DUF3408)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63036"
FT                   /db_xref="InterPro:IPR021823"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC4"
FT                   /protein_id="CBK63036.1"
FT   CDS             404249..404560
FT                   /transl_table=11
FT                   /locus_tag="AL1_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63037"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC5"
FT                   /protein_id="CBK63037.1"
FT   CDS             404567..404926
FT                   /transl_table=11
FT                   /locus_tag="AL1_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63038"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC6"
FT                   /protein_id="CBK63038.1"
FT                   LDGCYREARTRPEEL"
FT   CDS             complement(405448..405840)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63039"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC7"
FT                   /protein_id="CBK63039.1"
FT   CDS             complement(405879..406439)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC8"
FT                   /protein_id="CBK63040.1"
FT   CDS             complement(407286..408521)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03690"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63041"
FT                   /db_xref="GOA:D4IJC9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJC9"
FT                   /protein_id="CBK63041.1"
FT                   LEKMEKEICDAI"
FT   gap             408789..410387
FT                   /estimated_length=1599
FT   CDS             complement(411359..412483)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03710"
FT                   /product="methylmalonyl-CoA mutase metallochaperone MeaB"
FT                   /function="methylmalonyl-CoA mutase metallochaperone MeaB"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63042"
FT                   /db_xref="GOA:D4IJD0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD0"
FT                   /protein_id="CBK63042.1"
FT   CDS             complement(412490..412954)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63043"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD1"
FT                   /protein_id="CBK63043.1"
FT   CDS             complement(412969..413199)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63044"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD2"
FT                   /protein_id="CBK63044.1"
FT   CDS             414642..416207
FT                   /transl_table=11
FT                   /locus_tag="AL1_03760"
FT                   /product="Acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63045"
FT                   /db_xref="GOA:D4IJD3"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD3"
FT                   /protein_id="CBK63045.1"
FT                   NIPL"
FT   CDS             416238..416558
FT                   /transl_table=11
FT                   /locus_tag="AL1_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63046"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD4"
FT                   /protein_id="CBK63046.1"
FT                   RR"
FT   CDS             416595..417056
FT                   /transl_table=11
FT                   /locus_tag="AL1_03780"
FT                   /product="Acetyl/propionyl-CoA carboxylase, alpha subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63047"
FT                   /db_xref="GOA:D4IJD5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD5"
FT                   /protein_id="CBK63047.1"
FT   CDS             418426..418977
FT                   /transl_table=11
FT                   /locus_tag="AL1_03800"
FT                   /product="Gram-negative bacterial tonB protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63048"
FT                   /db_xref="GOA:D4IJD6"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD6"
FT                   /protein_id="CBK63048.1"
FT   CDS             421907..422713
FT                   /transl_table=11
FT                   /locus_tag="AL1_03850"
FT                   /product="translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63049"
FT                   /db_xref="GOA:D4IJD7"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD7"
FT                   /protein_id="CBK63049.1"
FT   gap             422904..423910
FT                   /estimated_length=1007
FT   CDS             complement(423982..425511)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03860"
FT                   /product="phosphoglycerate mutase"
FT                   /function="phosphoglycerate mutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63050"
FT                   /db_xref="GOA:D4IJD8"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD8"
FT                   /protein_id="CBK63050.1"
FT   gap             425661..426008
FT                   /estimated_length=348
FT   CDS             complement(426079..428700)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03870"
FT                   /product="alanyl-tRNA synthetase"
FT                   /function="alanyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63051"
FT                   /db_xref="GOA:D4IJD9"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJD9"
FT                   /protein_id="CBK63051.1"
FT                   LN"
FT   CDS             428800..429822
FT                   /transl_table=11
FT                   /locus_tag="AL1_03880"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63052"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE0"
FT                   /protein_id="CBK63052.1"
FT                   "
FT   CDS             429824..430774
FT                   /transl_table=11
FT                   /locus_tag="AL1_03890"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63053"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE1"
FT                   /protein_id="CBK63053.1"
FT   gap             431392..431812
FT                   /estimated_length=421
FT   CDS             complement(432126..434966)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03910"
FT                   /product="RecB family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63054"
FT                   /db_xref="GOA:D4IJE2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE2"
FT                   /protein_id="CBK63054.1"
FT                   DADTCNFCDFNVICKR"
FT   CDS             complement(435066..435767)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03920"
FT                   /product="Protein of unknown function (DUF2807)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63055"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE3"
FT                   /protein_id="CBK63055.1"
FT                   KFMGGDITRVE"
FT   gap             438088..438446
FT                   /estimated_length=359
FT   CDS             439349..441046
FT                   /transl_table=11
FT                   /locus_tag="AL1_03950"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63056"
FT                   /db_xref="GOA:D4IJE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE4"
FT                   /protein_id="CBK63056.1"
FT   CDS             441176..442066
FT                   /transl_table=11
FT                   /locus_tag="AL1_03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE5"
FT                   /protein_id="CBK63057.1"
FT                   AAQLACRTVFNDATL"
FT   gap             442488..443363
FT                   /estimated_length=876
FT   CDS             complement(443849..444898)
FT                   /transl_table=11
FT                   /locus_tag="AL1_03990"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63058"
FT                   /db_xref="GOA:D4IJE6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE6"
FT                   /protein_id="CBK63058.1"
FT                   LRLRGRFNA"
FT   CDS             complement(444902..445846)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04000"
FT                   /product="Lactate dehydrogenase and related dehydrogenases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63059"
FT                   /db_xref="GOA:D4IJE7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE7"
FT                   /protein_id="CBK63059.1"
FT   CDS             complement(445934..446671)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04010"
FT                   /product="Dinucleotide-utilizing enzymes involved in
FT                   molybdopterin and thiamine biosynthesis family 1"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63060"
FT                   /db_xref="GOA:D4IJE8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE8"
FT                   /protein_id="CBK63060.1"
FT   CDS             447638..448993
FT                   /transl_table=11
FT                   /locus_tag="AL1_04030"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, A subunit"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63061"
FT                   /db_xref="GOA:D4IJE9"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJE9"
FT                   /protein_id="CBK63061.1"
FT   CDS             449014..450123
FT                   /transl_table=11
FT                   /locus_tag="AL1_04040"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, B subunit"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63062"
FT                   /db_xref="GOA:D4IJF0"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF0"
FT                   /protein_id="CBK63062.1"
FT   CDS             450135..450986
FT                   /transl_table=11
FT                   /locus_tag="AL1_04050"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, C subunit"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63063"
FT                   /db_xref="GOA:D4IJF1"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF1"
FT                   /protein_id="CBK63063.1"
FT                   NE"
FT   CDS             450988..451635
FT                   /transl_table=11
FT                   /locus_tag="AL1_04060"
FT                   /product="NADH:ubiquinone oxidoreductase,
FT                   Na(+)-translocating, D subunit"
FT                   /EC_number="1.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63064"
FT                   /db_xref="GOA:D4IJF2"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF2"
FT                   /protein_id="CBK63064.1"
FT   gap             460631..461025
FT                   /estimated_length=395
FT   CDS             complement(461506..463023)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04150"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63065"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF3"
FT                   /protein_id="CBK63065.1"
FT   CDS             complement(463035..463820)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04160"
FT                   /product="TonB dependent receptor."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63066"
FT                   /db_xref="GOA:D4IJF4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF4"
FT                   /protein_id="CBK63066.1"
FT   CDS             complement(463902..466139)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04170"
FT                   /product="Outer membrane cobalamin receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63067"
FT                   /db_xref="GOA:D4IJF5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF5"
FT                   /protein_id="CBK63067.1"
FT   CDS             complement(466148..467104)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04180"
FT                   /product="Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63068"
FT                   /db_xref="GOA:D4IJF6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF6"
FT                   /protein_id="CBK63068.1"
FT   CDS             complement(467118..469226)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63069"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF7"
FT                   /protein_id="CBK63069.1"
FT                   YAALRYNK"
FT   CDS             complement(469248..470378)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63070"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF8"
FT                   /protein_id="CBK63070.1"
FT   CDS             470689..472365
FT                   /transl_table=11
FT                   /locus_tag="AL1_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63071"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJF9"
FT                   /protein_id="CBK63071.1"
FT   CDS             complement(472457..473134)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04220"
FT                   /product="Ion channel."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63072"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG0"
FT                   /protein_id="CBK63072.1"
FT                   KGE"
FT   tRNA            473267..473340
FT                   /locus_tag="AL1_T_07120"
FT   CDS             473442..474050
FT                   /transl_table=11
FT                   /locus_tag="AL1_04230"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63073"
FT                   /db_xref="GOA:D4IJG1"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG1"
FT                   /protein_id="CBK63073.1"
FT   CDS             complement(474065..475801)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04240"
FT                   /product="pyruvate dehydrogenase (cytochrome)"
FT                   /function="pyruvate dehydrogenase (cytochrome)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63074"
FT                   /db_xref="GOA:D4IJG2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG2"
FT                   /protein_id="CBK63074.1"
FT                   LV"
FT   CDS             complement(475936..477723)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04250"
FT                   /product="Pyruvate/oxaloacetate carboxyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63075"
FT                   /db_xref="GOA:D4IJG3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG3"
FT                   /protein_id="CBK63075.1"
FT   CDS             complement(477950..479002)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04260"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63076"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG4"
FT                   /protein_id="CBK63076.1"
FT                   LFQPGGRSGG"
FT   CDS             479368..482640
FT                   /transl_table=11
FT                   /locus_tag="AL1_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63077"
FT                   /db_xref="GOA:D4IJG5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG5"
FT                   /protein_id="CBK63077.1"
FT   CDS             complement(482699..483301)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04280"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED/haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 1 with
FT                   third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63078"
FT                   /db_xref="GOA:D4IJG6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG6"
FT                   /protein_id="CBK63078.1"
FT   CDS             483459..484502
FT                   /transl_table=11
FT                   /locus_tag="AL1_04290"
FT                   /product="Protein of unknown function (DUF2776)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63079"
FT                   /db_xref="InterPro:IPR021240"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG7"
FT                   /protein_id="CBK63079.1"
FT                   ESGTSKK"
FT   CDS             complement(484633..486849)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04300"
FT                   /product="vacuolar-type H(+)-translocating pyrophosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63080"
FT                   /db_xref="GOA:D4IJG8"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG8"
FT                   /protein_id="CBK63080.1"
FT   CDS             complement(486970..487458)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04310"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63081"
FT                   /db_xref="GOA:D4IJG9"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJG9"
FT                   /protein_id="CBK63081.1"
FT   gap             487954..488190
FT                   /estimated_length=237
FT   CDS             489285..491999
FT                   /transl_table=11
FT                   /locus_tag="AL1_04340"
FT                   /product="Fibronectin type III domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63082"
FT                   /db_xref="GOA:D4IJH0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH0"
FT                   /protein_id="CBK63082.1"
FT   CDS             491996..492274
FT                   /transl_table=11
FT                   /locus_tag="AL1_04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63083"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH1"
FT                   /protein_id="CBK63083.1"
FT   CDS             492276..492932
FT                   /transl_table=11
FT                   /locus_tag="AL1_04360"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63084"
FT                   /db_xref="GOA:D4IJH2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH2"
FT                   /protein_id="CBK63084.1"
FT   CDS             492966..493415
FT                   /transl_table=11
FT                   /locus_tag="AL1_04370"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63085"
FT                   /db_xref="GOA:D4IJH3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH3"
FT                   /protein_id="CBK63085.1"
FT   CDS             493417..494325
FT                   /transl_table=11
FT                   /locus_tag="AL1_04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63086"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH4"
FT                   /protein_id="CBK63086.1"
FT   CDS             494322..495515
FT                   /transl_table=11
FT                   /locus_tag="AL1_04390"
FT                   /product="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63087"
FT                   /db_xref="GOA:D4IJH5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH5"
FT                   /protein_id="CBK63087.1"
FT   CDS             495505..496047
FT                   /transl_table=11
FT                   /locus_tag="AL1_04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63088"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH6"
FT                   /protein_id="CBK63088.1"
FT                   RSSNTASIRRRSKACLR"
FT   CDS             complement(496125..496490)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04410"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63089"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH7"
FT                   /protein_id="CBK63089.1"
FT                   LAGFLCLVLAVYFIFRK"
FT   CDS             complement(497333..497992)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04430"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63090"
FT                   /db_xref="GOA:D4IJH8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH8"
FT                   /protein_id="CBK63090.1"
FT   CDS             complement(498056..500545)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63091"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJH9"
FT                   /protein_id="CBK63091.1"
FT                   GQEIQNFAVNLSLQLKF"
FT   CDS             500628..501119
FT                   /transl_table=11
FT                   /locus_tag="AL1_04450"
FT                   /product="ybaK/ebsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63092"
FT                   /db_xref="GOA:D4IJI0"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI0"
FT                   /protein_id="CBK63092.1"
FT                   "
FT   CDS             complement(501411..502469)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04460"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /function="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63093"
FT                   /db_xref="GOA:D4IJI1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI1"
FT                   /protein_id="CBK63093.1"
FT                   YERYYQEMYTGR"
FT   CDS             complement(502466..503326)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04470"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /function="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63094"
FT                   /db_xref="GOA:D4IJI2"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029900"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI2"
FT                   /protein_id="CBK63094.1"
FT                   KNMLR"
FT   CDS             complement(503323..503886)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04480"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /function="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63095"
FT                   /db_xref="GOA:D4IJI3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI3"
FT                   /protein_id="CBK63095.1"
FT   CDS             complement(503883..504767)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04490"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /function="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63096"
FT                   /db_xref="GOA:D4IJI4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI4"
FT                   /protein_id="CBK63096.1"
FT                   GRYLLKVIEESKR"
FT   CDS             504928..505320
FT                   /transl_table=11
FT                   /locus_tag="AL1_04500"
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63097"
FT                   /db_xref="GOA:D4IJI5"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR027565"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI5"
FT                   /protein_id="CBK63097.1"
FT   CDS             505317..506405
FT                   /transl_table=11
FT                   /locus_tag="AL1_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63098"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI6"
FT                   /protein_id="CBK63098.1"
FT   CDS             506456..508036
FT                   /transl_table=11
FT                   /locus_tag="AL1_04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63099"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI7"
FT                   /protein_id="CBK63099.1"
FT                   YVDLLSGER"
FT   tRNA            complement(508128..508203)
FT                   /locus_tag="AL1_T_07170"
FT   CDS             508483..509673
FT                   /transl_table=11
FT                   /locus_tag="AL1_04530"
FT                   /product="carboxynorspermidine dehydrogenase"
FT                   /function="carboxynorspermidine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63100"
FT                   /db_xref="GOA:D4IJI8"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI8"
FT                   /protein_id="CBK63100.1"
FT   CDS             510101..511240
FT                   /transl_table=11
FT                   /locus_tag="AL1_04540"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /function="carboxynorspermidine decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63101"
FT                   /db_xref="GOA:D4IJI9"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJI9"
FT                   /protein_id="CBK63101.1"
FT   CDS             512832..514700
FT                   /transl_table=11
FT                   /locus_tag="AL1_04560"
FT                   /product="Outer membrane cobalamin receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63102"
FT                   /db_xref="GOA:D4IJJ0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ0"
FT                   /protein_id="CBK63102.1"
FT   CDS             514889..516589
FT                   /transl_table=11
FT                   /locus_tag="AL1_04570"
FT                   /product="glutamate formiminotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63103"
FT                   /db_xref="GOA:D4IJJ1"
FT                   /db_xref="InterPro:IPR004227"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR012886"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ1"
FT                   /protein_id="CBK63103.1"
FT   CDS             516591..518630
FT                   /transl_table=11
FT                   /locus_tag="AL1_04580"
FT                   /product="Urocanate hydratase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63104"
FT                   /db_xref="GOA:D4IJJ2"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ2"
FT                   /protein_id="CBK63104.1"
FT   CDS             518662..520143
FT                   /transl_table=11
FT                   /locus_tag="AL1_04590"
FT                   /product="histidine ammonia-lyase"
FT                   /function="histidine ammonia-lyase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63105"
FT                   /db_xref="GOA:D4IJJ3"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ3"
FT                   /protein_id="CBK63105.1"
FT   CDS             520140..521384
FT                   /transl_table=11
FT                   /locus_tag="AL1_04600"
FT                   /product="imidazolonepropionase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63106"
FT                   /db_xref="GOA:D4IJJ4"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ4"
FT                   /protein_id="CBK63106.1"
FT                   LIRQVFLRGRKMCGL"
FT   CDS             521611..522456
FT                   /transl_table=11
FT                   /locus_tag="AL1_04610"
FT                   /product="methionine-R-sulfoxide
FT                   reductase/methionine-S-sulfoxide reductase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63107"
FT                   /db_xref="GOA:D4IJJ5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ5"
FT                   /protein_id="CBK63107.1"
FT                   "
FT   CDS             complement(522663..523511)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04620"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63108"
FT                   /db_xref="GOA:D4IJJ6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ6"
FT                   /protein_id="CBK63108.1"
FT                   K"
FT   CDS             523798..524676
FT                   /transl_table=11
FT                   /locus_tag="AL1_04630"
FT                   /product="Predicted permease, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63109"
FT                   /db_xref="GOA:D4IJJ7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ7"
FT                   /protein_id="CBK63109.1"
FT                   VSVVVLRSRKG"
FT   CDS             complement(524743..525534)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04640"
FT                   /product="Metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63110"
FT                   /db_xref="GOA:D4IJJ8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ8"
FT                   /protein_id="CBK63110.1"
FT   CDS             complement(525644..526807)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04650"
FT                   /product="Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63111"
FT                   /db_xref="GOA:D4IJJ9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJJ9"
FT                   /protein_id="CBK63111.1"
FT   CDS             complement(526958..527878)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04660"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63112"
FT                   /db_xref="GOA:D4IJK0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK0"
FT                   /protein_id="CBK63112.1"
FT   CDS             528033..529046
FT                   /transl_table=11
FT                   /locus_tag="AL1_04670"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63113"
FT                   /db_xref="GOA:D4IJK1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK1"
FT                   /protein_id="CBK63113.1"
FT   CDS             529076..532093
FT                   /transl_table=11
FT                   /locus_tag="AL1_04680"
FT                   /product="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63114"
FT                   /db_xref="GOA:D4IJK2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK2"
FT                   /protein_id="CBK63114.1"
FT                   ILVVTILPVLYSKIYK"
FT   CDS             532093..533382
FT                   /transl_table=11
FT                   /locus_tag="AL1_04690"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63115"
FT                   /db_xref="GOA:D4IJK3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK3"
FT                   /protein_id="CBK63115.1"
FT   CDS             complement(533435..533638)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63116"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK4"
FT                   /protein_id="CBK63116.1"
FT   tRNA            complement(533910..533983)
FT                   /locus_tag="AL1_T_07160"
FT   gap             534183..534469
FT                   /estimated_length=287
FT   tRNA            complement(535748..535821)
FT                   /locus_tag="AL1_T_07150"
FT   CDS             complement(535877..536413)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04720"
FT                   /product="N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63117"
FT                   /db_xref="GOA:D4IJK5"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK5"
FT                   /protein_id="CBK63117.1"
FT                   LRSYGSVQFSFFKKP"
FT   CDS             complement(536996..537631)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63118"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK6"
FT                   /protein_id="CBK63118.1"
FT   CDS             539087..539662
FT                   /transl_table=11
FT                   /locus_tag="AL1_04760"
FT                   /product="G:T/U mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63119"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK7"
FT                   /protein_id="CBK63119.1"
FT   CDS             complement(542543..542959)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63120"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK8"
FT                   /protein_id="CBK63120.1"
FT   CDS             complement(542994..543617)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04790"
FT                   /product="uridine kinase"
FT                   /function="uridine kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63121"
FT                   /db_xref="GOA:D4IJK9"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJK9"
FT                   /protein_id="CBK63121.1"
FT   CDS             complement(543842..545800)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04800"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA gyrase subunit B"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63122"
FT                   /db_xref="GOA:D4IJL0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL0"
FT                   /protein_id="CBK63122.1"
FT                   PRREFIERNAHYANIDA"
FT   CDS             complement(545919..546656)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04810"
FT                   /product="Predicted ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63123"
FT                   /db_xref="GOA:D4IJL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL1"
FT                   /protein_id="CBK63123.1"
FT   CDS             complement(547442..549328)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04820"
FT                   /product="FOG: WD40-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63124"
FT                   /db_xref="GOA:D4IJL2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR027295"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL2"
FT                   /protein_id="CBK63124.1"
FT   CDS             549579..550748
FT                   /transl_table=11
FT                   /locus_tag="AL1_04830"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /function="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number=""
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63125"
FT                   /db_xref="GOA:D4IJL3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL3"
FT                   /protein_id="CBK63125.1"
FT   CDS             550830..551270
FT                   /transl_table=11
FT                   /locus_tag="AL1_04840"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63126"
FT                   /db_xref="GOA:D4IJL4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL4"
FT                   /protein_id="CBK63126.1"
FT   CDS             551290..552447
FT                   /transl_table=11
FT                   /locus_tag="AL1_04850"
FT                   /product="Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63127"
FT                   /db_xref="GOA:D4IJL5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL5"
FT                   /protein_id="CBK63127.1"
FT   CDS             complement(552614..553801)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04860"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63128"
FT                   /db_xref="GOA:D4IJL6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL6"
FT                   /protein_id="CBK63128.1"
FT   CDS             complement(553970..554668)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04870"
FT                   /product="Putative effector of murein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63129"
FT                   /db_xref="GOA:D4IJL7"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL7"
FT                   /protein_id="CBK63129.1"
FT                   LMPLMEKYLY"
FT   CDS             complement(554661..555032)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04880"
FT                   /product="Putative effector of murein hydrolase LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63130"
FT                   /db_xref="GOA:D4IJL8"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL8"
FT                   /protein_id="CBK63130.1"
FT   CDS             complement(555354..557906)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04890"
FT                   /product="ferrous iron transporter FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63131"
FT                   /db_xref="GOA:D4IJL9"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJL9"
FT                   /protein_id="CBK63131.1"
FT   CDS             complement(557982..559364)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04900"
FT                   /product="efflux transporter, outer membrane factor (OMF)
FT                   lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63132"
FT                   /db_xref="GOA:D4IJM0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM0"
FT                   /protein_id="CBK63132.1"
FT                   QN"
FT   CDS             complement(559361..562498)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04910"
FT                   /product="The (Largely Gram-negative Bacterial)
FT                   Hydrophobe/Amphiphile Efflux-1 (HAE1) Family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63133"
FT                   /db_xref="GOA:D4IJM1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM1"
FT                   /protein_id="CBK63133.1"
FT   CDS             complement(562503..563675)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04920"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63134"
FT                   /db_xref="GOA:D4IJM2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM2"
FT                   /protein_id="CBK63134.1"
FT   CDS             563773..564012
FT                   /transl_table=11
FT                   /locus_tag="AL1_04930"
FT                   /product="Histone H1-like protein Hc1."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63135"
FT                   /db_xref="GOA:D4IJM3"
FT                   /db_xref="InterPro:IPR010886"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM3"
FT                   /protein_id="CBK63135.1"
FT   CDS             complement(564218..565939)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04940"
FT                   /product="Predicted membrane-associated, metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63136"
FT                   /db_xref="GOA:D4IJM4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM4"
FT                   /protein_id="CBK63136.1"
FT   CDS             complement(565950..567146)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63137"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM5"
FT                   /protein_id="CBK63137.1"
FT   CDS             complement(567153..567671)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04960"
FT                   /product="Bacterial protein of unknown function
FT                   (YtfJ_HI0045)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63138"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM6"
FT                   /protein_id="CBK63138.1"
FT                   FYETIEKYK"
FT   CDS             complement(567775..568146)
FT                   /transl_table=11
FT                   /locus_tag="AL1_04970"
FT                   /product="DoxX."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63139"
FT                   /db_xref="InterPro:IPR011637"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM7"
FT                   /protein_id="CBK63139.1"
FT   CDS             568348..568923
FT                   /transl_table=11
FT                   /locus_tag="AL1_04980"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /function="DNA-3-methyladenine glycosylase I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63140"
FT                   /db_xref="GOA:D4IJM8"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM8"
FT                   /protein_id="CBK63140.1"
FT   CDS             complement(570801..571547)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05010"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63141"
FT                   /db_xref="GOA:D4IJM9"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJM9"
FT                   /protein_id="CBK63141.1"
FT   CDS             571696..572976
FT                   /transl_table=11
FT                   /locus_tag="AL1_05020"
FT                   /product="serine hydroxymethyltransferase"
FT                   /function="serine hydroxymethyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63142"
FT                   /db_xref="GOA:D4IJN0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN0"
FT                   /protein_id="CBK63142.1"
FT   CDS             572978..573658
FT                   /transl_table=11
FT                   /locus_tag="AL1_05030"
FT                   /product="conserved hypothetical protein TIGR02453"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63143"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN1"
FT                   /protein_id="CBK63143.1"
FT                   EEMQ"
FT   CDS             573660..574622
FT                   /transl_table=11
FT                   /locus_tag="AL1_05040"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63144"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN2"
FT                   /protein_id="CBK63144.1"
FT   gap             574884..575647
FT                   /estimated_length=764
FT   CDS             576932..577249
FT                   /transl_table=11
FT                   /locus_tag="AL1_05060"
FT                   /product="Protein of unknown function (DUF2958)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63145"
FT                   /db_xref="InterPro:IPR021341"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN3"
FT                   /protein_id="CBK63145.1"
FT                   E"
FT   gap             577708..578843
FT                   /estimated_length=1136
FT   CDS             complement(578896..580740)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05080"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /function="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63146"
FT                   /db_xref="GOA:D4IJN4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN4"
FT                   /protein_id="CBK63146.1"
FT   CDS             complement(580875..581657)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05090"
FT                   /product="Archaeal fructose-1,6-bisphosphatase and related
FT                   enzymes of inositol monophosphatase family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63147"
FT                   /db_xref="GOA:D4IJN5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN5"
FT                   /protein_id="CBK63147.1"
FT   CDS             complement(581659..583026)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05100"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63148"
FT                   /db_xref="GOA:D4IJN6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN6"
FT                   /protein_id="CBK63148.1"
FT   CDS             complement(583478..584866)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05120"
FT                   /product="Phosphomannomutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63149"
FT                   /db_xref="GOA:D4IJN7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN7"
FT                   /protein_id="CBK63149.1"
FT                   ICNI"
FT   CDS             584981..585859
FT                   /transl_table=11
FT                   /locus_tag="AL1_05130"
FT                   /product="Uridine phosphorylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63150"
FT                   /db_xref="GOA:D4IJN8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN8"
FT                   /protein_id="CBK63150.1"
FT                   ETALDKLAILE"
FT   CDS             585892..587016
FT                   /transl_table=11
FT                   /locus_tag="AL1_05140"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /function="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63151"
FT                   /db_xref="GOA:D4IJN9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJN9"
FT                   /protein_id="CBK63151.1"
FT   CDS             587027..587794
FT                   /transl_table=11
FT                   /locus_tag="AL1_05150"
FT                   /product="DNA polymerase III, epsilon subunit and related
FT                   3'-5' exonucleases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63152"
FT                   /db_xref="GOA:D4IJP0"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP0"
FT                   /protein_id="CBK63152.1"
FT   CDS             587791..589617
FT                   /transl_table=11
FT                   /locus_tag="AL1_05160"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63153"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP1"
FT                   /protein_id="CBK63153.1"
FT   CDS             590298..590861
FT                   /transl_table=11
FT                   /locus_tag="AL1_05180"
FT                   /product="FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63154"
FT                   /db_xref="GOA:D4IJP2"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP2"
FT                   /protein_id="CBK63154.1"
FT   CDS             591540..593180
FT                   /transl_table=11
FT                   /locus_tag="AL1_05200"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63155"
FT                   /db_xref="GOA:D4IJP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP3"
FT                   /protein_id="CBK63155.1"
FT   CDS             complement(593276..595171)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05210"
FT                   /product="Thioredoxin."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63156"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP4"
FT                   /protein_id="CBK63156.1"
FT   CDS             597610..598128
FT                   /transl_table=11
FT                   /locus_tag="AL1_05230"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63157"
FT                   /db_xref="GOA:D4IJP5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP5"
FT                   /protein_id="CBK63157.1"
FT                   SATVFHERF"
FT   CDS             complement(598170..599162)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05240"
FT                   /product="Galactose mutarotase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63158"
FT                   /db_xref="GOA:D4IJP6"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP6"
FT                   /protein_id="CBK63158.1"
FT   CDS             complement(599515..603324)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05260"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /function="DNA polymerase III, alpha subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63159"
FT                   /db_xref="GOA:D4IJP7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP7"
FT                   /protein_id="CBK63159.1"
FT   CDS             603525..603734
FT                   /transl_table=11
FT                   /locus_tag="AL1_05270"
FT                   /product="Protein of unknown function (DUF2007)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63160"
FT                   /db_xref="GOA:D4IJP8"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP8"
FT                   /protein_id="CBK63160.1"
FT   CDS             complement(603777..604523)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05280"
FT                   /product="TonB family C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63161"
FT                   /db_xref="GOA:D4IJP9"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJP9"
FT                   /protein_id="CBK63161.1"
FT   CDS             complement(604554..605291)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05290"
FT                   /product="shikimate dehydrogenase"
FT                   /function="shikimate dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63162"
FT                   /db_xref="GOA:D4IJQ0"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ0"
FT                   /protein_id="CBK63162.1"
FT   CDS             complement(605295..606236)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05300"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63163"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ1"
FT                   /protein_id="CBK63163.1"
FT   gap             606791..607029
FT                   /estimated_length=239
FT   CDS             complement(607115..607411)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05310"
FT                   /product="Protein of unknown function (DUF3276)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63164"
FT                   /db_xref="InterPro:IPR021694"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ2"
FT                   /protein_id="CBK63164.1"
FT   CDS             complement(607511..609082)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05320"
FT                   /product="C-terminal peptidase (prc)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63165"
FT                   /db_xref="GOA:D4IJQ3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ3"
FT                   /protein_id="CBK63165.1"
FT                   QPVLEP"
FT   CDS             complement(609180..610526)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05330"
FT                   /product="histidyl-tRNA synthetase"
FT                   /function="histidyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63166"
FT                   /db_xref="GOA:D4IJQ4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ4"
FT                   /protein_id="CBK63166.1"
FT   CDS             complement(610579..612255)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05340"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63167"
FT                   /db_xref="GOA:D4IJQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ5"
FT                   /protein_id="CBK63167.1"
FT   CDS             complement(612421..612999)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05350"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63168"
FT                   /db_xref="GOA:D4IJQ6"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ6"
FT                   /protein_id="CBK63168.1"
FT   CDS             complement(613112..614053)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05360"
FT                   /product="Bacterial capsule synthesis protein PGA_cap."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63169"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ7"
FT                   /protein_id="CBK63169.1"
FT   gap             614067..614375
FT                   /estimated_length=309
FT   CDS             complement(614444..614746)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63170"
FT                   /db_xref="InterPro:IPR027890"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ8"
FT                   /protein_id="CBK63170.1"
FT   CDS             complement(614764..615951)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05380"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63171"
FT                   /db_xref="GOA:D4IJQ9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJQ9"
FT                   /protein_id="CBK63171.1"
FT   gap             616654..617137
FT                   /estimated_length=484
FT   CDS             619158..620315
FT                   /transl_table=11
FT                   /locus_tag="AL1_05400"
FT                   /product="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63172"
FT                   /db_xref="GOA:D4IJR0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR0"
FT                   /protein_id="CBK63172.1"
FT   CDS             620306..621385
FT                   /transl_table=11
FT                   /locus_tag="AL1_05410"
FT                   /product="Pyrimidine reductase, riboflavin biosynthesis"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63173"
FT                   /db_xref="GOA:D4IJR1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR1"
FT                   /protein_id="CBK63173.1"
FT   CDS             621495..622970
FT                   /transl_table=11
FT                   /locus_tag="AL1_05420"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63174"
FT                   /db_xref="GOA:D4IJR2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR2"
FT                   /protein_id="CBK63174.1"
FT   CDS             623050..624039
FT                   /transl_table=11
FT                   /locus_tag="AL1_05430"
FT                   /product="Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63175"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR3"
FT                   /protein_id="CBK63175.1"
FT   CDS             624043..625221
FT                   /transl_table=11
FT                   /locus_tag="AL1_05440"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63176"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR4"
FT                   /protein_id="CBK63176.1"
FT   CDS             625223..626458
FT                   /transl_table=11
FT                   /locus_tag="AL1_05450"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63177"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR5"
FT                   /protein_id="CBK63177.1"
FT                   HPARKENGDEGR"
FT   CDS             complement(626529..627188)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63178"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR6"
FT                   /protein_id="CBK63178.1"
FT   CDS             complement(627185..628486)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05470"
FT                   /product="Peptidase C10 family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63179"
FT                   /db_xref="GOA:D4IJR7"
FT                   /db_xref="InterPro:IPR000200"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR7"
FT                   /protein_id="CBK63179.1"
FT   CDS             complement(628747..631716)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63180"
FT                   /db_xref="GOA:D4IJR8"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR8"
FT                   /protein_id="CBK63180.1"
FT                   "
FT   gap             631840..632179
FT                   /estimated_length=340
FT   CDS             complement(632311..632712)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63181"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJR9"
FT                   /protein_id="CBK63181.1"
FT   CDS             complement(632896..633660)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05500"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63182"
FT                   /db_xref="GOA:D4IJS0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS0"
FT                   /protein_id="CBK63182.1"
FT   CDS             complement(633657..634961)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05510"
FT                   /product="Putative regulator of cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63183"
FT                   /db_xref="GOA:D4IJS1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS1"
FT                   /protein_id="CBK63183.1"
FT   CDS             complement(639472..641937)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05570"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /function="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63184"
FT                   /db_xref="GOA:D4IJS2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS2"
FT                   /protein_id="CBK63184.1"
FT                   QKCGAQVRA"
FT   CDS             642275..643636
FT                   /transl_table=11
FT                   /locus_tag="AL1_05580"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63185"
FT                   /db_xref="GOA:D4IJS3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS3"
FT                   /protein_id="CBK63185.1"
FT   CDS             complement(643823..644728)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05590"
FT                   /product="EamA-like transporter family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63186"
FT                   /db_xref="GOA:D4IJS4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS4"
FT                   /protein_id="CBK63186.1"
FT   CDS             complement(644763..645926)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05600"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63187"
FT                   /db_xref="GOA:D4IJS5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS5"
FT                   /protein_id="CBK63187.1"
FT   CDS             646044..647834
FT                   /transl_table=11
FT                   /locus_tag="AL1_05610"
FT                   /product="GTP-binding protein LepA"
FT                   /function="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63188"
FT                   /db_xref="GOA:D4IJS6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS6"
FT                   /protein_id="CBK63188.1"
FT   CDS             647840..649747
FT                   /transl_table=11
FT                   /locus_tag="AL1_05620"
FT                   /product="Long-chain acyl-CoA synthetases (AMP-forming)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63189"
FT                   /db_xref="GOA:D4IJS7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS7"
FT                   /protein_id="CBK63189.1"
FT                   "
FT   tRNA            649813..649888
FT                   /locus_tag="AL1_T_07130"
FT   CDS             complement(650039..650974)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63190"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS8"
FT                   /protein_id="CBK63190.1"
FT   CDS             complement(650990..653515)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05640"
FT                   /product="beta-mannosidase"
FT                   /function="beta-mannosidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63191"
FT                   /db_xref="GOA:D4IJS9"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR028369"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJS9"
FT                   /protein_id="CBK63191.1"
FT   CDS             complement(653573..654436)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05650"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63192"
FT                   /db_xref="GOA:D4IJT0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT0"
FT                   /protein_id="CBK63192.1"
FT                   QMLIKY"
FT   CDS             656176..657204
FT                   /transl_table=11
FT                   /locus_tag="AL1_05670"
FT                   /product="Predicted glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63193"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT1"
FT                   /protein_id="CBK63193.1"
FT                   CE"
FT   gap             659781..660796
FT                   /estimated_length=1016
FT   CDS             661493..663010
FT                   /transl_table=11
FT                   /locus_tag="AL1_05700"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63194"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT2"
FT                   /protein_id="CBK63194.1"
FT   CDS             663033..664640
FT                   /transl_table=11
FT                   /locus_tag="AL1_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63195"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT3"
FT                   /protein_id="CBK63195.1"
FT                   VGPRNYVMLFNKQAEAGE"
FT   CDS             664696..666177
FT                   /transl_table=11
FT                   /locus_tag="AL1_05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63196"
FT                   /db_xref="GOA:D4IJT4"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT4"
FT                   /protein_id="CBK63196.1"
FT   CDS             666901..667644
FT                   /transl_table=11
FT                   /locus_tag="AL1_05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63197"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT5"
FT                   /protein_id="CBK63197.1"
FT   CDS             complement(671492..672046)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05770"
FT                   /product="Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63198"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT6"
FT                   /protein_id="CBK63198.1"
FT   CDS             672214..673119
FT                   /transl_table=11
FT                   /locus_tag="AL1_05780"
FT                   /product="transcriptional regulator, AraC family"
FT                   /function="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63199"
FT                   /db_xref="GOA:D4IJT7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT7"
FT                   /protein_id="CBK63199.1"
FT   CDS             675135..675905
FT                   /transl_table=11
FT                   /locus_tag="AL1_05800"
FT                   /product="S1/P1 Nuclease."
FT                   /EC_number="3.1.30.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63200"
FT                   /db_xref="GOA:D4IJT8"
FT                   /db_xref="InterPro:IPR003154"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT8"
FT                   /protein_id="CBK63200.1"
FT   CDS             676423..677232
FT                   /transl_table=11
FT                   /locus_tag="AL1_05820"
FT                   /product="Predicted oxidoreductases of the aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63201"
FT                   /db_xref="GOA:D4IJT9"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJT9"
FT                   /protein_id="CBK63201.1"
FT   CDS             677251..677694
FT                   /transl_table=11
FT                   /locus_tag="AL1_05830"
FT                   /product="Domain of unknown function (DUF1893)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63202"
FT                   /db_xref="GOA:D4IJU0"
FT                   /db_xref="InterPro:IPR015067"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU0"
FT                   /protein_id="CBK63202.1"
FT   CDS             677783..679663
FT                   /transl_table=11
FT                   /locus_tag="AL1_05840"
FT                   /product="Outer membrane cobalamin receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63203"
FT                   /db_xref="GOA:D4IJU1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU1"
FT                   /protein_id="CBK63203.1"
FT   CDS             680190..681170
FT                   /transl_table=11
FT                   /locus_tag="AL1_05860"
FT                   /product="Uncharacterized Fe-S center protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63204"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU2"
FT                   /protein_id="CBK63204.1"
FT   CDS             681672..683765
FT                   /transl_table=11
FT                   /locus_tag="AL1_05870"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63205"
FT                   /db_xref="GOA:D4IJU3"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR014192"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU3"
FT                   /protein_id="CBK63205.1"
FT                   KAE"
FT   CDS             683767..684237
FT                   /transl_table=11
FT                   /locus_tag="AL1_05880"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63206"
FT                   /db_xref="GOA:D4IJU4"
FT                   /db_xref="InterPro:IPR014191"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU4"
FT                   /protein_id="CBK63206.1"
FT   gap             684531..684817
FT                   /estimated_length=287
FT   CDS             complement(685360..685725)
FT                   /transl_table=11
FT                   /locus_tag="AL1_05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63207"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU5"
FT                   /protein_id="CBK63207.1"
FT                   LRLILDSLFAEGNQLNV"
FT   CDS             689304..690842
FT                   /transl_table=11
FT                   /locus_tag="AL1_05950"
FT                   /product="Predicted membrane-associated, metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63208"
FT                   /db_xref="GOA:D4IJU6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU6"
FT                   /protein_id="CBK63208.1"
FT   CDS             691149..692321
FT                   /transl_table=11
FT                   /locus_tag="AL1_05960"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63209"
FT                   /db_xref="GOA:D4IJU7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU7"
FT                   /protein_id="CBK63209.1"
FT   CDS             692345..692722
FT                   /transl_table=11
FT                   /locus_tag="AL1_05970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63210"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU8"
FT                   /protein_id="CBK63210.1"
FT   CDS             692875..693066
FT                   /transl_table=11
FT                   /locus_tag="AL1_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63211"
FT                   /db_xref="GOA:D4IJU9"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJU9"
FT                   /protein_id="CBK63211.1"
FT                   HYKPNGKNIYFDRAELER"
FT   CDS             693540..693710
FT                   /transl_table=11
FT                   /locus_tag="AL1_05990"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63212"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV0"
FT                   /protein_id="CBK63212.1"
FT                   EDFLKQLRHDR"
FT   CDS             693700..694791
FT                   /transl_table=11
FT                   /locus_tag="AL1_06000"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63213"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV1"
FT                   /protein_id="CBK63213.1"
FT   CDS             694795..695310
FT                   /transl_table=11
FT                   /locus_tag="AL1_06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63214"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV2"
FT                   /protein_id="CBK63214.1"
FT                   KRLVRACV"
FT   CDS             695404..695613
FT                   /transl_table=11
FT                   /locus_tag="AL1_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63215"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV3"
FT                   /protein_id="CBK63215.1"
FT   CDS             complement(695686..696585)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63216"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV4"
FT                   /protein_id="CBK63216.1"
FT                   ENLCGLRLELYKELSERQ"
FT   CDS             complement(697110..697661)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63217"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV5"
FT                   /protein_id="CBK63217.1"
FT   CDS             697701..698021
FT                   /transl_table=11
FT                   /locus_tag="AL1_06050"
FT                   /product="Transposase DDE domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63218"
FT                   /db_xref="GOA:D4IJV6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV6"
FT                   /protein_id="CBK63218.1"
FT                   LF"
FT   CDS             698124..698213
FT                   /transl_table=11
FT                   /locus_tag="AL1_06060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63219"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV7"
FT                   /protein_id="CBK63219.1"
FT                   /translation="MWNIIILMQMMHLNYSQKMTLLLQGILPD"
FT   CDS             699255..700505
FT                   /transl_table=11
FT                   /locus_tag="AL1_06070"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63220"
FT                   /db_xref="GOA:D4IJV8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV8"
FT                   /protein_id="CBK63220.1"
FT                   YRTIDDEMKQQLVDLLK"
FT   CDS             700573..702033
FT                   /transl_table=11
FT                   /locus_tag="AL1_06080"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63221"
FT                   /db_xref="GOA:D4IJV9"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJV9"
FT                   /protein_id="CBK63221.1"
FT   CDS             702043..702972
FT                   /transl_table=11
FT                   /locus_tag="AL1_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63222"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW0"
FT                   /protein_id="CBK63222.1"
FT   gap             703109..704011
FT                   /estimated_length=903
FT   CDS             704022..704501
FT                   /transl_table=11
FT                   /locus_tag="AL1_06100"
FT                   /product="Predicted P-loop ATPase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63223"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW1"
FT                   /protein_id="CBK63223.1"
FT   CDS             705851..706219
FT                   /transl_table=11
FT                   /locus_tag="AL1_06130"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63224"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW2"
FT                   /protein_id="CBK63224.1"
FT                   AAIVTAIEKLLKQICDGR"
FT   CDS             706263..707285
FT                   /transl_table=11
FT                   /locus_tag="AL1_06140"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63225"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW3"
FT                   /protein_id="CBK63225.1"
FT                   "
FT   CDS             707304..707924
FT                   /transl_table=11
FT                   /locus_tag="AL1_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63226"
FT                   /db_xref="GOA:D4IJW4"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW4"
FT                   /protein_id="CBK63226.1"
FT   CDS             708288..710366
FT                   /transl_table=11
FT                   /locus_tag="AL1_06160"
FT                   /product="Outer membrane cobalamin receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63227"
FT                   /db_xref="GOA:D4IJW5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW5"
FT                   /protein_id="CBK63227.1"
FT   CDS             710379..711536
FT                   /transl_table=11
FT                   /locus_tag="AL1_06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63228"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW6"
FT                   /protein_id="CBK63228.1"
FT   CDS             711533..712774
FT                   /transl_table=11
FT                   /locus_tag="AL1_06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63229"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW7"
FT                   /protein_id="CBK63229.1"
FT                   ARDMHIYVRPDQHQ"
FT   CDS             712792..714087
FT                   /transl_table=11
FT                   /locus_tag="AL1_06190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63230"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW8"
FT                   /protein_id="CBK63230.1"
FT   CDS             714282..715349
FT                   /transl_table=11
FT                   /locus_tag="AL1_06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63231"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJW9"
FT                   /protein_id="CBK63231.1"
FT                   GYRSDGYSVRCAKDE"
FT   CDS             715377..716930
FT                   /transl_table=11
FT                   /locus_tag="AL1_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63232"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX0"
FT                   /protein_id="CBK63232.1"
FT                   "
FT   CDS             717119..718264
FT                   /transl_table=11
FT                   /locus_tag="AL1_06220"
FT                   /product="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63233"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX1"
FT                   /protein_id="CBK63233.1"
FT   CDS             complement(718265..718804)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06230"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /function="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63234"
FT                   /db_xref="GOA:D4IJX2"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX2"
FT                   /protein_id="CBK63234.1"
FT                   KHYYTQGVLSRDGIDR"
FT   CDS             complement(718807..719172)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63235"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX3"
FT                   /protein_id="CBK63235.1"
FT                   LCLLLDSLFAEGNQINF"
FT   CDS             complement(719270..720883)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06250"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63236"
FT                   /db_xref="GOA:D4IJX4"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX4"
FT                   /protein_id="CBK63236.1"
FT   CDS             721940..722686
FT                   /transl_table=11
FT                   /locus_tag="AL1_06270"
FT                   /product="Predicted ATPases of PP-loop superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63237"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX5"
FT                   /protein_id="CBK63237.1"
FT   CDS             complement(722702..724978)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06280"
FT                   /product="Outer membrane receptor for ferrienterochelin and
FT                   colicins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63238"
FT                   /db_xref="GOA:D4IJX6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX6"
FT                   /protein_id="CBK63238.1"
FT                   AKFAL"
FT   CDS             complement(725098..725232)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63239"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX7"
FT                   /protein_id="CBK63239.1"
FT   gap             726209..726299
FT                   /estimated_length=91
FT   CDS             complement(726332..727237)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06300"
FT                   /product="tRNA isopentenyltransferase (miaA)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63240"
FT                   /db_xref="GOA:D4IJX8"
FT                   /db_xref="InterPro:IPR002627"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX8"
FT                   /protein_id="CBK63240.1"
FT   CDS             complement(727227..727742)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06310"
FT                   /product="Plasmid pRiA4b ORF-3-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63241"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJX9"
FT                   /protein_id="CBK63241.1"
FT                   DDNYDDEY"
FT   CDS             complement(727799..728785)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06320"
FT                   /product="Acyl-CoA reductase (LuxC)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63242"
FT                   /db_xref="GOA:D4IJY0"
FT                   /db_xref="InterPro:IPR008670"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY0"
FT                   /protein_id="CBK63242.1"
FT   CDS             728880..729482
FT                   /transl_table=11
FT                   /locus_tag="AL1_06330"
FT                   /product="Predicted oxidoreductase related to
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63243"
FT                   /db_xref="GOA:D4IJY1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY1"
FT                   /protein_id="CBK63243.1"
FT   tRNA            729606..729678
FT                   /locus_tag="AL1_T_07140"
FT   CDS             729858..730997
FT                   /transl_table=11
FT                   /locus_tag="AL1_06340"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63244"
FT                   /db_xref="GOA:D4IJY2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY2"
FT                   /protein_id="CBK63244.1"
FT   CDS             732710..734044
FT                   /transl_table=11
FT                   /locus_tag="AL1_06360"
FT                   /product="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63245"
FT                   /db_xref="GOA:D4IJY3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY3"
FT                   /protein_id="CBK63245.1"
FT   CDS             734255..734416
FT                   /transl_table=11
FT                   /locus_tag="AL1_06370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63246"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY4"
FT                   /protein_id="CBK63246.1"
FT                   CVDWFEKI"
FT   CDS             734423..734503
FT                   /transl_table=11
FT                   /locus_tag="AL1_06380"
FT                   /product="F subunit of K+-transporting ATPase
FT                   (Potass_KdpF)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63247"
FT                   /db_xref="GOA:D4IJY5"
FT                   /db_xref="InterPro:IPR011726"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY5"
FT                   /protein_id="CBK63247.1"
FT                   /translation="MFTSLLILSILGFVYLMYVLVKPEKF"
FT   CDS             734508..736199
FT                   /transl_table=11
FT                   /locus_tag="AL1_06390"
FT                   /product="K+-transporting ATPase, KdpA"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63248"
FT                   /db_xref="GOA:D4IJY6"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY6"
FT                   /protein_id="CBK63248.1"
FT   CDS             736213..738255
FT                   /transl_table=11
FT                   /locus_tag="AL1_06400"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63249"
FT                   /db_xref="GOA:D4IJY7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY7"
FT                   /protein_id="CBK63249.1"
FT   CDS             738271..738840
FT                   /transl_table=11
FT                   /locus_tag="AL1_06410"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63250"
FT                   /db_xref="GOA:D4IJY8"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY8"
FT                   /protein_id="CBK63250.1"
FT   CDS             738850..739593
FT                   /transl_table=11
FT                   /locus_tag="AL1_06420"
FT                   /product="Bacterial protein of unknown function (Gcw_chp)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63251"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJY9"
FT                   /protein_id="CBK63251.1"
FT   CDS             739597..740718
FT                   /transl_table=11
FT                   /locus_tag="AL1_06430"
FT                   /product="Universal stress protein family./Osmosensitive K+
FT                   channel His kinase sensor domain."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63252"
FT                   /db_xref="GOA:D4IJZ0"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ0"
FT                   /protein_id="CBK63252.1"
FT   CDS             740770..742437
FT                   /transl_table=11
FT                   /locus_tag="AL1_06440"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /function="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63253"
FT                   /db_xref="GOA:D4IJZ1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ1"
FT                   /protein_id="CBK63253.1"
FT   CDS             complement(742497..742955)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06450"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63254"
FT                   /db_xref="GOA:D4IJZ2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ2"
FT                   /protein_id="CBK63254.1"
FT   CDS             743293..744558
FT                   /transl_table=11
FT                   /locus_tag="AL1_06460"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63255"
FT                   /db_xref="GOA:D4IJZ3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ3"
FT                   /protein_id="CBK63255.1"
FT   CDS             744565..747663
FT                   /transl_table=11
FT                   /locus_tag="AL1_06470"
FT                   /product="The (Largely Gram-negative Bacterial)
FT                   Hydrophobe/Amphiphile Efflux-1 (HAE1) Family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63256"
FT                   /db_xref="GOA:D4IJZ4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ4"
FT                   /protein_id="CBK63256.1"
FT   CDS             747648..749057
FT                   /transl_table=11
FT                   /locus_tag="AL1_06480"
FT                   /product="efflux transporter, outer membrane factor (OMF)
FT                   lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63257"
FT                   /db_xref="GOA:D4IJZ5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ5"
FT                   /protein_id="CBK63257.1"
FT                   GWQPSDAEKKG"
FT   CDS             complement(749067..749645)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06490"
FT                   /product="cAMP-binding proteins-catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63258"
FT                   /db_xref="GOA:D4IJZ6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ6"
FT                   /protein_id="CBK63258.1"
FT   CDS             complement(749730..751082)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06500"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63259"
FT                   /db_xref="GOA:D4IJZ7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ7"
FT                   /protein_id="CBK63259.1"
FT   CDS             complement(751187..752119)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06510"
FT                   /product="Predicted oxidoreductases of the aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63260"
FT                   /db_xref="GOA:D4IJZ8"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ8"
FT                   /protein_id="CBK63260.1"
FT   CDS             complement(752321..752593)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06520"
FT                   /product="Predicted oxidoreductases of the aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63261"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D4IJZ9"
FT                   /protein_id="CBK63261.1"
FT   CDS             complement(752607..754109)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06530"
FT                   /product="4Fe-4S binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63262"
FT                   /db_xref="GOA:D4IK00"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK00"
FT                   /protein_id="CBK63262.1"
FT   CDS             complement(754261..755103)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06540"
FT                   /product="Aldo/keto reductases, related to diketogulonate
FT                   reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63263"
FT                   /db_xref="GOA:D4IK01"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK01"
FT                   /protein_id="CBK63263.1"
FT   gap             756301..756618
FT                   /estimated_length=318
FT   CDS             complement(756865..757611)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06560"
FT                   /product="phosphoglycerate mutase"
FT                   /function="phosphoglycerate mutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63264"
FT                   /db_xref="GOA:D4IK02"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK02"
FT                   /protein_id="CBK63264.1"
FT   CDS             complement(757608..758630)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06570"
FT                   /product="Lactate dehydrogenase and related dehydrogenases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63265"
FT                   /db_xref="GOA:D4IK03"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK03"
FT                   /protein_id="CBK63265.1"
FT                   "
FT   CDS             complement(758675..759727)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06580"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /function="fructose-bisphosphate aldolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63266"
FT                   /db_xref="GOA:D4IK04"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK04"
FT                   /protein_id="CBK63266.1"
FT                   VYLDDEVTIA"
FT   CDS             761086..762219
FT                   /transl_table=11
FT                   /locus_tag="AL1_06600"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63267"
FT                   /db_xref="GOA:D4IK05"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK05"
FT                   /protein_id="CBK63267.1"
FT   CDS             765412..766782
FT                   /transl_table=11
FT                   /locus_tag="AL1_06620"
FT                   /product="efflux transporter, outer membrane factor (OMF)
FT                   lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63268"
FT                   /db_xref="GOA:D4IK06"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK06"
FT                   /protein_id="CBK63268.1"
FT   CDS             766782..767363
FT                   /transl_table=11
FT                   /locus_tag="AL1_06630"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63269"
FT                   /db_xref="GOA:D4IK07"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK07"
FT                   /protein_id="CBK63269.1"
FT   gap             767369..767862
FT                   /estimated_length=494
FT   gap             771580..771703
FT                   /estimated_length=124
FT   CDS             772265..772885
FT                   /transl_table=11
FT                   /locus_tag="AL1_06680"
FT                   /product="Homoserine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63270"
FT                   /db_xref="GOA:D4IK08"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK08"
FT                   /protein_id="CBK63270.1"
FT   CDS             773295..774503
FT                   /transl_table=11
FT                   /locus_tag="AL1_06700"
FT                   /product="homoserine dehydrogenase"
FT                   /function="homoserine dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63271"
FT                   /db_xref="GOA:D4IK09"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK09"
FT                   /protein_id="CBK63271.1"
FT                   NRD"
FT   CDS             complement(774543..775880)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06710"
FT                   /product="Fibrobacter succinogenes major domain
FT                   (Fib_succ_major)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63272"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="InterPro:IPR025049"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK10"
FT                   /protein_id="CBK63272.1"
FT   CDS             complement(775948..777150)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06720"
FT                   /product="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63273"
FT                   /db_xref="GOA:D4IK11"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK11"
FT                   /protein_id="CBK63273.1"
FT                   N"
FT   CDS             778916..779683
FT                   /transl_table=11
FT                   /locus_tag="AL1_06740"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63274"
FT                   /db_xref="GOA:D4IK12"
FT                   /db_xref="InterPro:IPR006622"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="InterPro:IPR016548"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK12"
FT                   /protein_id="CBK63274.1"
FT   CDS             complement(781345..782298)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06760"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63275"
FT                   /db_xref="GOA:D4IK13"
FT                   /db_xref="InterPro:IPR022853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK13"
FT                   /protein_id="CBK63275.1"
FT   CDS             complement(782325..782795)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06770"
FT                   /product="Membrane-bound serine protease (ClpP class)"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63276"
FT                   /db_xref="GOA:D4IK14"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK14"
FT                   /protein_id="CBK63276.1"
FT   CDS             complement(782881..784428)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63277"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK15"
FT                   /protein_id="CBK63277.1"
FT   CDS             complement(784437..785843)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06790"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63278"
FT                   /db_xref="GOA:D4IK16"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK16"
FT                   /protein_id="CBK63278.1"
FT                   IQIFFIKWWR"
FT   CDS             complement(785890..786186)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63279"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK17"
FT                   /protein_id="CBK63279.1"
FT   CDS             complement(786183..786677)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63280"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK18"
FT                   /protein_id="CBK63280.1"
FT                   I"
FT   CDS             789027..790529
FT                   /transl_table=11
FT                   /locus_tag="AL1_06840"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63281"
FT                   /db_xref="GOA:D4IK19"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK19"
FT                   /protein_id="CBK63281.1"
FT   CDS             791731..792702
FT                   /transl_table=11
FT                   /locus_tag="AL1_06860"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /function="methionyl-tRNA formyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63282"
FT                   /db_xref="GOA:D4IK20"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK20"
FT                   /protein_id="CBK63282.1"
FT   CDS             complement(792808..793500)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06870"
FT                   /product="3-Cys thioredoxin peroxidase"
FT                   /function="3-Cys thioredoxin peroxidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63283"
FT                   /db_xref="GOA:D4IK21"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK21"
FT                   /protein_id="CBK63283.1"
FT                   GRKLGEKV"
FT   CDS             794084..794440
FT                   /transl_table=11
FT                   /locus_tag="AL1_06880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63284"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK22"
FT                   /protein_id="CBK63284.1"
FT                   IDFQPKEEKSIKQD"
FT   CDS             complement(794547..795089)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06890"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /function="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63285"
FT                   /db_xref="GOA:D4IK23"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK23"
FT                   /protein_id="CBK63285.1"
FT                   PANEEAIRHGGEIIRKR"
FT   CDS             complement(795094..795861)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06900"
FT                   /product="Pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63286"
FT                   /db_xref="GOA:D4IK24"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK24"
FT                   /protein_id="CBK63286.1"
FT   CDS             complement(795868..796962)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06910"
FT                   /product="Pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, alpha subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63287"
FT                   /db_xref="GOA:D4IK25"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK25"
FT                   /protein_id="CBK63287.1"
FT   CDS             complement(796966..797193)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06920"
FT                   /product="4Fe-4S binding domain."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63288"
FT                   /db_xref="GOA:D4IK26"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK26"
FT                   /protein_id="CBK63288.1"
FT   CDS             complement(798831..799832)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06940"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /function="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63289"
FT                   /db_xref="GOA:D4IK27"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK27"
FT                   /protein_id="CBK63289.1"
FT   CDS             complement(799838..800911)
FT                   /transl_table=11
FT                   /locus_tag="AL1_06950"
FT                   /product="phosphoserine aminotransferase apoenzyme"
FT                   /function="phosphoserine aminotransferase apoenzyme"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63290"
FT                   /db_xref="GOA:D4IK28"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR003248"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK28"
FT                   /protein_id="CBK63290.1"
FT                   VEALVACMQEFAEAHKK"
FT   CDS             801189..802049
FT                   /transl_table=11
FT                   /locus_tag="AL1_06960"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63291"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK29"
FT                   /protein_id="CBK63291.1"
FT                   VLNIL"
FT   CDS             802174..802737
FT                   /transl_table=11
FT                   /locus_tag="AL1_06970"
FT                   /product="guanylate kinase"
FT                   /function="guanylate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63292"
FT                   /db_xref="GOA:D4IK30"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK30"
FT                   /protein_id="CBK63292.1"
FT   CDS             802739..803548
FT                   /transl_table=11
FT                   /locus_tag="AL1_06980"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63293"
FT                   /db_xref="GOA:D4IK31"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK31"
FT                   /protein_id="CBK63293.1"
FT   CDS             804530..805102
FT                   /transl_table=11
FT                   /locus_tag="AL1_07000"
FT                   /product="Protein of unknown function (DUF3109)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63294"
FT                   /db_xref="InterPro:IPR021458"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK32"
FT                   /protein_id="CBK63294.1"
FT   CDS             805113..806312
FT                   /transl_table=11
FT                   /locus_tag="AL1_07010"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63295"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK33"
FT                   /protein_id="CBK63295.1"
FT                   "
FT   gap             807168..807563
FT                   /estimated_length=396
FT   CDS             complement(808437..809654)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63296"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK34"
FT                   /protein_id="CBK63296.1"
FT                   EIVMAK"
FT   CDS             809882..811576
FT                   /transl_table=11
FT                   /locus_tag="AL1_07050"
FT                   /product="Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63297"
FT                   /db_xref="GOA:D4IK35"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK35"
FT                   /protein_id="CBK63297.1"
FT   CDS             811573..812952
FT                   /transl_table=11
FT                   /locus_tag="AL1_07060"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63298"
FT                   /db_xref="GOA:D4IK36"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK36"
FT                   /protein_id="CBK63298.1"
FT                   L"
FT   gap             812995..813728
FT                   /estimated_length=734
FT   CDS             complement(814010..814153)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63299"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK37"
FT                   /protein_id="CBK63299.1"
FT                   SG"
FT   CDS             complement(814835..816895)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07230"
FT                   /product="N-acetyl-beta-hexosaminidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63300"
FT                   /db_xref="GOA:D4IK38"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK38"
FT                   /protein_id="CBK63300.1"
FT   CDS             complement(817036..818244)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63301"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013728"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK39"
FT                   /protein_id="CBK63301.1"
FT                   TNW"
FT   CDS             complement(818265..820595)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07250"
FT                   /product="Domain of unknown function (DUF1735)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63302"
FT                   /db_xref="GOA:D4IK40"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013728"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK40"
FT                   /protein_id="CBK63302.1"
FT   CDS             complement(820616..822190)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63303"
FT                   /db_xref="InterPro:IPR024302"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK41"
FT                   /protein_id="CBK63303.1"
FT                   RLWWDAR"
FT   CDS             complement(822206..825526)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07270"
FT                   /product="Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63304"
FT                   /db_xref="GOA:D4IK42"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK42"
FT                   /protein_id="CBK63304.1"
FT   CDS             complement(825712..826581)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07280"
FT                   /product="Fe2+-dicitrate sensor, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63305"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK43"
FT                   /protein_id="CBK63305.1"
FT                   ETNEITIY"
FT   CDS             complement(826744..827322)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07290"
FT                   /product="RNA polymerase sigma factor, sigma-70 family/RNA
FT                   polymerase sigma-70 factor, Bacteroides expansion family 1"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63306"
FT                   /db_xref="GOA:D4IK44"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK44"
FT                   /protein_id="CBK63306.1"
FT   CDS             827684..828928
FT                   /transl_table=11
FT                   /locus_tag="AL1_07300"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63307"
FT                   /db_xref="GOA:D4IK45"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK45"
FT                   /protein_id="CBK63307.1"
FT                   TLYRDTDLEKVRERL"
FT   CDS             832399..833955
FT                   /transl_table=11
FT                   /locus_tag="AL1_07320"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63308"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK46"
FT                   /protein_id="CBK63308.1"
FT                   N"
FT   tRNA            834147..834222
FT                   /locus_tag="AL1_T_07720"
FT   CDS             834325..835524
FT                   /transl_table=11
FT                   /locus_tag="AL1_07340"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63309"
FT                   /db_xref="GOA:D4IK47"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK47"
FT                   /protein_id="CBK63309.1"
FT                   "
FT   CDS             complement(835592..836431)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63310"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK48"
FT                   /protein_id="CBK63310.1"
FT   CDS             838081..838305
FT                   /transl_table=11
FT                   /locus_tag="AL1_07370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63311"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK49"
FT                   /protein_id="CBK63311.1"
FT   CDS             838546..839148
FT                   /transl_table=11
FT                   /locus_tag="AL1_07380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63312"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK50"
FT                   /protein_id="CBK63312.1"
FT   CDS             839518..839814
FT                   /transl_table=11
FT                   /locus_tag="AL1_07390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63313"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK51"
FT                   /protein_id="CBK63313.1"
FT   CDS             840770..842710
FT                   /transl_table=11
FT                   /locus_tag="AL1_07410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63314"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK52"
FT                   /protein_id="CBK63314.1"
FT                   KNFSSILGLDE"
FT   CDS             842771..843016
FT                   /transl_table=11
FT                   /locus_tag="AL1_07420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63315"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK53"
FT                   /protein_id="CBK63315.1"
FT   CDS             complement(843100..844002)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63316"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK54"
FT                   /protein_id="CBK63316.1"
FT   CDS             844355..844588
FT                   /transl_table=11
FT                   /locus_tag="AL1_07440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63317"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK55"
FT                   /protein_id="CBK63317.1"
FT   tRNA            844832..844904
FT                   /locus_tag="AL1_T_07730"
FT   CDS             845154..846383
FT                   /transl_table=11
FT                   /locus_tag="AL1_07460"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63318"
FT                   /db_xref="GOA:D4IK56"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK56"
FT                   /protein_id="CBK63318.1"
FT                   QVERAIAKLG"
FT   CDS             complement(846467..847558)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63319"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK57"
FT                   /protein_id="CBK63319.1"
FT   CDS             complement(847586..848527)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07480"
FT                   /product="HipA-like C-terminal domain./HipA-like N-terminal
FT                   domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63320"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR012894"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK58"
FT                   /protein_id="CBK63320.1"
FT   CDS             complement(848531..848863)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07490"
FT                   /product="HipA N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63321"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK59"
FT                   /protein_id="CBK63321.1"
FT                   VITKEE"
FT   CDS             complement(848860..849039)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07500"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63322"
FT                   /db_xref="GOA:D4IK60"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017507"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK60"
FT                   /protein_id="CBK63322.1"
FT                   GYEVGAVPMTKTDE"
FT   CDS             849212..849343
FT                   /transl_table=11
FT                   /locus_tag="AL1_07510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63323"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK61"
FT                   /protein_id="CBK63323.1"
FT   CDS             complement(849393..849689)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63324"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK62"
FT                   /protein_id="CBK63324.1"
FT   CDS             complement(849757..850068)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63325"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK63"
FT                   /protein_id="CBK63325.1"
FT   CDS             complement(850059..850397)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07540"
FT                   /product="Protein of unknown function (DUF3408)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63326"
FT                   /db_xref="InterPro:IPR021823"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK64"
FT                   /protein_id="CBK63326.1"
FT                   LKTTLPWE"
FT   CDS             850399..850569
FT                   /transl_table=11
FT                   /locus_tag="AL1_07550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63327"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK65"
FT                   /protein_id="CBK63327.1"
FT                   KTFLWRAKKKI"
FT   CDS             complement(851505..852002)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63328"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK66"
FT                   /protein_id="CBK63328.1"
FT                   PQ"
FT   CDS             852783..854195
FT                   /transl_table=11
FT                   /locus_tag="AL1_07570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63329"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK67"
FT                   /protein_id="CBK63329.1"
FT                   RAIQILNGEDHD"
FT   CDS             854188..854925
FT                   /transl_table=11
FT                   /locus_tag="AL1_07580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63330"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK68"
FT                   /protein_id="CBK63330.1"
FT   CDS             854993..855922
FT                   /transl_table=11
FT                   /locus_tag="AL1_07590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63331"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK69"
FT                   /protein_id="CBK63331.1"
FT   CDS             855919..857193
FT                   /transl_table=11
FT                   /locus_tag="AL1_07600"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63332"
FT                   /db_xref="GOA:D4IK70"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK70"
FT                   /protein_id="CBK63332.1"
FT   CDS             857274..857741
FT                   /transl_table=11
FT                   /locus_tag="AL1_07610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63333"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK71"
FT                   /protein_id="CBK63333.1"
FT   CDS             complement(857774..860902)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07620"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63334"
FT                   /db_xref="GOA:D4IK72"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK72"
FT                   /protein_id="CBK63334.1"
FT   CDS             complement(860899..863511)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63335"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK73"
FT                   /protein_id="CBK63335.1"
FT   CDS             complement(863628..864815)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63336"
FT                   /db_xref="InterPro:IPR029470"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK74"
FT                   /protein_id="CBK63336.1"
FT   CDS             complement(864896..866581)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07650"
FT                   /product="ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63337"
FT                   /db_xref="GOA:D4IK75"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK75"
FT                   /protein_id="CBK63337.1"
FT   CDS             complement(867800..873559)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07680"
FT                   /product="Distinct helicase family with a unique C-terminal
FT                   domain including a metal-binding cysteine cluster"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63338"
FT                   /db_xref="GOA:D4IK76"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK76"
FT                   /protein_id="CBK63338.1"
FT   CDS             complement(873567..876995)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63339"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK77"
FT                   /protein_id="CBK63339.1"
FT   CDS             877861..879063
FT                   /transl_table=11
FT                   /locus_tag="AL1_07700"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63340"
FT                   /db_xref="GOA:D4IK78"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK78"
FT                   /protein_id="CBK63340.1"
FT                   L"
FT   CDS             879145..>881274
FT                   /transl_table=11
FT                   /locus_tag="AL1_07710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63341"
FT                   /db_xref="GOA:D4IK79"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK79"
FT                   /protein_id="CBK63341.1"
FT                   VPKKRITDADKVNLVE"
FT   rRNA            881290..882801
FT                   /gene="16S"
FT                   /locus_tag="AL1_R_07750"
FT                   /product="16S rRNA"
FT   gap             882813..883275
FT                   /estimated_length=463
FT   rRNA            883349..886219
FT                   /gene="23S"
FT                   /locus_tag="AL1_R_07740"
FT                   /product="23S rRNA"
FT   rRNA            886334..886445
FT                   /gene="5S"
FT                   /locus_tag="AL1_R_07760"
FT                   /product="5S rRNA"
FT   CDS             886938..887684
FT                   /transl_table=11
FT                   /locus_tag="AL1_07770"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63342"
FT                   /db_xref="GOA:D4IK80"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK80"
FT                   /protein_id="CBK63342.1"
FT   CDS             887780..888673
FT                   /transl_table=11
FT                   /locus_tag="AL1_07780"
FT                   /product="Exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63343"
FT                   /db_xref="GOA:D4IK81"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK81"
FT                   /protein_id="CBK63343.1"
FT                   YSDHIPVELVLKHDSE"
FT   CDS             888741..889337
FT                   /transl_table=11
FT                   /locus_tag="AL1_07790"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63344"
FT                   /db_xref="GOA:D4IK82"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK82"
FT                   /protein_id="CBK63344.1"
FT   CDS             889409..890611
FT                   /transl_table=11
FT                   /locus_tag="AL1_07800"
FT                   /product="Fe2+-dicitrate sensor, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63345"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK83"
FT                   /protein_id="CBK63345.1"
FT                   R"
FT   CDS             890768..894115
FT                   /transl_table=11
FT                   /locus_tag="AL1_07810"
FT                   /product="Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63346"
FT                   /db_xref="GOA:D4IK84"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK84"
FT                   /protein_id="CBK63346.1"
FT                   TFGINITI"
FT   CDS             894132..895415
FT                   /transl_table=11
FT                   /locus_tag="AL1_07820"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63347"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK85"
FT                   /protein_id="CBK63347.1"
FT   CDS             895458..896417
FT                   /transl_table=11
FT                   /locus_tag="AL1_07830"
FT                   /product="Predicted periplasmic protein (DUF2233)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63348"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK86"
FT                   /protein_id="CBK63348.1"
FT   CDS             896423..898207
FT                   /transl_table=11
FT                   /locus_tag="AL1_07840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63349"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK87"
FT                   /protein_id="CBK63349.1"
FT                   QRGVSRDGKAVIGAWVNE"
FT   CDS             complement(899513..900109)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63350"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK88"
FT                   /protein_id="CBK63350.1"
FT   CDS             900672..901763
FT                   /transl_table=11
FT                   /locus_tag="AL1_07880"
FT                   /product="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63351"
FT                   /db_xref="GOA:D4IK89"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK89"
FT                   /protein_id="CBK63351.1"
FT   CDS             901820..903499
FT                   /transl_table=11
FT                   /locus_tag="AL1_07890"
FT                   /product="trehalose synthase"
FT                   /function="trehalose synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63352"
FT                   /db_xref="GOA:D4IK90"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK90"
FT                   /protein_id="CBK63352.1"
FT   CDS             complement(904568..905119)
FT                   /transl_table=11
FT                   /locus_tag="AL1_07900"
FT                   /product="RNA polymerase sigma factor, sigma-70 family/RNA
FT                   polymerase sigma-70 factor, Bacteroides expansion family 1"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63353"
FT                   /db_xref="GOA:D4IK91"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK91"
FT                   /protein_id="CBK63353.1"
FT   CDS             905308..905655
FT                   /transl_table=11
FT                   /locus_tag="AL1_07910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63354"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK92"
FT                   /protein_id="CBK63354.1"
FT                   SETYTLTQKAQ"
FT   CDS             905684..906661
FT                   /transl_table=11
FT                   /locus_tag="AL1_07920"
FT                   /product="Fe2+-dicitrate sensor, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63355"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK93"
FT                   /protein_id="CBK63355.1"
FT   gap             908843..908964
FT                   /estimated_length=122
FT   CDS             910275..911663
FT                   /transl_table=11
FT                   /locus_tag="AL1_07950"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63356"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK94"
FT                   /protein_id="CBK63356.1"
FT                   PGFN"
FT   CDS             911688..913703
FT                   /transl_table=11
FT                   /locus_tag="AL1_07960"
FT                   /product="Fibronectin type III domain./PQQ enzyme repeat."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63357"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR027295"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK95"
FT                   /protein_id="CBK63357.1"
FT   CDS             913762..914628
FT                   /transl_table=11
FT                   /locus_tag="AL1_07970"
FT                   /product="Sugar phosphate isomerases/epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63358"
FT                   /db_xref="GOA:D4IK96"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK96"
FT                   /protein_id="CBK63358.1"
FT                   ILGKMKK"
FT   CDS             916800..916910
FT                   /transl_table=11
FT                   /locus_tag="AL1_07990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63359"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK97"
FT                   /protein_id="CBK63359.1"
FT   CDS             916957..918576
FT                   /transl_table=11
FT                   /locus_tag="AL1_08000"
FT                   /product="Metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63360"
FT                   /db_xref="GOA:D4IK98"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK98"
FT                   /protein_id="CBK63360.1"
FT   CDS             918614..920302
FT                   /transl_table=11
FT                   /locus_tag="AL1_08010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63361"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D4IK99"
FT                   /protein_id="CBK63361.1"
FT   CDS             920404..921321
FT                   /transl_table=11
FT                   /locus_tag="AL1_08020"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63362"
FT                   /db_xref="GOA:D4IKA0"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA0"
FT                   /protein_id="CBK63362.1"
FT   CDS             921326..922696
FT                   /transl_table=11
FT                   /locus_tag="AL1_08030"
FT                   /product="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63363"
FT                   /db_xref="GOA:D4IKA1"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA1"
FT                   /protein_id="CBK63363.1"
FT   CDS             922693..923775
FT                   /transl_table=11
FT                   /locus_tag="AL1_08040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63364"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA2"
FT                   /protein_id="CBK63364.1"
FT   gap             924221..924928
FT                   /estimated_length=708
FT   CDS             925849..926133
FT                   /transl_table=11
FT                   /locus_tag="AL1_08050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63365"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA3"
FT                   /protein_id="CBK63365.1"
FT   CDS             complement(926923..927453)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08060"
FT                   /product="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63366"
FT                   /db_xref="GOA:D4IKA4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA4"
FT                   /protein_id="CBK63366.1"
FT                   GYHDEVMLQKIFD"
FT   CDS             complement(927453..928682)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08070"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63367"
FT                   /db_xref="GOA:D4IKA5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA5"
FT                   /protein_id="CBK63367.1"
FT                   MLIRNKIIGL"
FT   CDS             complement(928845..929726)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08080"
FT                   /product="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /function="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63368"
FT                   /db_xref="GOA:D4IKA6"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA6"
FT                   /protein_id="CBK63368.1"
FT                   DPNTVVESKSTL"
FT   gap             930332..930796
FT                   /estimated_length=465
FT   CDS             complement(932977..933777)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08120"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /function="glucosamine-6-phosphate deaminase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63369"
FT                   /db_xref="GOA:D4IKA7"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA7"
FT                   /protein_id="CBK63369.1"
FT   CDS             complement(933837..935786)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08130"
FT                   /product="6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63370"
FT                   /db_xref="GOA:D4IKA8"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA8"
FT                   /protein_id="CBK63370.1"
FT                   MAEYQAIEVFVKMF"
FT   CDS             complement(936034..936678)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63371"
FT                   /db_xref="GOA:D4IKA9"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKA9"
FT                   /protein_id="CBK63371.1"
FT   gap             937255..937456
FT                   /estimated_length=202
FT   CDS             complement(938064..939059)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63372"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB0"
FT                   /protein_id="CBK63372.1"
FT   CDS             complement(939083..940912)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08180"
FT                   /product="SusD family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63373"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB1"
FT                   /protein_id="CBK63373.1"
FT   CDS             complement(940936..944073)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08190"
FT                   /product="Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63374"
FT                   /db_xref="GOA:D4IKB2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB2"
FT                   /protein_id="CBK63374.1"
FT   CDS             complement(944102..947053)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08200"
FT                   /product="Lyase, catalytic./Polysaccharide lyase family 8,
FT                   super-sandwich domain./Lyase, N terminal."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63375"
FT                   /db_xref="GOA:D4IKB3"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012329"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015176"
FT                   /db_xref="InterPro:IPR015177"
FT                   /db_xref="InterPro:IPR024200"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB3"
FT                   /protein_id="CBK63375.1"
FT   CDS             947240..948454
FT                   /transl_table=11
FT                   /locus_tag="AL1_08210"
FT                   /product="Highly conserved protein containing a thioredoxin
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63376"
FT                   /db_xref="GOA:D4IKB4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB4"
FT                   /protein_id="CBK63376.1"
FT                   GEPLF"
FT   CDS             948466..951498
FT                   /transl_table=11
FT                   /locus_tag="AL1_08220"
FT                   /product="Lyase, catalytic./Polysaccharide lyase family 8,
FT                   super-sandwich domain./Lyase, N terminal."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63377"
FT                   /db_xref="GOA:D4IKB5"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012329"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015176"
FT                   /db_xref="InterPro:IPR015177"
FT                   /db_xref="InterPro:IPR024200"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB5"
FT                   /protein_id="CBK63377.1"
FT   CDS             951505..953043
FT                   /transl_table=11
FT                   /locus_tag="AL1_08230"
FT                   /product="Arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63378"
FT                   /db_xref="GOA:D4IKB6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB6"
FT                   /protein_id="CBK63378.1"
FT   CDS             953057..955633
FT                   /transl_table=11
FT                   /locus_tag="AL1_08240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63379"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB7"
FT                   /protein_id="CBK63379.1"
FT   CDS             955654..957903
FT                   /transl_table=11
FT                   /locus_tag="AL1_08250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63380"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB8"
FT                   /protein_id="CBK63380.1"
FT   CDS             complement(957980..958945)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08260"
FT                   /product="mannose-6-phosphate isomerase, type 1"
FT                   /function="mannose-6-phosphate isomerase, type 1"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63381"
FT                   /db_xref="GOA:D4IKB9"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKB9"
FT                   /protein_id="CBK63381.1"
FT   CDS             complement(958958..960064)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08270"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63382"
FT                   /db_xref="GOA:D4IKC0"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC0"
FT                   /protein_id="CBK63382.1"
FT   CDS             960966..961136
FT                   /transl_table=11
FT                   /locus_tag="AL1_08290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63383"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC1"
FT                   /protein_id="CBK63383.1"
FT                   RLSDCPGPCTP"
FT   CDS             complement(961285..961836)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08300"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63384"
FT                   /db_xref="GOA:D4IKC2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC2"
FT                   /protein_id="CBK63384.1"
FT   CDS             complement(961850..963586)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08310"
FT                   /product="acetolactate synthase, large subunit"
FT                   /function="acetolactate synthase, large subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63385"
FT                   /db_xref="GOA:D4IKC3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC3"
FT                   /protein_id="CBK63385.1"
FT                   FE"
FT   CDS             complement(963602..965428)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08320"
FT                   /product="dihydroxyacid dehydratase"
FT                   /function="dihydroxyacid dehydratase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63386"
FT                   /db_xref="GOA:D4IKC4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC4"
FT                   /protein_id="CBK63386.1"
FT   CDS             965521..965745
FT                   /transl_table=11
FT                   /locus_tag="AL1_08330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63387"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC5"
FT                   /protein_id="CBK63387.1"
FT   CDS             967240..968532
FT                   /transl_table=11
FT                   /locus_tag="AL1_08350"
FT                   /product="threonine synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63388"
FT                   /db_xref="GOA:D4IKC6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC6"
FT                   /protein_id="CBK63388.1"
FT   CDS             968670..969854
FT                   /transl_table=11
FT                   /locus_tag="AL1_08360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63389"
FT                   /db_xref="GOA:D4IKC7"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC7"
FT                   /protein_id="CBK63389.1"
FT   CDS             complement(969971..970225)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63390"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC8"
FT                   /protein_id="CBK63390.1"
FT   CDS             complement(970252..971322)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08380"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63391"
FT                   /db_xref="GOA:D4IKC9"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKC9"
FT                   /protein_id="CBK63391.1"
FT                   CPECVQLRFDFGNPET"
FT   CDS             971541..972155
FT                   /transl_table=11
FT                   /locus_tag="AL1_08390"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63392"
FT                   /db_xref="GOA:D4IKD0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023312"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD0"
FT                   /protein_id="CBK63392.1"
FT   CDS             complement(972353..973084)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08400"
FT                   /product="Uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63393"
FT                   /db_xref="GOA:D4IKD1"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD1"
FT                   /protein_id="CBK63393.1"
FT   CDS             complement(973092..975713)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08410"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63394"
FT                   /db_xref="GOA:D4IKD2"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD2"
FT                   /protein_id="CBK63394.1"
FT                   QL"
FT   CDS             complement(975710..977017)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08420"
FT                   /product="Alpha-L-fucosidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63395"
FT                   /db_xref="GOA:D4IKD3"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD3"
FT                   /protein_id="CBK63395.1"
FT   CDS             977074..977784
FT                   /transl_table=11
FT                   /locus_tag="AL1_08430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63396"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD4"
FT                   /protein_id="CBK63396.1"
FT                   VIARETGAENGGWL"
FT   CDS             977804..978268
FT                   /transl_table=11
FT                   /locus_tag="AL1_08440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63397"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD5"
FT                   /protein_id="CBK63397.1"
FT   CDS             979506..979721
FT                   /transl_table=11
FT                   /locus_tag="AL1_08450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63398"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD6"
FT                   /protein_id="CBK63398.1"
FT   CDS             979729..980088
FT                   /transl_table=11
FT                   /locus_tag="AL1_08460"
FT                   /product="RteC protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63399"
FT                   /db_xref="InterPro:IPR018534"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD7"
FT                   /protein_id="CBK63399.1"
FT                   QIYDSLTDKMDEMDK"
FT   CDS             980182..980526
FT                   /transl_table=11
FT                   /locus_tag="AL1_08470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63400"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD8"
FT                   /protein_id="CBK63400.1"
FT                   KQKYALNCVK"
FT   CDS             981581..981892
FT                   /transl_table=11
FT                   /locus_tag="AL1_08490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63401"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKD9"
FT                   /protein_id="CBK63401.1"
FT   CDS             981889..982218
FT                   /transl_table=11
FT                   /locus_tag="AL1_08500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63402"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE0"
FT                   /protein_id="CBK63402.1"
FT                   LPPTK"
FT   CDS             complement(982842..983069)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63403"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE1"
FT                   /protein_id="CBK63403.1"
FT   CDS             complement(983295..983681)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63404"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE2"
FT                   /protein_id="CBK63404.1"
FT   CDS             983680..983994
FT                   /transl_table=11
FT                   /locus_tag="AL1_08540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63405"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE3"
FT                   /protein_id="CBK63405.1"
FT                   "
FT   CDS             984005..984985
FT                   /transl_table=11
FT                   /locus_tag="AL1_08550"
FT                   /product="Antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63406"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE4"
FT                   /protein_id="CBK63406.1"
FT   CDS             985035..985268
FT                   /transl_table=11
FT                   /locus_tag="AL1_08560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63407"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE5"
FT                   /protein_id="CBK63407.1"
FT   CDS             985311..985622
FT                   /transl_table=11
FT                   /locus_tag="AL1_08570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63408"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE6"
FT                   /protein_id="CBK63408.1"
FT   CDS             985612..985974
FT                   /transl_table=11
FT                   /locus_tag="AL1_08580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63409"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE7"
FT                   /protein_id="CBK63409.1"
FT                   LHEKYLLNAGRGSQSY"
FT   CDS             985991..986392
FT                   /transl_table=11
FT                   /locus_tag="AL1_08590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63410"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE8"
FT                   /protein_id="CBK63410.1"
FT   CDS             986412..986852
FT                   /transl_table=11
FT                   /locus_tag="AL1_08600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63411"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKE9"
FT                   /protein_id="CBK63411.1"
FT   CDS             986857..987363
FT                   /transl_table=11
FT                   /locus_tag="AL1_08610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63412"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF0"
FT                   /protein_id="CBK63412.1"
FT                   EQTLF"
FT   CDS             987382..987684
FT                   /transl_table=11
FT                   /locus_tag="AL1_08620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63413"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF1"
FT                   /protein_id="CBK63413.1"
FT   CDS             987908..988492
FT                   /transl_table=11
FT                   /locus_tag="AL1_08630"
FT                   /product="RNA polymerase sigma factor, sigma-70 family/RNA
FT                   polymerase sigma-70 factor, Bacteroides expansion family 1"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63414"
FT                   /db_xref="GOA:D4IKF2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF2"
FT                   /protein_id="CBK63414.1"
FT   CDS             988688..989638
FT                   /transl_table=11
FT                   /locus_tag="AL1_08640"
FT                   /product="Fe2+-dicitrate sensor, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63415"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF3"
FT                   /protein_id="CBK63415.1"
FT   CDS             989917..993141
FT                   /transl_table=11
FT                   /locus_tag="AL1_08650"
FT                   /product="Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63416"
FT                   /db_xref="GOA:D4IKF4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF4"
FT                   /protein_id="CBK63416.1"
FT   CDS             993147..994727
FT                   /transl_table=11
FT                   /locus_tag="AL1_08660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63417"
FT                   /db_xref="InterPro:IPR024302"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF5"
FT                   /protein_id="CBK63417.1"
FT                   TWWDCKPLN"
FT   CDS             994737..995654
FT                   /transl_table=11
FT                   /locus_tag="AL1_08670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63418"
FT                   /db_xref="GOA:D4IKF6"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF6"
FT                   /protein_id="CBK63418.1"
FT   CDS             995654..996274
FT                   /transl_table=11
FT                   /locus_tag="AL1_08680"
FT                   /product="Domain of unknown function (DUF1735)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63419"
FT                   /db_xref="InterPro:IPR013728"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF7"
FT                   /protein_id="CBK63419.1"
FT   CDS             996351..996929
FT                   /transl_table=11
FT                   /locus_tag="AL1_08690"
FT                   /product="Pentaxin family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63420"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF8"
FT                   /protein_id="CBK63420.1"
FT   CDS             997013..998476
FT                   /transl_table=11
FT                   /locus_tag="AL1_08700"
FT                   /product="Glycosyl hydrolases family 18."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63421"
FT                   /db_xref="GOA:D4IKF9"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR013728"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKF9"
FT                   /protein_id="CBK63421.1"
FT   CDS             998596..999474
FT                   /transl_table=11
FT                   /locus_tag="AL1_08710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63422"
FT                   /db_xref="GOA:D4IKG0"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG0"
FT                   /protein_id="CBK63422.1"
FT                   TGTTYTKDYGN"
FT   CDS             999742..1000506
FT                   /transl_table=11
FT                   /locus_tag="AL1_08720"
FT                   /product="Glycosyl hydrolases family 18."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63423"
FT                   /db_xref="GOA:D4IKG1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG1"
FT                   /protein_id="CBK63423.1"
FT   CDS             1000740..1001411
FT                   /transl_table=11
FT                   /locus_tag="AL1_08730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63424"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG2"
FT                   /protein_id="CBK63424.1"
FT                   L"
FT   CDS             complement(1001560..1001985)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63425"
FT                   /db_xref="InterPro:IPR024355"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG3"
FT                   /protein_id="CBK63425.1"
FT   CDS             complement(1001997..1002158)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08750"
FT                   /product="DNA N-6-adenine-methyltransferase (Dam)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63426"
FT                   /db_xref="GOA:D4IKG4"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG4"
FT                   /protein_id="CBK63426.1"
FT                   VVFKGYNK"
FT   CDS             complement(1002460..1003350)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08760"
FT                   /product="DNA-methyltransferase (dcm)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63427"
FT                   /db_xref="GOA:D4IKG5"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG5"
FT                   /protein_id="CBK63427.1"
FT                   IVERVAARIKQTTLL"
FT   CDS             complement(1003357..1003947)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08770"
FT                   /product="Conjugative transposon protein TraO."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63428"
FT                   /db_xref="InterPro:IPR018899"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG6"
FT                   /protein_id="CBK63428.1"
FT   CDS             complement(1003950..1004852)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63429"
FT                   /db_xref="InterPro:IPR022298"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG7"
FT                   /protein_id="CBK63429.1"
FT   CDS             complement(1005463..1006062)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63430"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG8"
FT                   /protein_id="CBK63430.1"
FT   CDS             complement(1006066..1006296)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63431"
FT                   /db_xref="InterPro:IPR025050"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKG9"
FT                   /protein_id="CBK63431.1"
FT   CDS             complement(1006286..1006909)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63432"
FT                   /db_xref="InterPro:IPR022276"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH0"
FT                   /protein_id="CBK63432.1"
FT   CDS             complement(1006925..1007923)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08830"
FT                   /product="Homologues of TraJ from Bacteroides conjugative
FT                   transposon."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63433"
FT                   /db_xref="InterPro:IPR012424"
FT                   /db_xref="InterPro:IPR022393"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH1"
FT                   /protein_id="CBK63433.1"
FT   CDS             complement(1008579..1008980)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63434"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH2"
FT                   /protein_id="CBK63434.1"
FT   gap             1010683..1011875
FT                   /estimated_length=1193
FT   CDS             complement(1012515..1012685)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63435"
FT                   /db_xref="InterPro:IPR024451"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH3"
FT                   /protein_id="CBK63435.1"
FT                   TGEDYEAMHAT"
FT   CDS             complement(1012678..1012998)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63436"
FT                   /db_xref="InterPro:IPR025407"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH4"
FT                   /protein_id="CBK63436.1"
FT                   HV"
FT   CDS             complement(1013373..1013474)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63437"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH5"
FT                   /protein_id="CBK63437.1"
FT   CDS             complement(1014264..1014626)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08930"
FT                   /product="Protein of unknown function (DUF3408)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63438"
FT                   /db_xref="InterPro:IPR021823"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH6"
FT                   /protein_id="CBK63438.1"
FT                   HKSDINEISRRHADIL"
FT   CDS             complement(1014623..1015066)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08940"
FT                   /product="Protein of unknown function (DUF3408)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63439"
FT                   /db_xref="InterPro:IPR021823"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH7"
FT                   /protein_id="CBK63439.1"
FT   CDS             complement(1015070..1015831)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08950"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63440"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH8"
FT                   /protein_id="CBK63440.1"
FT   gap             1015992..1016597
FT                   /estimated_length=606
FT   CDS             1016979..1017137
FT                   /transl_table=11
FT                   /locus_tag="AL1_08960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63441"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKH9"
FT                   /protein_id="CBK63441.1"
FT                   IVGRIFG"
FT   CDS             1017374..1018828
FT                   /transl_table=11
FT                   /locus_tag="AL1_08970"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63442"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI0"
FT                   /protein_id="CBK63442.1"
FT   CDS             complement(1018895..1019356)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63443"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI1"
FT                   /protein_id="CBK63443.1"
FT   CDS             complement(1020778..1020966)
FT                   /transl_table=11
FT                   /locus_tag="AL1_08990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63444"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI2"
FT                   /protein_id="CBK63444.1"
FT                   RKTYKKKLFNPGKIISF"
FT   CDS             complement(1020959..1021705)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09000"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63445"
FT                   /db_xref="GOA:D4IKI3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI3"
FT                   /protein_id="CBK63445.1"
FT   CDS             complement(1021725..1023182)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09010"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63446"
FT                   /db_xref="GOA:D4IKI4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI4"
FT                   /protein_id="CBK63446.1"
FT   CDS             1023499..1023660
FT                   /transl_table=11
FT                   /locus_tag="AL1_09020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63447"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI5"
FT                   /protein_id="CBK63447.1"
FT                   RAKKPKRA"
FT   CDS             complement(1023781..1024125)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63448"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI6"
FT                   /protein_id="CBK63448.1"
FT                   IRKAPRVVVR"
FT   CDS             complement(1024138..1024443)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63449"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI7"
FT                   /protein_id="CBK63449.1"
FT   CDS             complement(1024546..1024749)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09050"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63450"
FT                   /db_xref="GOA:D4IKI8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI8"
FT                   /protein_id="CBK63450.1"
FT   CDS             1025023..1026252
FT                   /transl_table=11
FT                   /locus_tag="AL1_09060"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63451"
FT                   /db_xref="GOA:D4IKI9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKI9"
FT                   /protein_id="CBK63451.1"
FT                   EATKDLKLIL"
FT   CDS             1026278..1027480
FT                   /transl_table=11
FT                   /locus_tag="AL1_09070"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63452"
FT                   /db_xref="GOA:D4IKJ0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ0"
FT                   /protein_id="CBK63452.1"
FT                   Y"
FT   CDS             1027487..1027849
FT                   /transl_table=11
FT                   /locus_tag="AL1_09080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63453"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ1"
FT                   /protein_id="CBK63453.1"
FT                   TSPPLLVCYGKGGWYS"
FT   CDS             complement(1028166..1028285)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63454"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ2"
FT                   /protein_id="CBK63454.1"
FT   CDS             complement(1029240..1030937)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09110"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63455"
FT                   /db_xref="GOA:D4IKJ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ3"
FT                   /protein_id="CBK63455.1"
FT   CDS             complement(1030941..1032686)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09120"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63456"
FT                   /db_xref="GOA:D4IKJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ4"
FT                   /protein_id="CBK63456.1"
FT                   KEEEV"
FT   CDS             1032888..1035263
FT                   /transl_table=11
FT                   /locus_tag="AL1_09130"
FT                   /product="Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63457"
FT                   /db_xref="GOA:D4IKJ5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ5"
FT                   /protein_id="CBK63457.1"
FT   CDS             1035282..1035890
FT                   /transl_table=11
FT                   /locus_tag="AL1_09140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63458"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ6"
FT                   /protein_id="CBK63458.1"
FT   CDS             1036113..1037021
FT                   /transl_table=11
FT                   /locus_tag="AL1_09150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63459"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ7"
FT                   /protein_id="CBK63459.1"
FT   CDS             1037147..1037434
FT                   /transl_table=11
FT                   /locus_tag="AL1_09160"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63460"
FT                   /db_xref="GOA:D4IKJ8"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ8"
FT                   /protein_id="CBK63460.1"
FT   CDS             1037440..1038513
FT                   /transl_table=11
FT                   /locus_tag="AL1_09170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63461"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKJ9"
FT                   /protein_id="CBK63461.1"
FT                   MIVKEGKGYRYNPDFHY"
FT   CDS             1038677..1039642
FT                   /transl_table=11
FT                   /locus_tag="AL1_09180"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63462"
FT                   /db_xref="GOA:D4IKK0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK0"
FT                   /protein_id="CBK63462.1"
FT   CDS             1039788..1040171
FT                   /transl_table=11
FT                   /locus_tag="AL1_09190"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63463"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK1"
FT                   /protein_id="CBK63463.1"
FT   CDS             1040137..1041060
FT                   /transl_table=11
FT                   /locus_tag="AL1_09200"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63464"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK2"
FT                   /protein_id="CBK63464.1"
FT   CDS             1041065..1041784
FT                   /transl_table=11
FT                   /locus_tag="AL1_09210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63465"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK3"
FT                   /protein_id="CBK63465.1"
FT                   NEQAEQLKKEADKLGKP"
FT   CDS             complement(1041840..1042199)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63466"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK4"
FT                   /protein_id="CBK63466.1"
FT                   TLRQFEKEHCTKKKK"
FT   CDS             complement(1042983..1043114)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63467"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK5"
FT                   /protein_id="CBK63467.1"
FT   CDS             complement(1043200..1045491)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63468"
FT                   /db_xref="GOA:D4IKK6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK6"
FT                   /protein_id="CBK63468.1"
FT                   KGVDTSRFRY"
FT   CDS             complement(1046403..1046834)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09270"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63469"
FT                   /db_xref="GOA:D4IKK7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK7"
FT                   /protein_id="CBK63469.1"
FT   CDS             complement(1047507..1048079)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09280"
FT                   /product="cAMP-binding proteins-catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63470"
FT                   /db_xref="GOA:D4IKK8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK8"
FT                   /protein_id="CBK63470.1"
FT   CDS             complement(1048311..1049465)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09290"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63471"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKK9"
FT                   /protein_id="CBK63471.1"
FT   CDS             complement(1049491..1050714)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09300"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63472"
FT                   /db_xref="GOA:D4IKL0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL0"
FT                   /protein_id="CBK63472.1"
FT                   NSLPELKF"
FT   CDS             1051701..1052681
FT                   /transl_table=11
FT                   /locus_tag="AL1_09320"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63473"
FT                   /db_xref="GOA:D4IKL1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL1"
FT                   /protein_id="CBK63473.1"
FT   CDS             1052773..1053006
FT                   /transl_table=11
FT                   /locus_tag="AL1_09330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63474"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL2"
FT                   /protein_id="CBK63474.1"
FT   CDS             1053035..1053355
FT                   /transl_table=11
FT                   /locus_tag="AL1_09340"
FT                   /product="RteC protein."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63475"
FT                   /db_xref="InterPro:IPR018534"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL3"
FT                   /protein_id="CBK63475.1"
FT                   KR"
FT   CDS             complement(1053443..1053859)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63476"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL4"
FT                   /protein_id="CBK63476.1"
FT   CDS             1053906..1054130
FT                   /transl_table=11
FT                   /locus_tag="AL1_09360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63477"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL5"
FT                   /protein_id="CBK63477.1"
FT   CDS             1054556..1054984
FT                   /transl_table=11
FT                   /locus_tag="AL1_09370"
FT                   /product="Protein of unknown function (DUF3408)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63478"
FT                   /db_xref="InterPro:IPR021823"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL6"
FT                   /protein_id="CBK63478.1"
FT   CDS             1055572..1056591
FT                   /transl_table=11
FT                   /locus_tag="AL1_09380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63479"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL7"
FT                   /protein_id="CBK63479.1"
FT   CDS             1056597..1058345
FT                   /transl_table=11
FT                   /locus_tag="AL1_09390"
FT                   /product="Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63480"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL8"
FT                   /protein_id="CBK63480.1"
FT                   RKQSKF"
FT   CDS             1058435..1059304
FT                   /transl_table=11
FT                   /locus_tag="AL1_09400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63481"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKL9"
FT                   /protein_id="CBK63481.1"
FT                   QKLPKNKK"
FT   CDS             1059312..1059821
FT                   /transl_table=11
FT                   /locus_tag="AL1_09410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63482"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM0"
FT                   /protein_id="CBK63482.1"
FT                   DRKQNK"
FT   CDS             1059826..1060422
FT                   /transl_table=11
FT                   /locus_tag="AL1_09420"
FT                   /product="Putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63483"
FT                   /db_xref="GOA:D4IKM1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM1"
FT                   /protein_id="CBK63483.1"
FT   CDS             1060436..1061161
FT                   /transl_table=11
FT                   /locus_tag="AL1_09430"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63484"
FT                   /db_xref="GOA:D4IKM2"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM2"
FT                   /protein_id="CBK63484.1"
FT   CDS             1061172..1061534
FT                   /transl_table=11
FT                   /locus_tag="AL1_09440"
FT                   /product="Predicted lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63485"
FT                   /db_xref="GOA:D4IKM3"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM3"
FT                   /protein_id="CBK63485.1"
FT                   PDGHWLEFYQRLPFSD"
FT   CDS             complement(1062269..1063339)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63486"
FT                   /db_xref="GOA:D4IKM4"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM4"
FT                   /protein_id="CBK63486.1"
FT                   FHLAKHRKFYKCQIIN"
FT   CDS             complement(1063547..1063645)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63487"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM5"
FT                   /protein_id="CBK63487.1"
FT                   /translation="MLKRKIDDYIRNYYGSTFGFQYLAKRGKMIDF"
FT   CDS             1064654..1065073
FT                   /transl_table=11
FT                   /locus_tag="AL1_09470"
FT                   /product="Outer membrane cobalamin receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63488"
FT                   /db_xref="GOA:D4IKM6"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM6"
FT                   /protein_id="CBK63488.1"
FT   CDS             1065070..1065465
FT                   /transl_table=11
FT                   /locus_tag="AL1_09480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63489"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM7"
FT                   /protein_id="CBK63489.1"
FT   CDS             complement(1065750..1066121)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63490"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM8"
FT                   /protein_id="CBK63490.1"
FT   CDS             complement(1066137..1066403)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63491"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKM9"
FT                   /protein_id="CBK63491.1"
FT   CDS             complement(1066400..1066735)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63492"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN0"
FT                   /protein_id="CBK63492.1"
FT                   QKGGADV"
FT   CDS             1067629..1067820
FT                   /transl_table=11
FT                   /locus_tag="AL1_09530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63493"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN1"
FT                   /protein_id="CBK63493.1"
FT                   AEFFDEMSRQAKEHFDHA"
FT   CDS             1067927..1068109
FT                   /transl_table=11
FT                   /locus_tag="AL1_09540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63494"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN2"
FT                   /protein_id="CBK63494.1"
FT                   GVIVRDMANTALLAE"
FT   CDS             complement(1068895..1069161)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63495"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN3"
FT                   /protein_id="CBK63495.1"
FT   CDS             1069329..1070561
FT                   /transl_table=11
FT                   /locus_tag="AL1_09570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63496"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN4"
FT                   /protein_id="CBK63496.1"
FT                   FKGYPEGWRNE"
FT   CDS             1070693..1073437
FT                   /transl_table=11
FT                   /locus_tag="AL1_09580"
FT                   /product="Outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63497"
FT                   /db_xref="GOA:D4IKN5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR027804"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN5"
FT                   /protein_id="CBK63497.1"
FT   CDS             complement(1073434..1073616)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63498"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN6"
FT                   /protein_id="CBK63498.1"
FT                   PGVKYVCLKGILSVY"
FT   CDS             1073615..1075174
FT                   /transl_table=11
FT                   /locus_tag="AL1_09600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63499"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN7"
FT                   /protein_id="CBK63499.1"
FT                   VF"
FT   CDS             1075264..1075458
FT                   /transl_table=11
FT                   /locus_tag="AL1_09610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63500"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN8"
FT                   /protein_id="CBK63500.1"
FT   CDS             1075480..1075902
FT                   /transl_table=11
FT                   /locus_tag="AL1_09620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63501"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKN9"
FT                   /protein_id="CBK63501.1"
FT   CDS             1075912..1076622
FT                   /transl_table=11
FT                   /locus_tag="AL1_09630"
FT                   /product="Cytochrome C biogenesis protein transmembrane
FT                   region."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63502"
FT                   /db_xref="GOA:D4IKP0"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP0"
FT                   /protein_id="CBK63502.1"
FT                   FILAGIYYFVIYYI"
FT   CDS             1076632..1076958
FT                   /transl_table=11
FT                   /locus_tag="AL1_09640"
FT                   /product="Cupin domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63503"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP1"
FT                   /protein_id="CBK63503.1"
FT                   MIKG"
FT   CDS             complement(1077384..1078856)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09660"
FT                   /product="Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63504"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP2"
FT                   /protein_id="CBK63504.1"
FT   CDS             complement(1078910..1080364)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09670"
FT                   /product="Plasmid recombination enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63505"
FT                   /db_xref="GOA:D4IKP3"
FT                   /db_xref="InterPro:IPR001668"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP3"
FT                   /protein_id="CBK63505.1"
FT   CDS             complement(1080582..1081406)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63506"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP4"
FT                   /protein_id="CBK63506.1"
FT   CDS             complement(1081418..1081984)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63507"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP5"
FT                   /protein_id="CBK63507.1"
FT   CDS             complement(1081984..1082355)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63508"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP6"
FT                   /protein_id="CBK63508.1"
FT   CDS             complement(1082391..1082810)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63509"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP7"
FT                   /protein_id="CBK63509.1"
FT   CDS             1084142..1084771
FT                   /transl_table=11
FT                   /locus_tag="AL1_09730"
FT                   /product="Resolvase, N terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63510"
FT                   /db_xref="GOA:D4IKP8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP8"
FT                   /protein_id="CBK63510.1"
FT   CDS             1085061..1085351
FT                   /transl_table=11
FT                   /locus_tag="AL1_09740"
FT                   /product="Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63511"
FT                   /db_xref="GOA:D4IKP9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKP9"
FT                   /protein_id="CBK63511.1"
FT   CDS             complement(1085478..1085756)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63512"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ0"
FT                   /protein_id="CBK63512.1"
FT   CDS             complement(1086165..1086689)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63513"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ1"
FT                   /protein_id="CBK63513.1"
FT                   GWKIRRRKLHA"
FT   CDS             complement(1087054..1087434)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09780"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63514"
FT                   /db_xref="GOA:D4IKQ2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ2"
FT                   /protein_id="CBK63514.1"
FT   CDS             complement(1088244..1088501)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63515"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ3"
FT                   /protein_id="CBK63515.1"
FT   CDS             complement(1088504..1089013)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63516"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ4"
FT                   /protein_id="CBK63516.1"
FT                   VIVEVP"
FT   CDS             complement(1089030..1089326)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63517"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ5"
FT                   /protein_id="CBK63517.1"
FT   CDS             1089395..1089568
FT                   /transl_table=11
FT                   /locus_tag="AL1_09820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63518"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ6"
FT                   /protein_id="CBK63518.1"
FT                   LCDTILIRQTES"
FT   CDS             complement(1090005..1090451)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09830"
FT                   /product="PIN domain."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63519"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ7"
FT                   /protein_id="CBK63519.1"
FT   CDS             complement(1090554..1092725)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09840"
FT                   /product="helicase, putative, RecD/TraA family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63520"
FT                   /db_xref="GOA:D4IKQ8"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ8"
FT                   /protein_id="CBK63520.1"
FT   CDS             1092781..1093113
FT                   /transl_table=11
FT                   /locus_tag="AL1_09850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63521"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKQ9"
FT                   /protein_id="CBK63521.1"
FT                   FHDIKF"
FT   gap             1093567..1094695
FT                   /estimated_length=1129
FT   CDS             complement(1094775..1095212)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63522"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKR0"
FT                   /protein_id="CBK63522.1"
FT   CDS             complement(1095218..1095541)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63523"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKR1"
FT                   /protein_id="CBK63523.1"
FT                   DNS"
FT   CDS             complement(1095590..1095889)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63524"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKR2"
FT                   /protein_id="CBK63524.1"
FT   CDS             complement(1098600..1100639)
FT                   /transl_table=11
FT                   /locus_tag="AL1_09950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63525"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021459"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKR3"
FT                   /protein_id="CBK63525.1"
FT   CDS             1106646..1108031
FT                   /transl_table=11
FT                   /locus_tag="AL1_09980"
FT                   /product="F5/8 type C domain./Domain of unknown function
FT                   (DUF1735)."
FT                   /db_xref="EnsemblGenomes-Gn:AL1_09980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63526"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013728"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKR4"
FT                   /protein_id="CBK63526.1"
FT                   IGF"
FT   CDS             1109360..1110541
FT                   /transl_table=11
FT                   /locus_tag="AL1_10000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_10000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63527"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKR5"
FT                   /protein_id="CBK63527.1"
FT   CDS             1110581..1112029
FT                   /transl_table=11
FT                   /locus_tag="AL1_10010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_10010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63528"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKR6"
FT                   /protein_id="CBK63528.1"
FT   CDS             1112051..1113826
FT                   /transl_table=11
FT                   /locus_tag="AL1_10020"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_10020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63529"
FT                   /db_xref="GOA:D4IKR7"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKR7"
FT                   /protein_id="CBK63529.1"
FT                   FITTDRPDLFLRLVR"
FT   CDS             1113850..1115109
FT                   /transl_table=11
FT                   /locus_tag="AL1_10030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AL1_10030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK63530"
FT                   /db_xref="UniProtKB/TrEMBL:D4IKR8"
FT                   /protein_id="CBK63530.1"