spacer

EBI Dbfetch

ID   CR942285; SV 1; circular; genomic DNA; STD; PRO; 98396 BP.
XX
AC   CR942285;
XX
DT   05-DEC-2005 (Rel. 86, Created)
DT   23-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Escherichia coli plasmid pCoo
XX
KW   Enterotoxigenic Escherichia coli, ETEC, CS1 pilus.
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-98396
RX   DOI; 10.1128/JB.187.18.6509-6516.2005.
RX   PUBMED; 16159784.
RA   Froehlich B., Parkhill J., Sanders M., Quail M.A., Scott J.R.;
RT   "The pCoo plasmid of enterotoxigenic Escherichia coli is a mosaic
RT   cointegrate";
RL   J. Bacteriol. 187(18):6509-6516(2005).
XX
RN   [2]
RP   1-98396
RA   Parkhill J.;
RT   ;
RL   Submitted (11-APR-2005) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail:
RL   parkhill@sanger.ac.uk
XX
DR   MD5; 9a64eb157f0b540242bf426a15914db7.
DR   EuropePMC; PMC1236633; 16159784.
DR   EuropePMC; PMC2579436; 18854044.
DR   EuropePMC; PMC2786348; 19786598.
DR   EuropePMC; PMC3535984; 23070168.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00042; CopA.
DR   RFAM; RF01087; PK-repZ.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01794; sok.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..98396
FT                   /organism="Escherichia coli"
FT                   /strain="JEF100"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562"
FT   CDS             379..468
FT                   /transl_table=11
FT                   /gene="repY"
FT                   /locus_tag="pCoo001"
FT                   /product="RepY protein"
FT                   /note="Similar to Salmonella typhimurium R64 RepY protein
FT                   repY SWALL:Q9Z4G6 (EMBL:AP005147) (29 aa) fasta scores:
FT                   E(): 1.3e-13, 96.55% id in 29 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP46"
FT                   /protein_id="CAI79483.1"
FT                   /translation="MKPYQRFNPVQCINTLHNRSAISDSLWQV"
FT   CDS             456..1487
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /gene_synonym="repZ"
FT                   /locus_tag="pCoo002"
FT                   /product="replication initiation protein"
FT                   /note="Similar to Escherichia coli replication initiation
FT                   protein repA SWALL:REP8_ECOLI (SWALL:Q52346) (343 aa) fasta
FT                   scores: E(): 5.6e-128, 97.37% id in 343 aa, and to
FT                   Salmonella typhimurium R64 RepZ protein repZ SWALL:BAB91568
FT                   (EMBL:AP005147) (343 aa) fasta scores: E(): 1.1e-123,
FT                   93.58% id in 343 aa"
FT                   /db_xref="GOA:Q2VP45"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP45"
FT                   /protein_id="CAI79484.1"
FT                   /translation="MAGLKNTPYNAVHWSQLAHEEQIRFWEDYETGRATSFLVEPERKL
FT                   TNRRRGEHSTKPKCENPSWYRPERYKALSGQLGHAYNRLVKKDPVTGEQSLRMHMSLHP
FT                   FYVQKRTYAGRKYAFRPEKQRLLDAIWPVLVCFSDAGTHTVGMSVSRLAREISPKDSKG
FT                   KVIPELEVTVSRLSRLLAEQVRFGVLGVSEETLWDRETRQRLPRYVWITPAGWQMLGVD
FT                   MVKLHEQQQKRLRESEIRQQLIREGVLREDEDISVHAARKRWYLQRSQDALKHRRAKAA
FT                   ASKRARRLKKLPADQQIHEMAEYLRKRLPPDEAYFCSDDHLKRLAIRELRQLELTLAAP
FT                   PPH"
FT   repeat_region   1961..2331
FT                   /rpt_type=DIRECT
FT                   /note="rep2; imperfect"
FT   CDS             2396..2665
FT                   /transl_table=11
FT                   /locus_tag="pCoo003"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Shigella sonnei ColIb-P9 YacA protein
FT                   yacA SWALL:Q9Z4G5 (EMBL:AB021078) (89 aa) fasta scores:
FT                   E(): 2.2e-31, 95.5% id in 89 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP44"
FT                   /protein_id="CAI79485.1"
FT                   /translation="MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQH
FT                   NTWFRDQVAAGRQQLEHGDVLPHDMVESSAAAWRDEMSRKIAGK"
FT   CDS             2662..2856
FT                   /transl_table=11
FT                   /locus_tag="pCoo004"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Shigella sonnei YacB protein yacB
FT                   SWALL:Q9Z4G4 (EMBL:AB021078) (93 aa) fasta scores: E():
FT                   7.1e-11, 76% id in 50 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP43"
FT                   /protein_id="CAI79486.1"
FT                   /translation="MMEIFWTMLASQDRKRIREYIAEQNLMVAIELDERIGYFGRTYRL
FT                   TPGFGGFTPVLHVTSYTHK"
FT   misc_feature    2674..2775
FT                   /note="Pfam match to entry PF05016 Plasmid_stabil, , score
FT                   29.3, E-value 8.1e-08"
FT   repeat_region   2787..2841
FT                   /rpt_type=DIRECT
FT                   /note="rep2a"
FT   CDS             2884..3582
FT                   /transl_table=11
FT                   /locus_tag="pCoo005"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP42"
FT                   /protein_id="CAI79487.1"
FT                   /translation="MTIESCFIGTRLSGKRYGPQSGDMQVSEFISLISPQNAPHKVVLP
FT                   DFTGLASRLDAQIRKQFHQLKEDEHFLRYRQLSERWYQAGSISDRNNRSKRFEKIMDDS
FT                   LDFLLYSQDVMPNINPDNLQYHDYEKVSSKGKMYCVALLFHVIARAAYEPESVGADPTL
FT                   PEYCRWMKNWIKKTLGHDFLERIMINYALFNPAYFPALQRLSGEKETRDAHTFLADSLA
FT                   RACNCFSSIN"
FT   repeat_region   3767..5046
FT                   /note="IS element"
FT   CDS             complement(join(3913..4044,4048..4161,4165..4917))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo006"
FT                   /product="IS element transposase (pseudogene)"
FT                   /note="Similar to Shigella flexneri 2a is1328 transposase
FT                   SWALL:Q93EZ2 (EMBL:AF326777) (334 aa) fasta scores: E():
FT                   3.1e-113, 87.42% id in 334 aa"
FT                   /db_xref="PSEUDO:CAI79488.1"
FT   misc_feature    complement(4033..4365)
FT                   /note="Pfam match to entry PF02371 Transposase_20, , score
FT                   133.4, E-value 5e-37"
FT   misc_feature    complement(4477..4659)
FT                   /note="Pfam match to entry PF01548 Transposase_9, , score
FT                   18.9, E-value 0.00014"
FT   CDS             join(5047..5280,5283..5729,5729..5866)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo007"
FT                   /product="IS3 family transposase"
FT                   /note="Similar to Agrobacterium tumefaciens is3 family
FT                   transposase SWALL:Q8UDL7 (EMBL:AE009161) (512 aa) fasta
FT                   scores: E(): 3.6e-69, 60.21% id in 274 aa"
FT                   /db_xref="PSEUDO:CAI79489.1"
FT   misc_feature    5377..5862
FT                   /note="Pfam match to entry PF00665 rve, , score 101.0,
FT                   E-value 3e-27"
FT   CDS             complement(5903..6004)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo008"
FT                   /product="IS629-family transposase (fragment)"
FT                   /note="Similar to Shigella flexneri, and Shigella flexneri
FT                   2a is629 orf tnpc or cp0272 SWALL:Q9AFI8 (EMBL:AF348706)
FT                   (55 aa) fasta scores: E(): 3.9e-08, 70.58% id in 34 aa"
FT   repeat_region   complement(5904..6050)
FT                   /rpt_type=INVERTED
FT                   /note="rep4; imperfect"
FT   CDS             join(6261..6364,8617..9229)
FT                   /transl_table=11
FT                   /gene="cooB"
FT                   /gene_synonym="csoB"
FT                   /locus_tag="pCoo009"
FT                   /product="CS1 fimbrial subunit B precursor"
FT                   /note="Similar to Escherichia coli cs1 fimbrial subunit b
FT                   precursor csob or cooB SWALL:CSOB_ECOLI (SWALL:P25731) (238
FT                   aa) fasta scores: E(): 1.5e-88, 100% id in 238 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAZ0"
FT                   /protein_id="CAI79491.1"
FT                   /translation="MRKLFLSLLMIPFVAKANFMIYPISKEIKGGSSELIRIYSKSKDT
FT                   QYIKVYTKKVLNPGTKEEYEVDTPNWEGGLVTTPSKVILPGGGSKSVRLSQLKDISSED
FT                   VYRVYFESIKPEKQDGLSKNKSLKTDLSVNIIYAALIRVLPKDGKSDMRASLSPKSSLL
FT                   IKNTGNVRVGIKDAFFCKKTSINNDDCIKKTYNKNIYPGSSFDTGVIQNGFSHIFIDSV
FT                   DGSAGKQGKRMLISIH"
FT   repeat_region   6365..6512
FT                   /rpt_type=INVERTED
FT                   /note="rep1"
FT   misc_feature    6365..8616
FT                   /note="kanamycin resistance cassette; artifical insertion"
FT   CDS             complement(6519..6725)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo010"
FT                   /product="integrase (pseudogene)"
FT                   /note="part of artificial marker insertion in cooB"
FT                   /note="Similar to Escherichia coli Inti1 inti1
FT                   SWALL:AAQ75566 (EMBL:AY214164) (193 aa) fasta scores: E():
FT                   4.8e-15, 97.87% id in 47 aa"
FT   misc_feature    complement(6525..6665)
FT                   /note="Pfam match to entry PF00589 Phage_integrase, , score
FT                   25.4, E-value 7.4e-07"
FT   CDS             complement(6817..7602)
FT                   /transl_table=11
FT                   /gene="aphA"
FT                   /locus_tag="pCoo011"
FT                   /product="aminoglycoside 3'-phosphotransferase (Kanamycin
FT                   resistance-artifical insertion)"
FT                   /EC_number="2.7.1.95"
FT                   /note="Artificial insertion of Kanamycin resistance marker
FT                   gene in cooB"
FT                   /note="Similar to Enterococcus faecalis aminoglycoside
FT                   3'-phosphotransferase aphA SWALL:KKA3_ENTFA (SWALL:P00554)
FT                   (264 aa) fasta scores: E(): 4.8e-107, 100% id in 261 aa"
FT                   /db_xref="GOA:Q2VP40"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024165"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP40"
FT                   /protein_id="CAI79493.1"
FT                   /translation="MRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKMTDS
FT                   RYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYEDEQS
FT                   PEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDTPFK
FT                   DPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIAFCV
FT                   RSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"
FT   misc_feature    complement(6841..7560)
FT                   /note="Pfam match to entry PF01636 APH, , score 223.9,
FT                   E-value 2.9e-64"
FT   CDS             complement(join(7707..7943,7945..8178))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="sat4"
FT                   /locus_tag="pCoo012"
FT                   /product="streptothricin acetyltransferase (pseudogene)"
FT                   /note="part of artificial marker insertion in cooB"
FT                   /note="Similar to Staphylococcus intermedius streptothricin
FT                   acetyltransferase sat4 SWALL:Q9EZB9 (EMBL:AF299292) (176
FT                   aa) fasta scores: E(): 3.7e-29, 86.22% id in 167 aa"
FT   misc_feature    complement(7786..8031)
FT                   /note="Pfam match to entry PF00583.9 Acetyltransf_1, ,
FT                   score 56.4, E-value 7.8e-14"
FT   repeat_region   complement(8469..8616)
FT                   /rpt_type=INVERTED
FT                   /note="rep1"
FT   CDS             9280..9795
FT                   /transl_table=11
FT                   /gene="cooA"
FT                   /gene_synonym="csoA"
FT                   /locus_tag="pCoo013"
FT                   /product="CS1 fimbrial subunit A precursor"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   cs1 fimbrial subunit a precursor csoa or cooA
FT                   SWALL:FMS1_ECOLI (SWALL:P25730) (171 aa) fasta scores: E():
FT                   2.5e-56, 100% id in 171 aa"
FT                   /db_xref="GOA:Q6JAY9"
FT                   /db_xref="InterPro:IPR007540"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAY9"
FT                   /protein_id="CAI79495.1"
FT                   /translation="MKLKKTIGAMALATLFATMGASAVEKTISVTASVDPTVDLLQSDG
FT                   SALPNSVALTYSPAVNNFEAHTINTVVHTNDSDKGVVVKLSADPVLSNVLNPTLQIPVS
FT                   VNFAGKPLSTTGITIDSNDLNFASSGVNKVSSTQKLSIHADATRVTGGALTAGQYQGLV
FT                   SIILTKST"
FT   misc_feature    9280..9346
FT                   /note="Signal peptide predicted for cooA by SignalP 2.0 HMM
FT                   (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.620 between residues 23 and 24"
FT   misc_feature    9349..9789
FT                   /note="Pfam match to entry PF04449 Fimbrial_CS1, , score
FT                   336.8, E-value 3.1e-98"
FT   CDS             9877..12495
FT                   /transl_table=11
FT                   /gene="cooC"
FT                   /locus_tag="pCoo014"
FT                   /product="CooC precursor (Usher protein)"
FT                   /note="Similar to Escherichia coli CooC precursor cooC
FT                   SWALL:Q47114 (EMBL:X76908) (872 aa) fasta scores: E(): 0,
FT                   100% id in 872 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q47114"
FT                   /protein_id="CAI79496.1"
FT                   /translation="MIGGKSSKVVIVLSVLIGSSSGFASKYNLVDIPESFRDLWGEQDE
FT                   LLEVRLYGQSLGVHRIKSTPTTVAFESPDNLLDKIEINKGKEADLRVLMRGSFQRNGNM
FT                   SCQGYTGQNNCNYIKTNTVAVIVDDVENVLNLFIGNEFLASGENDSDYYQPSKNTKKAF
FT                   IHSQTINLSDTGNYENLSIVGTGSLGITDNSYAILGWAANYNRYKSYNYNEQSINSLYF
FT                   RHDFEKNFYYQLGRIDRSDLSQSSGGNFNFDLLPVPDIYGMRAGTTQSYIKNTGKSVAS
FT                   PVTIMLTHFSRVEAYRNGQLLGVWYLDAGISELDTERLPDGNYDLKLKIFEQEQLVREE
FT                   IVPFNKSGSSIGDTHWDVFVQAGDIINDNGRYVEKQKNHKSAINSGLRLPLTRNLAVQL
FT                   GGAVIDNKNYYETGILWNSGLLDGSLNSKFTFLFGDDTHGNYQNVSYTDGFSLSFYHND
FT                   KRVDDCGKDYNMGWSGCYESYSASLSIPVKGWNSTLAYSNTYSTSVYRYDAVSEYVPYY
FT                   YYKGRTKRWQLTASTVVRWGDYNIMPTIGVYNSEQKQWADKGGYLSLTLTRVDGGKSLN
FT                   AGYSYNYSRGNYTSNDAFVEGHLVSDTNVSYRELSARVSGNRYYTEGGVSGRINNRFGD
FT                   LNGTLNVNKNRKSHDTTHSLTAGYSSSFALTTDGIYWGGSASGLTNLSGGIVRVKSNED
FT                   ESELLNVKGSSYGHYSLGSNDSLFIPVPALMQASLTIEENTNKSKNIDVLAPTKNTFFM
FT                   LPGSVYPIDVSANVSFTYVGRGVDVKGRPLSGAYILNAQNIVLDENGGFSFESSENEKE
FT                   LFLLKDKTIYSCSLDRSEMRNGIAFVGEVACNSTIKELLPEKLVTNSRIHDLLAYNQDT
FT                   E"
FT   misc_feature    9877..9946
FT                   /note="Signal peptide predicted for cooC by SignalP 2.0 HMM
FT                   (Signal peptide probabilty 0.935) with cleavage site
FT                   probability 0.754 between residues 24 and 25"
FT   CDS             12492..13583
FT                   /transl_table=11
FT                   /gene="cooD"
FT                   /locus_tag="pCoo015"
FT                   /product="CooD precursor"
FT                   /note="Similar to Escherichia coli CooD precursor cooD
FT                   SWALL:Q47115 (EMBL:X76908) (363 aa) fasta scores: E():
FT                   1.3e-147, 100% id in 363 aa"
FT                   /db_xref="InterPro:IPR010888"
FT                   /db_xref="UniProtKB/TrEMBL:Q47115"
FT                   /protein_id="CAI79497.1"
FT                   /translation="MKKIFIFLSIIFSAVVSAGRYPETTVGNLTKSFQAPRLDRSVQSP
FT                   IYNIFTNHVAGYSLSHSLYDRIVFLCTSSSNPVNGACPTIGTSGVQYGTTTITLQFTEK
FT                   RSLIKRNINLAGNKKPIWENQSCDFSNLMVLNSKSWSCGAHGNANGTLLNLYIPAGEIN
FT                   KLPFGGIWEATLILRLSRYGEVSSTHYGNYTVNITVDLTDKGNIQVWLPGFHSNPRVDL
FT                   NLRPIGNYKYSGSNSLDMCFYDGYSTNSDSMVIKFQDDNPTNSSEYNLYKIGGTEKLPY
FT                   AVSLLMGEKIFYPVNGQSFTINDSSVLETNWNRVTAVAMPEVNVPVLCWPARLLLNADV
FT                   NAPDAGQYSGQIYITFTPSVENL"
FT   misc_feature    12492..12549
FT                   /note="Signal peptide predicted for cooD by SignalP 2.0 HMM
FT                   (Signal peptide probabilty 0.971) with cleavage site
FT                   probability 0.353 between residues 20 and 21"
FT   misc_feature    12501..13580
FT                   /note="Pfam match to entry PF07434 CblD, , score 874.3,
FT                   E-value 4.6e-260"
FT   repeat_region   complement(14268..14300)
FT                   /note="IS2 terminal IR"
FT   repeat_region   complement(join(14268..15345,60424..60659))
FT                   /note="IS2"
FT   CDS             complement(14271..15176)
FT                   /transl_table=11
FT                   /locus_tag="pCoo016"
FT                   /product="transposase insD for insertion element IS2"
FT                   /note="Similar to Escherichia coli transposase insd for
FT                   insertion element is2a/d/f/h/i/k SWALL:INSD_ECOLI
FT                   (SWALL:P19777) (301 aa) fasta scores: E(): 2.9e-129, 100%
FT                   id in 301 aa"
FT                   /db_xref="GOA:Q2VP36"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP36"
FT                   /protein_id="CAI79498.1"
FT                   /translation="MDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWMDGRRSR
FT                   HTDDTDVLLRIHHVIGELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
FT                   RKPAVPPSKRAHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVT
FT                   TGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNT
FT                   AVRSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSP
FT                   REYLRQRACNGLSDNRCLEI"
FT   misc_feature    complement(14319..14816)
FT                   /note="Pfam match to entry PF00665 rve, , score 122.7,
FT                   E-value 8.5e-34"
FT   CDS             complement(join(15134..15345,60424..60490))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo017"
FT                   /product="transposase insC for insertion element IS2
FT                   (pseudogene)"
FT                   /note="Similar to Shigella flexneri transposase insc for
FT                   insertion element is2 SWALL:INSC_SHIFL (SWALL:P59444) (121
FT                   aa) fasta scores: E(): 1e-31, 100% id in 92 aa"
FT                   /db_xref="PSEUDO:CAI79499.1"
FT   repeat_region   15346..15350
FT                   /note="direct repeat caused by insertion of IS element and
FT                   subsequent recombination; second copy at 60424..60428"
FT   repeat_region   15351..15378
FT                   /rpt_type=INVERTED
FT                   /note="IS terminal IR"
FT   repeat_region   15351..17304
FT                   /note="IS100"
FT   CDS             complement(15417..16196)
FT                   /transl_table=11
FT                   /locus_tag="pCoo018"
FT                   /product="putative IS100 transposase ATP-binding protein"
FT                   /note="Similar to Escherichia coli, and Yersinia pestis
FT                   putative ATP-binding protein SWALL:Q9R3L5 (EMBL:AF550679)
FT                   (260 aa) fasta scores: E(): 1.7e-88, 100% id in 260 aa"
FT                   /db_xref="GOA:P74994"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:P74994"
FT                   /protein_id="CAI79500.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   misc_feature    complement(15492..16031)
FT                   /note="Pfam match to entry PF01695 IstB, , score 369.7,
FT                   E-value 3.6e-108"
FT   misc_feature    complement(15849..15872)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS             complement(16196..17218)
FT                   /transl_table=11
FT                   /locus_tag="pCoo019"
FT                   /product="IS100 transposase"
FT                   /note="Similar to Escherichia coli, Yersinia pestis, and
FT                   Yersinia pseudotuberculosis is100 transposase SWALL:P74993
FT                   (EMBL:AF550679) (340 aa) fasta scores: E(): 4.5e-139,
FT                   98.82% id in 340 aa"
FT                   /db_xref="GOA:Q2VNY8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNY8"
FT                   /protein_id="CAI79501.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHPGENQVNFDKSPLHHPLSIYDSFCRGVA
FT                   "
FT   misc_feature    complement(16340..16873)
FT                   /note="Pfam match to entry PF00665 rve, , score 84.1,
FT                   E-value 3.5e-22"
FT   misc_feature    complement(17096..17215)
FT                   /note="Pfam match to entry PF02796 HTH_7, , score 29.2,
FT                   E-value 1.2e-05"
FT   misc_feature    complement(17102..17167)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2147.000, SD 6.50 at aa 18-39, sequence
FT                   MSSRAIARELGISRNTVKRYLQ"
FT   repeat_region   complement(17277..17304)
FT                   /rpt_type=INVERTED
FT                   /note="IS terminal IR"
FT   repeat_region   17305..17309
FT                   /note="direct repeat caused by insertion of IS element and
FT                   subsequent recombination; second copy at 58465..58469"
FT   repeat_region   17305..19830
FT                   /note="partial IS679, 5' end at 58285..58464. Separated by
FT                   IS100 insertion and recombination"
FT   CDS             17307..17861
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo020"
FT                   /product="IS element transposase (pseudogene)"
FT                   /note="Similar to Escherichia coli IS679 orf49 protein
FT                   SWALL:Q9R3N0 (EMBL:AB024946) (216 aa) fasta scores: E():
FT                   3.4e-75, 100% id in 184 aa, and to Shigella flexneri issfl3
FT                   orfa s0899 SWALL:Q7UD61 (EMBL:AE016981) (224 aa) fasta
FT                   scores: E(): 2.7e-17, 39.45% id in 185 aa. Interrupted by
FT                   IS100 insertion and separated from N-terminus (at
FT                   58359..58469) by reconbination"
FT   misc_feature    17490..17744
FT                   /note="Pfam match to entry PF01527 Transposase_8, , score
FT                   102.2, E-value 1.3e-27"
FT   CDS             17861..18208
FT                   /transl_table=11
FT                   /locus_tag="pCoo021"
FT                   /product="IS element transposase"
FT                   /note="Similar to Escherichia coli Orf50 protein orf50
FT                   SWALL:Q9S117 (EMBL:AB024946) (115 aa) fasta scores: E():
FT                   1.7e-47, 99.13% id in 115 aa, and to Shigella flexneri
FT                   putative is orf s0218 or s0118 or s0900 or s0946 or s2133
FT                   or s3548 or s4030 or s4438 SWALL:Q99QC8 (EMBL:AF348706)
FT                   (116 aa) fasta scores: E(): 6e-22, 71.6% id in 81 aa"
FT                   /db_xref="GOA:Q68JE0"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q68JE0"
FT                   /protein_id="CAI79503.1"
FT                   /translation="MISLPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLFI
FT                   FRGRRGDQIKVLWADSDGLCLFTKRLERGRFVWPVTRDGKVHLTPAQLSMLLEGINWKH
FT                   PKRTERAGIRI"
FT   misc_feature    17876..18202
FT                   /note="Pfam match to entry PF05717 Transposase_34, , score
FT                   238.6, E-value 1.1e-68"
FT   CDS             18228..19799
FT                   /transl_table=11
FT                   /locus_tag="pCoo022"
FT                   /product="IS element transposase"
FT                   /note="Similar to Escherichia coli Orf51 protein orf51
FT                   SWALL:Q9S116 (EMBL:AB024946) (523 aa) fasta scores: E():
FT                   6.1e-194, 98.47% id in 523 aa, and to Shigella flexneri
FT                   issfl3 orfc s2184 SWALL:Q7UCC5 (EMBL:AE016985) (533 aa)
FT                   fasta scores: E(): 1.2e-105, 59.81% id in 535 aa, and to
FT                   Pseudomonas fluorescens TnpC protein tnpC SWALL:CAD91355
FT                   (EMBL:AJ563381) (501 aa) fasta scores: E(): 3.5e-87, 52.44%
FT                   id in 490 aa"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q68JD9"
FT                   /protein_id="CAI79504.1"
FT                   /translation="MDTSLAHENARLRALLQTQQDTIRQMAEYNRLLSQRVAAYASEIN
FT                   RLKALVAKLQRMQFGKSSEKLRAKTERQIQEAQERISALQEEMAETLGEQYDPVLPSPL
FT                   RQSSARKPLPASLPRETRVIRPEEECCPACGGELSPLGCDVSEQLELISSAFKVIETQR
FT                   PKQACCRCDHIVQAPVPSKPIARSYAGAGLLAHVVTGKYADHLPLYRQSEIYRRQGVEL
FT                   SRATLGRWTGAVAELLEPLYDVLRQYVLMPGKVHADDIPVPVQEPGSGKTRTARLWVYV
FT                   RDDRNAGSQMPPAVWFAYSPDRKGVHPQNHLAGYSGVLQADAYGGYRVLYESGRITEAA
FT                   CMAHARRKIHDVHARVPTDITTEALQRIGELYAIEAEVRGCTAEQRLAARKARAAPLMQ
FT                   SLYDWIQTQMKTLSRHSDTAKAFAYLLKQWDGLNVYCSNGWVEIDNNIAENALRGVAVG
FT                   RKNWLFAGSDSGGEHAAVLYSLIGTCRLNNVEPEKWLRYVIEHIQDWPANRVRDLLPWK
FT                   VDLTSR"
FT   misc_feature    18639..19235
FT                   /note="Pfam match to entry PF03050 Transposase_25, , score
FT                   436.1, E-value 3.8e-128"
FT   repeat_region   19618..19830
FT                   /rpt_type=DIRECT
FT                   /note="rep11"
FT   repeat_region   19743..19836
FT                   /rpt_type=DIRECT
FT                   /note="rep3; imperfect"
FT   repeat_region   complement(19805..19830)
FT                   /note="IS679 terminal IR"
FT   repeat_region   19831..19836
FT                   /note="target site duplication for IS629: second copy at
FT                   58279..58284. Separated by IS100 insertion and
FT                   recombination"
FT   repeat_region   19965..20452
FT                   /rpt_type=DIRECT
FT                   /note="rep5"
FT   CDS             complement(20406..20699)
FT                   /transl_table=11
FT                   /locus_tag="pCoo023"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP31"
FT                   /protein_id="CAI79505.1"
FT                   /translation="MIGFRNVDMAELRIHTPAERVAIAEGHLFRVAFAIFFQLSQAAEF
FT                   QDVPLFPGVFSLPATRIVYDAVLTWIFRVLIQLSPLSGFQPPSSFEFREPRF"
FT   CDS             20779..21036
FT                   /transl_table=11
FT                   /locus_tag="pCoo024"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Vibrio vulnificus hypothetical protein
FT                   vv20643 SWALL:Q8D693 (EMBL:AE016810) (79 aa) fasta scores:
FT                   E(): 1.2, 32.09% id in 81 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP30"
FT                   /protein_id="CAI79506.1"
FT                   /translation="MWREWMGYITYVTDQRPGESDILSGNAFADLEIRDSDGHILLKMP
FT                   APESGWTHESLSLVQPQKVRDGEEAFDAYLNGMWIGSTEV"
FT   CDS             21332..21592
FT                   /transl_table=11
FT                   /locus_tag="pCoo025"
FT                   /product="putative integral membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP29"
FT                   /protein_id="CAI79507.1"
FT                   /translation="MTDDDLDTEQEEFYSMEQCIFDFGIINYNPAITWTVPAVFFFLAL
FT                   LAGIVFNIGRKNNLIVFVWAISLPVITVFIFIFLGGKINIC"
FT   misc_feature    join(21422..21490,21509..21568)
FT                   /note="2 probable transmembrane helices predicted for
FT                   pCoo025 by TMHMM2.0 at aa 31-53 and 60-79"
FT   CDS             complement(21753..21947)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo026"
FT                   /product="IS element transposase (fragment)"
FT                   /note="Similar to Shigella flexneri, and Shigella flexneri
FT                   2a is2 orf2 s0052 or cp0047 SWALL:Q9AFW4 (EMBL:AF348706)
FT                   (95 aa) fasta scores: E(): 2.1e-13, 77.35% id in 53 aa"
FT                   /db_xref="PSEUDO:CAI79508.1"
FT   misc_feature    complement(21774..21917)
FT                   /note="Pfam match to entry PF00665 rve, , score 12.9,
FT                   E-value 0.0035"
FT   CDS             complement(join(22018..22314,22316..22438))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo027"
FT                   /product="putative transglycosyloase (X polypeptide)
FT                   (pseudogene)"
FT                   /note="Similar to Escherichia coli x polypeptide x or 19
FT                   SWALL:X192_ECOLI (SWALL:P17738) (169 aa) fasta scores: E():
FT                   1e-28, 67.8% id in 146 aa, and to Salmonella typhimurium
FT                   invasion protein iagb precursor iagb or stm2877
FT                   SWALL:IAGB_SALTY (SWALL:P43017) (160 aa) fasta scores: E():
FT                   5e-10, 37.33% id in 150 aa, and to Escherichia coli PilT
FT                   protein pilT SWALL:Q9F539 (EMBL:AP002527) (160 aa) fasta
FT                   scores: E(): 3.8e-09, 37% id in 127 aa"
FT                   /db_xref="PSEUDO:CAI79509.1"
FT   misc_feature    complement(22055..22381)
FT                   /note="Pfam match to entry PF01464 SLT, , score 107.7,
FT                   E-value 2.7e-29"
FT   stem_loop       22691..22708
FT   stem_loop       22713..22730
FT   CDS             22910..23296
FT                   /transl_table=11
FT                   /gene="traM"
FT                   /locus_tag="pCoo028"
FT                   /product="TraM protein"
FT                   /note="Similar to Escherichia coli TraM protein traM
FT                   SWALL:TRM8_ECOLI (SWALL:P33788) (127 aa) fasta scores: E():
FT                   1.3e-28, 65.87% id in 126 aa"
FT                   /db_xref="GOA:Q2VP28"
FT                   /db_xref="InterPro:IPR007925"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP28"
FT                   /protein_id="CAI79510.1"
FT                   /translation="MPRIQTFVSNQVREEIENLVTERRQEGATENDATVSSVTSMLIEL
FT                   GLRVYRIQREKKESGFNQMEYNKLMLDNISRVRFMCSEIMNMSMLNQESVASGYFTIEK
FT                   IKPAMEKFVNEQVGIFFHDDEETD"
FT   misc_feature    22910..23290
FT                   /note="Pfam match to entry PF05261.1 Tra_M, , score 215.0,
FT                   E-value 1.5e-61"
FT   CDS             23775..24056
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="pCoo029"
FT                   /product="TraJ protein"
FT                   /note="Similar to Escherichia coli TraJ protein traJ
FT                   SWALL:TRJ8_ECOLI (SWALL:P33786) (149 aa) fasta scores: E():
FT                   0.03, 26.88% id in 93 aa, and to Erwinia amylovora Orf5
FT                   orf5 SWALL:AAQ97947 (EMBL:AY422215) (96 aa) fasta scores:
FT                   E(): 0.0021, 31.32% id in 83 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP27"
FT                   /protein_id="CAI79511.1"
FT                   /translation="MAIIDPIRMEILRKVFPEINDIKIEVFTLFAFGMTIREISVYRNT
FT                   THQAVYKTLKELCDQYNSPSNEALKTLYITRLALHSFLELRIELTPEQ"
FT   misc_feature    23874..23939
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1160.000, SD 3.14 at aa 34-55, sequence
FT                   MTIREISVYRNTTHQAVYKTLK"
FT   CDS             24536..24895
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="pCoo030"
FT                   /product="fimbrial protein precursor"
FT                   /note="Similar to Salmonella typhi fimbrial protein
FT                   precursor traA SWALL:PIL1_SALTI (SWALL:P12060) (119 aa)
FT                   fasta scores: E(): 8e-38, 83.05% id in 118 aa, and to
FT                   Escherichia coli fimbrial protein precursor traA
FT                   SWALL:PIL1_ECOLI (SWALL:P04737) (121 aa) fasta scores: E():
FT                   1.9e-07, 35.48% id in 124 aa"
FT                   /db_xref="GOA:Q2VP26"
FT                   /db_xref="InterPro:IPR008873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP26"
FT                   /protein_id="CAI79512.1"
FT                   /translation="MNLSLSEGGRPASVKNRAWHYCQMAWRGVCTPKALSRLAAFSPLL
FT                   LLGMGQMAHATDLLAGGKNDVKATFGADSFVIMCIYIAEIVIGVATYIRTKNLLILLGL
FT                   VVVIVFTTVGLTFVN"
FT   misc_feature    24536..24892
FT                   /note="Pfam match to entry PF05513.1 TraA, , score 260.3,
FT                   E-value 3.3e-75"
FT   misc_feature    join(24635..24703,24746..24814,24827..24886)
FT                   /note="3 probable transmembrane helices predicted for traA
FT                   by TMHMM2.0 at aa 34-56, 71-93 and 98-117"
FT   CDS             24897..25202
FT                   /transl_table=11
FT                   /gene="traL"
FT                   /locus_tag="pCoo031"
FT                   /product="TraL protein"
FT                   /note="Similar to Salmonella typhi TraL protein traL
FT                   SWALL:TRAL_SALTI (SWALL:P12058) (101 aa) fasta scores: E():
FT                   3e-39, 86.13% id in 101 aa, and to Escherichia coli TraL
FT                   protein traL SWALL:TRL1_ECOLI (SWALL:P08321) (91 aa) fasta
FT                   scores: E(): 4.3e-15, 46.66% id in 90 aa"
FT                   /db_xref="GOA:Q2VP25"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="InterPro:IPR016382"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP25"
FT                   /protein_id="CAI79513.1"
FT                   /translation="MSGNDLEKFRFPKTLSEQNRIIGLPLDEAIPAAVLVLWGFFAKKY
FT                   VFGLIIATVVWQLIRAAKRGKSSRWLYNWCYWHLPVELFRVVYRVIPDSSYRKWIK"
FT   misc_feature    24915..25199
FT                   /note="Pfam match to entry PF07178.1 TraL, , score 206.5,
FT                   E-value 5e-59"
FT   misc_feature    24996..25064
FT                   /note="1 probable transmembrane helix predicted for traL by
FT                   TMHMM2.0 at aa 34-56"
FT   CDS             25222..25785
FT                   /transl_table=11
FT                   /gene="traE"
FT                   /locus_tag="pCoo032"
FT                   /product="TraE protein"
FT                   /note="Similar to Salmonella typhi TraE protein traE
FT                   SWALL:TRE1_SALTI (SWALL:P12057) (187 aa) fasta scores: E():
FT                   2.9e-65, 92.51% id in 187 aa, and to Escherichia coli TraE
FT                   protein traE SWALL:TRE2_ECOLI (SWALL:P10514) (188 aa) fasta
FT                   scores: E(): 3.3e-28, 45.74% id in 188 aa"
FT                   /db_xref="GOA:Q2VP24"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP24"
FT                   /protein_id="CAI79514.1"
FT                   /translation="MEISARNSSTKIIAIIILSLTALVFILGFAVTWLAVTNRTLIHEQ
FT                   RTVVTPMTYNAPFAVSETKADTEFFRMMTLSFLALRLNVSPETVDSNHAFLMSFVEPEV
FT                   REEFKKVLQEEAAQIKASDVNSTFYTTEINVYPVDGRVDVRGVLKMWIGNSKPTTELKN
FT                   YRLRLKYAGGFTRIGRFYEVTNEK"
FT   misc_feature    25222..25321
FT                   /note="Signal peptide predicted for traE by SignalP 2.0 HMM
FT                   (Signal peptide probabilty 0.916) with cleavage site
FT                   probability 0.367 between residues 34 and 35"
FT   misc_feature    25222..25782
FT                   /note="Pfam match to entry PF05309.1 TraE, , score 441.7,
FT                   E-value 7.8e-130"
FT   misc_feature    25255..25323
FT                   /note="1 probable transmembrane helix predicted for traE by
FT                   TMHMM2.0 at aa 12-34"
FT   misc_feature    25438..25503
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1344.000, SD 3.76 at aa 73-94, sequence
FT                   MTLSFLALRLNVSPETVDSNHA"
FT   CDS             25775..26371
FT                   /transl_table=11
FT                   /locus_tag="pCoo033"
FT                   /product="TraK-X deletion and fusion protein"
FT                   /note="Similar to Salmonella typhi TraX traX SWALL:Q8KNJ7
FT                   (EMBL:AF411480) (243 aa) fasta scores: E(): 1.5e-35, 85.47%
FT                   id in 117 aa, and to Salmonella typhi TraK traK
FT                   SWALL:Q8KNL8 (EMBL:AF411480) (246 aa) fasta scores: E():
FT                   1.6e-20, 73.4% id in 94 aa, and to Escherichia coli TraX
FT                   protein traX SWALL:TRX2_ECOLI (SWALL:P22710) (248 aa) fasta
FT                   scores: E(): 0.0011, 36.6% id in 112 aa, and to Escherichia
FT                   coli TraK lipoprotein precursor traK SWALL:TRK1_ECOLI
FT                   (SWALL:P41066) (242 aa) fasta scores: E(): 0.0023, 29.76%
FT                   id in 84 aa"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="InterPro:IPR014125"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP23"
FT                   /protein_id="CAI79515.1"
FT                   /translation="MKNNFPALLLGTALMITSPVTVYAQSPATLSFPQRGQFRLSISNT
FT                   DPNMIFIPGDKVTAITAQNGMLADKRLTSAGGVLFTSVANGVAAFTVLMGYIPFSSASY
FT                   GIPGLLMLAGALLVWQVRDTLRPALFAVWLLLVALLNARHGDVMMFSGVILTLTVLFCV
FT                   HGLVPASGRRLQAGRWFAPAYAIHLFFIGFLVRVL"
FT   misc_feature    25775..25844
FT                   /note="Signal peptide predicted for pCoo033 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 24 and 25"
FT   misc_feature    25775..26296
FT                   /note="Pfam match to entry PF06586 TraK, , score 27.4,
FT                   E-value 3.7e-08"
FT   misc_feature    join(25793..25861,25997..26065,26084..26137,26147..26200,
FT                   26213..26281,26309..26365)
FT                   /note="6 probable transmembrane helices predicted for
FT                   pCoo033 by TMHMM2.0 at aa 7-29, 75-97, 104-121, 125-142,
FT                   147-169 and 179-197"
FT   CDS             26615..26980
FT                   /transl_table=11
FT                   /locus_tag="pCoo034"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP22"
FT                   /protein_id="CAI79516.1"
FT                   /translation="MSETVLSGWRSGNSGQRLRMYGGWLPILLPALTGSSLHGREQNTA
FT                   SGAAGVRPDINHALQEVEDAWRKPKNIQVRWADAFALLSCPTPETGKSKFSPLPAFRYY
FT                   LVNGICHIYKHNVNNIN"
FT   CDS             27285..27542
FT                   /transl_table=11
FT                   /gene="repA2"
FT                   /locus_tag="pCoo035"
FT                   /product="replication regulatory protein RepA2"
FT                   /note="Similar to Escherichia coli R100 replication
FT                   regulatory protein repa2 repa2 or copB SWALL:CPB2_ECOLI
FT                   (SWALL:P03847) (84 aa) fasta scores: E(): 2.1e-15, 61.9% id
FT                   in 84 aa"
FT                   /db_xref="InterPro:IPR019661"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP21"
FT                   /protein_id="CAI79517.1"
FT                   /translation="MSQTENAVTSSSGAKRAYRKGKPLSEAERQRAASARKRSVCKEIK
FT                   VFVRPELKNYLTSLCAAEGVTQAELIERLIEKEACHRNMA"
FT   misc_RNA        complement(27674..27766)
FT                   /gene="inc"
FT                   /gene_synonym="RNA-I"
FT                   /note="inhibitor of RepA1 protein synthesis"
FT   CDS             27778..27852
FT                   /transl_table=11
FT                   /gene="repA6"
FT                   /gene_synonym="repL"
FT                   /locus_tag="pCoo035a"
FT                   /product="positive regulator of repfic repa1 expression
FT                   (repa1 leader peptide)"
FT                   /db_xref="InterPro:IPR012605"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP20"
FT                   /protein_id="CAI79518.1"
FT                   /translation="MPGKVQDFFLCTLLLRIVSAGWCD"
FT   CDS             27845..28702
FT                   /transl_table=11
FT                   /gene="repA1"
FT                   /locus_tag="pCoo036"
FT                   /product="replication initiation protein RepA"
FT                   /note="Similar to Escherichia coli replication initiation
FT                   protein repa or repa1 SWALL:REP2_ECOLI (SWALL:P03066) (285
FT                   aa) fasta scores: E(): 5.7e-108, 96.84% id in 285 aa"
FT                   /db_xref="GOA:Q2VP19"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="InterPro:IPR017837"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP19"
FT                   /protein_id="CAI79519.1"
FT                   /translation="MTDLQQTYYRQVKNPNPVFTPRKGAGTLKFCEKLMEKAVGFTSRF
FT                   DFAIHVAHARSRGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECGLA
FT                   TESAAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTLALFAALDVSED
FT                   AVAAARRSRVEWENKQRKKQGLDSLGMDELIAKAWRFVRERFRSYQTELKSRGIKRARA
FT                   RRDANRERQDIVTLVKRQLTREISEGRFTANGEAVKREVERRVKERMILSRNRNYSRLA
FT                   TASP"
FT   misc_feature    27866..28651
FT                   /note="Pfam match to entry PF02387.5 IncFII_repA, , score
FT                   -32.7, E-value 1.2e-08"
FT   CDS             join(29065..29181,29181..29261,29264..29452)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="repA4"
FT                   /locus_tag="pCoo037"
FT                   /product="hypothetical protein RepA4 (pseudogene)"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   Repa4 repa4 SWALL:YPRR_ECOLI (SWALL:P03848) (128 aa) fasta
FT                   scores: E(): 2.4e-42, 89.84% id in 128 aa"
FT                   /db_xref="PSEUDO:CAI79520.1"
FT   repeat_region   29180..29552
FT                   /rpt_type=DIRECT
FT                   /note="rep2; imperfect"
FT   CDS             29673..29984
FT                   /transl_table=11
FT                   /locus_tag="pCoo038"
FT                   /product="prophage protein gp49"
FT                   /note="Similar to Bacteriophage N15 gp49 gene 49
FT                   SWALL:O64357 (EMBL:AF064539) (103 aa) fasta scores: E():
FT                   2.8e-33, 90.19% id in 102 aa"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP18"
FT                   /protein_id="CAI79521.1"
FT                   /translation="MFNVITHPTALDELLELPDNLRGRMARLIERLEQEGNKMKMPHSR
FT                   VIGGGLFELRVGDKNIARTLYAYATGNEIYLLHAFVKKTQKTPTKAIEIARMRLKEMK"
FT   CDS             29984..30271
FT                   /transl_table=11
FT                   /locus_tag="pCoo039"
FT                   /product="prophage protein gp48"
FT                   /note="Similar to Bacteriophage N15 gp48 gene 48
FT                   SWALL:O64356 (EMBL:AF064539) (95 aa) fasta scores: E():
FT                   2.2e-29, 87.36% id in 95 aa"
FT                   /db_xref="GOA:Q2VP17"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP17"
FT                   /protein_id="CAI79522.1"
FT                   /translation="MKVKGVPFSQVKQKLLNTPEAVKGYEDADKELEMVEMLYEMREKA
FT                   GLTKSALAERMGLRPSAISRLESNPLGASMKTLTRYAQACGATINIHAVY"
FT   misc_feature    30095..30259
FT                   /note="Pfam match to entry PF01381 HTH_3, , score 49.7,
FT                   E-value 8.1e-12"
FT   misc_feature    30122..30187
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1983.000, SD 5.94 at aa 47-68, sequence
FT                   LTKSALAERMGLRPSAISRLES"
FT   CDS             30648..31157
FT                   /transl_table=11
FT                   /gene="def"
FT                   /gene_synonym="fms"
FT                   /locus_tag="pCoo040"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 peptide deformylase def or fms
FT                   or b3287 or c4047 or z4657 or ecs4152 SWALL:DEF_ECOLI
FT                   (SWALL:P27251) (168 aa) fasta scores: E(): 5.9e-59, 98.81%
FT                   id in 168 aa"
FT                   /db_xref="GOA:Q2VP16"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP16"
FT                   /protein_id="CAI79523.1"
FT                   /translation="MSVLQVLHIPDERLRKVAKPVEEVNAEIRRIVDDMFETMYAEKGI
FT                   GLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRA
FT                   EKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLD
FT                   RLKARA"
FT   misc_feature    30654..31106
FT                   /note="Pfam match to entry PF01327 Pep_deformylase, , score
FT                   313.0, E-value 4.5e-91"
FT   CDS             complement(31462..31680)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo041"
FT                   /product="IS91 transposase (fragment)"
FT                   /note="Similar to Escherichia coli transposase TnpA tnpA
FT                   SWALL:CAD87832 (EMBL:AJ555214) (395 aa) fasta scores: E():
FT                   2.2e-27, 100% id in 72 aa"
FT   CDS             31674..31727
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo042"
FT                   /product="IS679 transposase (fragment)"
FT                   /note="Similar to Escherichia coli O6 hypothetical protein
FT                   c3663 SWALL:Q8FDS4 (EMBL:AE016766) (126 aa) fasta scores:
FT                   E(): 0.00015, 94.44% id in 18 aa, and to Pseudomonas
FT                   fluorescens TnpC protein tnpC SWALL:CAD91355
FT                   (EMBL:AJ563381) (501 aa) fasta scores: E(): 1.2, 64.7% id
FT                   in 17 aa"
FT   repeat_region   31674..31767
FT                   /rpt_type=DIRECT
FT                   /note="rep3; end of IS679"
FT   CDS             31770..32012
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo043"
FT                   /product="IS630 transposase (fragment)"
FT                   /note="Similar to Shigella sonnei insertion element is630
FT                   hypothetical 39 kDa protein SWALL:YIS5_SHISO (SWALL:P16943)
FT                   (343 aa) fasta scores: E(): 3.2e-30, 87.5% id in 80 aa"
FT                   /db_xref="PSEUDO:CAI79526.1"
FT   CDS             complement(32074..33018)
FT                   /transl_table=11
FT                   /gene="msbB"
FT                   /locus_tag="pCoo044"
FT                   /product="lipid A biosynthesis (kdo)2-(lauroyl)-lipid iva
FT                   acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Similar to Shigella flexneri lipid a biosynthesis
FT                   (kdo)2-(lauroyl)-lipid iva acyltransferase 2 msbb2 or msbb
FT                   or cp0238 SWALL:MSB2_SHIFL (SWALL:O06659) (314 aa) fasta
FT                   scores: E(): 3.1e-128, 96.17% id in 314 aa, and to
FT                   Escherichia coli lipid a biosynthesis msbb or b1855
FT                   SWALL:MSBB_ECOLI (SWALL:P24205) (323 aa) fasta scores: E():
FT                   1.8e-95, 70.19% id in 312 aa"
FT                   /db_xref="GOA:Q2VP15"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011921"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP15"
FT                   /protein_id="CAI79527.1"
FT                   /translation="MKKYKSEFIPEFKKNYLSPVYWSTWFLLGMIAGISMFPPSFRDPV
FT                   LAKIGRWAGRLSKKARRRATINLSLCFPEKSDTEREIIVDKMFATALQSIVMMAELAIR
FT                   GPEKFQKRVFWKGLEILEEIRHNNRNVIFLVPHGWSVDIPAMLLAAQGEKMAAMFHQQR
FT                   NPVIDYIWNSVRRKFGGRLHAREDGIKPFIQSVRQGYWGYYLPDQDHGPEYSEFADFFA
FT                   TYKATLPIIGRLMNISQAMIIPLFPVYDEKKHLLTIEIRPPMDACIASADNKMIARQMN
FT                   KTVEILVGPHPEQYVWVLKLLKTRKLNEADPYP"
FT   misc_feature    complement(32107..32994)
FT                   /note="Pfam match to entry PF03279 Lip_A_acyltrans, , score
FT                   440.9, E-value 1.4e-129"
FT   misc_feature    complement(32874..33018)
FT                   /note="Signal peptide predicted for msbB by SignalP 2.0 HMM
FT                   (Signal peptide probabilty 0.747) with cleavage site
FT                   probability 0.597 between residues 47 and 48"
FT   misc_feature    complement(32896..32964)
FT                   /note="1 probable transmembrane helix predicted for msbB by
FT                   TMHMM2.0 at aa 19-41"
FT   CDS             complement(33083..34033)
FT                   /transl_table=11
FT                   /locus_tag="pCoo045"
FT                   /product="virK homologue"
FT                   /note="Similar to Escherichia coli VirK virK SWALL:Q9X694
FT                   (EMBL:AF134403) (316 aa) fasta scores: E(): 1.3e-130,
FT                   94.62% id in 316 aa, and to Shigella flexneri VirK,
FT                   required for proper localization of icsa virK SWALL:Q99QA5
FT                   (EMBL:AL391753) (316 aa) fasta scores: E(): 1.5e-129,
FT                   93.67% id in 316 aa"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP14"
FT                   /protein_id="CAI79528.1"
FT                   /translation="MFSISNLSFIGFLKRIIFSSDSLPGKWEHRKFRFMYILRCSINPV
FT                   VSIRYYYELRSLPCIEDILAIHPTLPARIHRPYLHKGGRAWTRGQYILEHYRFVQNLPE
FT                   KYSKFLFPQKSVSLVQFIGKDGENFDIQCSPSGFDREGELMLSLFYNKTVIARLTFSVI
FT                   LTQNGHIAFIGGLQGAPKNTGPDVIRCATRACYGIFPKRIIFEAFCALMKACNISECLA
FT                   VSEHSHVFRQLRYWYQKRKIFVAVYSDFWESVAGKTCGDWYRLPTQVIRKPLSDIASKK
FT                   RSEYRKRYALLDYIHETTIRSLDAYPVHSEHQDLN"
FT   misc_feature    complement(33125..33979)
FT                   /note="Pfam match to entry PF04393 DUF535, , score 499.4,
FT                   E-value 3.4e-147"
FT   CDS             complement(34038..35126)
FT                   /transl_table=11
FT                   /locus_tag="pCoo046"
FT                   /product="glycosyl transferase"
FT                   /note="Similar to Shigella flexneri orf186 SWALL:AAP79030
FT                   (EMBL:AY206446) (362 aa) fasta scores: E(): 7.9e-145,
FT                   95.58% id in 362 aa"
FT                   /db_xref="GOA:Q2VP13"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP13"
FT                   /protein_id="CAI79529.1"
FT                   /translation="MNILFTESSPNIGGQELQAVAQMKALKKMGHSVLLVCRENSKIAF
FT                   EASKFGIDITFALFRNSLHIPTVWRLLGIVHSFQPDAIVCHSGHDSNIVGLVRFFTWKH
FT                   PFRIIRQKTYLTRKTKFFSINHFCDEVIVPGTNMKTHLEQEGCRTRVTVVPPGFDFQEL
FT                   YVDSRNSLPPSVLSWLASRRGCPVIAQVGMLRPEKGHEFMLNLLFHLKMNGRQFCWLIV
FT                   GSGSPELREHLQYQIDSMGMHDDVFIADNIFPAAPVYRVASLVVLPSENESFGMVLAEA
FT                   SAFSVPVVATQIGGIPEVIQNNQTGTLLPAGNKHAWMCALNDFFNDPGRFYQMARLAKQ
FT                   DIEERFDINKTALKILTLAKQK"
FT   misc_feature    complement(34104..34613)
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1, , score
FT                   67.6, E-value 3.3e-17"
FT   CDS             complement(35129..35950)
FT                   /transl_table=11
FT                   /gene="shf"
FT                   /locus_tag="pCoo047"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="Similar to Shigella flexneri, and Shigella flexneri
FT                   2a orf185 shf or cp0235 SWALL:Q99QG8 (EMBL:AL391753) (280
FT                   aa) fasta scores: E(): 6.8e-120, 95.6% id in 273 aa"
FT                   /db_xref="GOA:Q2VP12"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP12"
FT                   /protein_id="CAI79530.1"
FT                   /translation="MFKANHVPVLMYHHVSHCPGLVTLSPETFRKQMKWLAENNWKTLS
FT                   SDELEFFYRGGKLPRKSVMLTFDDGYLDNWFQVYPLLNEFNLKAHIFLITSFIGNGPVR
FT                   HSPGKEYSHRDCEHQIATGNADNVMLRWSEVNEMLQSGLVEFHVHTHTHTRWDKKFTSR
FT                   EEQCKHLRQDLLSGREYLKKMTGKCSKHLCWPEGYYNKDYIQIAEELGFHYLYTTERRM
FT                   NAPAKGTTRIGRISTKERENCVWLKRRLFYYTTPFFSSLLALHKGPRLPDD"
FT   misc_feature    complement(35306..35785)
FT                   /note="Pfam match to entry PF01522.9 Polysacc_deac_1, ,
FT                   score 157.7, E-value 2.5e-44"
FT   repeat_region   36214..36574
FT                   /rpt_type=DIRECT
FT                   /note="rep7"
FT   CDS             complement(36215..36745)
FT                   /transl_table=11
FT                   /locus_tag="pCoo048"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   SWALL:Q7WTH7 (EMBL:AY205565) (196 aa) fasta scores: E():
FT                   2.4e-37, 80% id in 195 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP11"
FT                   /protein_id="CAI79531.1"
FT                   /translation="MTQSRRPSPLQRRVLIVLAALDEKRPGHVLTRDIERVLERSGEAP
FT                   VYGPNLRASCRRLEDAGRAIAHPLLLAEQNRLRAEQRTAEVVVLPLIPLSVPPAEGTSA
FT                   KDLPVALGGITYQACRGDFVVRLDGSTCLQLWNKEGRVVRLEGDPLDVAQWLHACHDAG
FT                   IEVRVQVNESVTL"
FT   repeat_region   36557..36695
FT                   /rpt_type=DIRECT
FT                   /note="rep8"
FT   CDS             complement(36745..37002)
FT                   /transl_table=11
FT                   /locus_tag="pCoo049"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium YdfA protein ydfA
FT                   SWALL:Q8L239 (EMBL:AP005147) (85 aa) fasta scores: E():
FT                   6.3e-32, 89.41% id in 85 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP10"
FT                   /protein_id="CAI79532.1"
FT                   /translation="MDEERVFSLSYEQLTRFAEQGIRKCNLDSQGVTYLCESAKAGAML
FT                   IFWHELAINGYSSMNAIKRQELIDADFQRLRNLIWPDGDR"
FT   CDS             37447..37665
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="pCoo050"
FT                   /product="CcdA antitoxin protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 ccda protein ccda or leta or H SWALL:CCDA_ECOLI
FT                   (SWALL:P05702) (72 aa) fasta scores: E(): 1.8e-27, 100% id
FT                   in 72 aa"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP09"
FT                   /protein_id="CAI79533.1"
FT                   /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWK
FT                   AENQEGMAEVARFIEMNGSFADENRDW"
FT   misc_feature    37447..37662
FT                   /note="Pfam match to entry PF07362 CcdA, , score 191.4,
FT                   E-value 1.7e-54"
FT   CDS             37667..37972
FT                   /transl_table=11
FT                   /gene="ccdB"
FT                   /locus_tag="pCoo051"
FT                   /product="cytotoxic protein CcdB"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 cytotoxic protein ccdb ccdb or letb or G
FT                   SWALL:CCDB_ECOLI (SWALL:P05703) (101 aa) fasta scores: E():
FT                   7.7e-38, 99.01% id in 101 aa"
FT                   /db_xref="GOA:Q3ZU17"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZU17"
FT                   /protein_id="CAI79534.1"
FT                   /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
FT                   VSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
FT   misc_feature    37667..37969
FT                   /note="Pfam match to entry PF01845 CcdB, , score 313.3,
FT                   E-value 3.5e-91"
FT   repeat_region   37995..38680
FT                   /rpt_type=DIRECT
FT                   /note="rep9"
FT   CDS             38000..38686
FT                   /transl_table=11
FT                   /gene="resD"
FT                   /locus_tag="pCoo052"
FT                   /product="putative resolvase"
FT                   /note="Similar to Escherichia coli resolvase resd or D
FT                   SWALL:REDM_ECOLI (SWALL:P18021) (260 aa) fasta scores: E():
FT                   7e-85, 96.01% id in 226 aa"
FT                   /db_xref="GOA:Q2VP07"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP07"
FT                   /protein_id="CAI79535.1"
FT                   /translation="MSMVHDELPKYLLAPEVSALLHYVPDLRRKMLLATLWNTGARINE
FT                   ALVLMRGDFSLTPPYPFVQLAPLKQRTEKAARTAGRTPARQQTHRLVPLSDSWYVSQLQ
FT                   TMVATLKIPMERRNKRTGRTEKVRIWEVTDRTVRTWIGEAVATAAADGVTFSVPVTPHT
FT                   FRHSYAMHMLYAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFAMPESDAVS
FT                   MLKRIP"
FT   misc_feature    38006..38620
FT                   /note="Pfam match to entry PF00589.8 Phage_integrase, ,
FT                   score 179.4, E-value 7.2e-51"
FT   misc_feature    38360..38425
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1037.000, SD 2.72 at aa 121-142, sequence
FT                   TGRTEKVRIWEVTDRTVRTWIG"
FT   CDS             39016..39657
FT                   /transl_table=11
FT                   /locus_tag="pCoo053"
FT                   /product="putative resolvase"
FT                   /note="Similar to Proteus vulgaris resolvase orf13
FT                   SWALL:Q8L2E0 (EMBL:AP004237) (211 aa) fasta scores: E():
FT                   1.2e-71, 94.23% id in 208 aa"
FT                   /db_xref="GOA:Q2VP06"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP06"
FT                   /protein_id="CAI79536.1"
FT                   /translation="MFIRAYLRASTEDQFAERAKEMLEQFVQERGHKIASYYRENISGT
FT                   KLDRPELKRLLMDSHCNDILLVEQIDRLTRLSNSDWITLKKQIEQHELRIVSLDVPTSW
FT                   QALSDKDPSQSDPITRAVITAINNMLIDLMAAMSHKDWLSRRQRQKQGIERAHTLGKYR
FT                   GKQADRERHQKVMYYRQVKKLSIRETAEATGYSTSQVCRIQALYKEVKPD"
FT   misc_feature    39022..39501
FT                   /note="Pfam match to entry PF00239 Resolvase, , score 80.0,
FT                   E-value 6.2e-21"
FT   misc_feature    39031..39057
FT                   /note="PS00397 Site-specific recombinases active site."
FT   misc_feature    39565..39630
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1717.000, SD 5.03 at aa 184-205, sequence
FT                   LSIRETAEATGYSTSQVCRIQA"
FT   CDS             complement(40097..40777)
FT                   /transl_table=11
FT                   /locus_tag="pCoo054"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2779 ypo2779 or y1612 SWALL:Q8ZD14 (EMBL:AJ414153) (232
FT                   aa) fasta scores: E(): 1.4e-18, 34.86% id in 218 aa, and to
FT                   Escherichia coli hypothetical protein yhjh yhjh or b3525
FT                   SWALL:YHJH_ECOLI (SWALL:P37646) (255 aa) fasta scores: E():
FT                   1.4e-10, 28.01% id in 232 aa"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP05"
FT                   /protein_id="CAI79537.1"
FT                   /translation="MEVIYIAEPIISTNINKLIAVELLSRFYSKTGVPLSTQRVLSMFT
FT                   TAMKINLLKSQIKEIINHRDFFEHHGVLCSVNIDYETCLYISCNNEIQKTISENKFIAL
FT                   EISETYPELTQNNDVIPFLCSLTEYIWLDDFGSGNSTMHTAMKNKYHAIKLDKLFYQEN
FT                   IGKPYFKGVINNLKKLCPNIIAEGVENIYYNGLSMNTGLWGTQGYFFPSVPLSEIKHMN
FT                   SAWL"
FT   misc_feature    complement(40136..40762)
FT                   /note="Pfam match to entry PF00563 EAL, , score -83.0,
FT                   E-value 3.4e-05"
FT   CDS             41025..41729
FT                   /transl_table=11
FT                   /locus_tag="pCoo055"
FT                   /product="putative AraC family regulatory protein"
FT                   /note="Similar to Salmonella typhi arac family regulatory
FT                   protein sty4515 or t4221 SWALL:Q8Z1M7 (EMBL:AL627282) (291
FT                   aa) fasta scores: E(): 6.2e-14, 32.12% id in 193 aa, and to
FT                   Escherichia coli putative hth-type transcriptional
FT                   regulator ydeo ydeo or b1499 SWALL:YDEO_ECOLI
FT                   (SWALL:P76135) (253 aa) fasta scores: E(): 6e-24, 36.32% id
FT                   in 234 aa"
FT                   /db_xref="GOA:Q2VP04"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP04"
FT                   /protein_id="CAI79538.1"
FT                   /translation="MPGVCYFILIKKPINFQFLKDFLILNYGDVLLLKHSERDFLQSYS
FT                   DKYLEIELNEDTVRNYLSYYNHCEKQFLETPPCILRKSFAYPDLLISMIDNINSQNHIH
FT                   PDFKDAIFFSLLSVFSDVANLRAFLTSGMPTFSGKVRSIFLSDVSKHWKLRDLADYLYM
FT                   SESLIKKKLLLENTSFSKILLDTRMSLAIKLLKQNHPIKYVSEMCGFSSTSYFVCLFRQ
FT                   YYECTPRKYLKH"
FT   misc_feature    41439..41576
FT                   /note="Pfam match to entry PF00165 HTH_AraC, , score 11.9,
FT                   E-value 0.14"
FT   misc_feature    41478..41543
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1176.000, SD 3.19 at aa 152-173, sequence
FT                   WKLRDLADYLYMSESLIKKKLL"
FT   misc_feature    41583..41708
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    41592..41723
FT                   /note="Pfam match to entry PF00165 HTH_AraC, , score 44.6,
FT                   E-value 2.7e-10"
FT   CDS             complement(42072..46166)
FT                   /transl_table=11
FT                   /gene="eatA"
FT                   /locus_tag="pCoo056"
FT                   /product="secreted autotransporter serine protease EatA"
FT                   /note="Similar to Escherichia coli secreted autotransporter
FT                   protein EatA eatA SWALL:Q84GK0 (EMBL:AY163491) (1364 aa)
FT                   fasta scores: E(): 0, 96.48% id in 1364 aa, and to Shigella
FT                   flexneri SepA, extracellular serine protease of the iga1
FT                   protease family, secreted by a c-terminal autotransporter
FT                   domain sepA SWALL:Q99QC6 (EMBL:AL391753) (1364 aa) fasta
FT                   scores: E(): 0, 74.7% id in 1364 aa"
FT                   /db_xref="GOA:Q2VP03"
FT                   /db_xref="InterPro:IPR000710"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP03"
FT                   /protein_id="CAI79539.1"
FT                   /translation="MNKVFSLKYSFLAKGFIAVSELARRVSVKGKLKSASSIIISPITI
FT                   AIVSYAPPSLAATVNADISYQTFRDFAENKGAFIVGASNINIYDKNGVLVGVLDKAPMP
FT                   DFSSATMNTGTLPPGDHTLYSPQYVVTAKHVNGSDIMSFGHIQNNYTVVGENNHNSLDI
FT                   KTRRLNKIVTEVAPAEVSSVGAVNGAYQEGGRFTAFYRLGGGLQYIKDKNGNLTPVYTN
FT                   GGFLTGGTISALSSYNNGQMITAPTGDIFNPANGPLANYLNKGDSGSPLFAYDSLEKKW
FT                   VLIGVLSSGSEYGNNWVVTTQDFLNQQQKHDFDKTISYDSKKGSLQWRYDKDAGVGTLS
FT                   QEGVVWDMHGKKGEDLNAGKNLQFTGNNGEVILHDSIDQGAGYLQFFNNYTVTSLTDQT
FT                   WTGGGIITEKGVNVLWQVNGVNNDNLHKVGEGTLTVNGKGVNNGGLKVGDGTVILNQRP
FT                   DDNGHKQAFSSINISSGRATVILSDANQVNPDKISWGYRGGTLDLNGNNVTFTRLQAAD
FT                   YGAIISNNNKNKSELTLKLQTLNENDISVDVKTYEVFGGRGSPGDLYYVSASNTYFILK
FT                   SKAYGPFFSDLDNTNVWQNVGHDRDKAIQIVKQQKIEESSQPYMFHGQLNGYMDVNIHP
FT                   LSGKDVLTLDGSVNLPEGVITKKSGTLIFQGHPVIHAGMTTSAGQSDWENRQFTMDKLK
FT                   LDAATFHLSRNTRMQGDISAANGSTVILGSSRVFTDKNDGTGNAVSSVEGSSTATTAAD
FT                   QSYYSGNVLLENHSSLEVRENFTGGIEAYDSSVSVTSQNAILDHVGSFINSSLLLEKGA
FT                   KLTAQSGIFTNNTMEIKENASLTLTGIPSVGKPGYYSPVISTTEGIHLGERASLSVKNM
FT                   GYLSSNIIAEDSAAIINLGDSNATIGKTDSPLFNTLMRGYNAVLQGNIMGPQSSVNMNN
FT                   ALWHSDRNSEIKELKANDSQIELGGRGHFAKLRVKELIASNSVFLVHVNNGQADQLNVT
FT                   GKLQGSNNTILVNFFNKAANGTNVTLITAPKGSDENTFKAGTQQIGFSNITPEIRTENT
FT                   DTATKWVLTGYQSVADARASKIATDFMDSGYKSFLTEVNNLNKRMGDLRDSQGDAGGWA
FT                   RIMNGTGSGESGYRDNYTHVQIGADRKHELNGLNLFTGALLTYTDSNASSQAFSGKTKS
FT                   LGGGVYASGLFESGAYFDLIGKYLHHDNRYTLNFASLGERSYTTHSLYAGAEIGYRYHM
FT                   SENTWVEPQMELVYGSVSGKSFNWKDQGMQLSMKDKDYHPLIGRTGVDVGRVFSGDTWK
FT                   VTARAGLSYQFDLLANGETVLQDASGKKHFKGEKDSRMLMNVGTNVEVKDNMRFGLELE
FT                   KSAFGRYNIDNSINANFRYYF"
FT   misc_feature    complement(42075..42899)
FT                   /note="Pfam match to entry PF03797 Autotransporter, , score
FT                   224.1, E-value 2.5e-64"
FT   misc_feature    complement(42993..43346)
FT                   /note="Pfam match to entry PF03212 Pertactin, , score
FT                   -27.6, E-value 0.002"
FT   misc_feature    complement(43767..46025)
FT                   /note="Pfam match to entry PF02395 IGA1, , score 1188.0,
FT                   E-value 0"
FT   misc_feature    complement(45980..46166)
FT                   /note="Signal peptide predicted for eatA by SignalP 2.0 HMM
FT                   (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.502 between residues 61 and 62"
FT   CDS             complement(join(46887..46904,47690..47716,47720..47875,
FT                   47879..47911,47911..48060))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="pCoo057"
FT                   /product="transposase for transposon gamma-delta
FT                   (pseudogene)"
FT                   /note="Similar to Escherichia coli transposase for
FT                   transposon gamma-delta tnpA SWALL:TNPA_ECOLI (SWALL:Q00037)
FT                   (1002 aa) fasta scores: E(): 1.4e-44, 95.34% id in 129 aa"
FT   repeat_region   46905..46921
FT                   /note="17bp direct repeat around IS1"
FT   repeat_region   complement(46922..46944)
FT   repeat_region   complement(46922..47689)
FT                   /note="IS1"
FT   CDS             complement(46937..47440)
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="pCoo058"
FT                   /product="insertion element IS1 protein InsB"
FT                   /note="Similar to Escherichia coli insertion element is1
FT                   1/5/6 protein insb (insb1 or b0021) and (insb5 or b1893)
FT                   and (insb6 or b3445) SWALL:INB1_ECOLI (SWALL:P03830) (167
FT                   aa) fasta scores: E(): 6.9e-67, 93.41% id in 167 aa"
FT                   /db_xref="GOA:Q2VP02"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP02"
FT                   /protein_id="CAI79541.1"
FT                   /translation="MPGNCPHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTLATLARLLSLLSAFEVVVWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   CDS             complement(47359..47634)
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="pCoo059"
FT                   /product="insertion element IS1 protein InsA"
FT                   /note="Similar to Escherichia coli, Salmonella typhi, and
FT                   Shigella sonnei insertion element is1 1/2/3/5/6 protein
FT                   insa SWALL:INSA_ECOLI (SWALL:P03827) (91 aa) fasta scores:
FT                   E(): 5.3e-36, 98.9% id in 91 aa"
FT                   /db_xref="GOA:Q2VP01"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP01"
FT                   /protein_id="CAI79542.1"
FT                   /translation="MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTY
FT                   TASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTVLRHLKNSGRSR"
FT   misc_feature    complement(47380..47445)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1346.000, SD 3.77 at aa 64-85, sequence
FT                   VGCRATARIMGVGLNTVLRHLK"
FT   misc_feature    complement(47566..47589)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   repeat_region   47667..47689
FT                   /note="IS1 terminal IR"
FT   repeat_region   47690..47706
FT                   /note="17bp direct repeat around IS1"
FT   misc_feature    complement(47755..48060)
FT                   /note="Pfam match to entry PF01526.7 Transposase_7, , score
FT                   213.2, E-value 5e-61"
FT   CDS             48179..48385
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo060"
FT                   /product="IS element transposase (pseudogene)"
FT                   /note="Similar to Yersinia pestis insertion element is1661
FT                   protein ypo3592A SWALL:Q8ZB36 (EMBL:AJ414157) (68 aa) fasta
FT                   scores: E(): 0.087, 30.3% id in 66 aa"
FT   repeat_region   complement(48392..48414)
FT                   /note="IS1 terminal IR"
FT   repeat_region   48392..49159
FT                   /note="IS1"
FT   CDS             48447..48722
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="pCoo061"
FT                   /product="insertion element IS1 protein InsA"
FT                   /note="Similar to Escherichia coli, Salmonella typhi, and
FT                   Shigella sonnei insertion element is1 1/2/3/5/6 protein
FT                   insa SWALL:INSA_ECOLI (SWALL:P03827) (91 aa) fasta scores:
FT                   E(): 2.1e-35, 97.8% id in 91 aa"
FT                   /db_xref="GOA:Q2VP00"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VP00"
FT                   /protein_id="CAI79544.1"
FT                   /translation="MASISISCPSCSATEGVVRNGKSTAGHQRYLCSHCRKTWQLQFTY
FT                   TASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSGRSR"
FT   misc_feature    48447..48710
FT                   /note="Pfam match to entry PF03811 Ins_element1, , score
FT                   239.4, E-value 6.5e-69"
FT   misc_feature    48492..48515
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    48636..48701
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1364.000, SD 3.83 at aa 64-85, sequence
FT                   VGCRATARIMGVGLNTILRHLK"
FT   CDS             join(48641..48775,48779..49144)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="pCoo062"
FT                   /product="insertion element IS1 protein InsB (pseudogene)"
FT                   /note="Similar to Escherichia coli insertion element is1
FT                   1/5/6 protein insb (insb1 or b0021) and (insb5 or b1893)
FT                   and (insb6 or b3445) SWALL:INB1_ECOLI (SWALL:P03830) (167
FT                   aa) fasta scores: E(): 1.7e-66, 93.41% id in 167 aa"
FT                   /db_xref="PSEUDO:CAI79545.1"
FT   misc_feature    48749..49138
FT                   /note="Pfam match to entry PF03400 Transposase_27, , score
FT                   347.4, E-value 1.9e-101"
FT   repeat_region   49137..49159
FT                   /note="IS1 terminal IR"
FT   CDS             49291..49758
FT                   /transl_table=11
FT                   /locus_tag="pCoo063"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNZ9"
FT                   /protein_id="CAI79546.1"
FT                   /translation="MKASHKTPLSFLKPSDTLYIVAHGNTSVIGSGSATGPTLNPVALA
FT                   SLLIHKRLPKNFIDIRVLSCASGIHSRTPAFAQRLKEIMKVHGYHSLVVTGYLGEVDVS
FT                   RDWRLKNDDGMEFYTLRKKGIIPVKDVLSESQRALCGSDLKYALSDFKKRF"
FT   CDS             50147..51127
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="pCoo064"
FT                   /product="partition protein ParA"
FT                   /note="Similar to Citrobacter freundii ParA parA
FT                   SWALL:Q8GFV8 (EMBL:AF550415) (324 aa) fasta scores: E():
FT                   3.3e-105, 86.81% id in 326 aa, and to Escherichia coli
FT                   protein StbA stbA SWALL:STBA_ECOLI (SWALL:P11904) (320 aa)
FT                   fasta scores: E(): 6.5e-58, 52.63% id in 323 aa"
FT                   /db_xref="InterPro:IPR009440"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNZ8"
FT                   /protein_id="CAI79547.1"
FT                   /translation="MRIFVDDGSTNIKLAWVEDGAVKTLISPNSFKPEWSMTLQGLTDA
FT                   TIPASANYEIDGEKYSFDQLSPDAVRTTETRYQYSDVNVVAIHHALMQSGIAPQPVDII
FT                   VTLPLGEYLDENDQPNLANIERKKNNVRRAVTVQGRENFTIRKVSVLPESVPAGFDVLK
FT                   DLNDLESLLIVDIGGTTLDIAHVRSKMSGFTKTYCDPKTGVSIITEAVKHAMDVNVSTR
FT                   TSSYFADRLIQSRDDNEFLTRYIPNAEQREQILTVLRDREKKLQHRVADSVGRFAGFTH
FT                   VMVVGGGASLVAGAVKKATGVGDNRFFVSDNPQFDLVLGMMAMKG"
FT   misc_feature    50147..51118
FT                   /note="Pfam match to entry PF06406 StbA, , score 773.6,
FT                   E-value 9.8e-230"
FT   CDS             51130..51552
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="pCoo065"
FT                   /product="partition protein ParB"
FT                   /note="Similar to Citrobacter freundii ParB parB
FT                   SWALL:Q8GFV7 (EMBL:AF550415) (147 aa) fasta scores: E():
FT                   1.8e-38, 74.83% id in 147 aa, and to Escherichia coli
FT                   protein StbB stbB SWALL:STBB_ECOLI (SWALL:P11906) (117 aa)
FT                   fasta scores: E(): 1.3e-06, 39.28% id in 84 aa"
FT                   /db_xref="InterPro:IPR019720"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNZ7"
FT                   /protein_id="CAI79548.1"
FT                   /translation="MADNRKCSFYIYPERNAADRVADRFLEKLPQKERGRAMRAMMLCG
FT                   AALMKQDERLPFLIAEFLTDSTSMQDIQRIISSTLPQQENGEVVRLLEAFLQSAGNNAK
FT                   TILPAVDSATQEISAPVDQNLLETRNNIKNLFPDDE"
FT   CDS             51895..52911
FT                   /transl_table=11
FT                   /locus_tag="pCoo066"
FT                   /product="IS element transposase"
FT                   /note="Similar to Pseudomonas fluorescens Tnpa1 protein
FT                   tnpa1 SWALL:Q9L343 (EMBL:AJ288908) (344 aa) fasta scores:
FT                   E(): 3.4e-79, 61.6% id in 336 aa"
FT                   /db_xref="GOA:Q2VNZ6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNZ6"
FT                   /protein_id="CAI79549.1"
FT                   /translation="MTVVTVGIDLAKNVFAVHGVNAAGKAVLVKPLVRRAKLLELIATL
FT                   PACLIGIEACTGAHFWAREFQKMGHTVRIMAPQLVSPYRMGGRHGKNDAADAAAICEAV
FT                   TRPNMRFVPIKSVEQQGQLFVHRAHQGYVSERTALINRIRGLLSELGIVLPQAFKAFLS
FT                   GVAQVLEDLPGFCNQVIGDLLNELYHIEEKIKNSEKLIQQLARDNSAAQLLMQFRGIGP
FT                   MTATAIVASIGNGHGFKNGRQFSAWLGLTPRQQSSGGKARLGRITKAGDSYLRTLLVLG
FT                   ARSVLLGAAKNDDPVSRWALQLKERRGYGRALVAIAAKNARMCWAMLHLRDEFRFPA"
FT   misc_feature    52453..52791
FT                   /note="Pfam match to entry PF02371 Transposase_20, , score
FT                   124.7, E-value 2.1e-34"
FT   CDS             53067..53363
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo067"
FT                   /product="conserved hypothetical protein (partial)"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   Orf59 orf59 SWALL:Q849V5 (EMBL:AF550679) (187 aa) fasta
FT                   scores: E(): 5.1e-39, 97.98% id in 99 aa"
FT   repeat_region   53678..53683
FT                   /note="IS element target site duplication"
FT   repeat_region   53684..53708
FT                   /note="IS element terminal IR"
FT   repeat_region   complement(53684..56217)
FT                   /note="IS element"
FT   CDS             complement(53715..55328)
FT                   /transl_table=11
FT                   /locus_tag="pCoo068"
FT                   /product="putative IS element transposase"
FT                   /note="Similar to Escherichia coli Ecs1339 ecs1339
FT                   SWALL:AAR25073 (EMBL:AY458016) (537 aa) fasta scores: E():
FT                   5.7e-200, 100% id in 537 aa, and to Shigella flexneri
FT                   issfl3 orfc s3549 SWALL:Q7UBD2 (EMBL:AE016989) (533 aa)
FT                   fasta scores: E(): 2.1e-88, 50% id in 524 aa"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SJ34"
FT                   /protein_id="CAI79551.1"
FT                   /translation="MSQKYLIRIAELERLLSEQAEALRQKDQQLSLVEETEAFLRSALT
FT                   RAEEKIEEDEREIEHLRAQIEKLRRMLFGTRSEKLRREVELAEALLKQREQDSDRYSGR
FT                   EDDPQVPRQLRQSRHRRPLPAHLPREIHRLEPEESCCPECGGKLDYLGEVSAEQLELVS
FT                   SALKVIRTERVKKACTKCDCIVEAPAPSRPIERGIAGPGLLARVLTGKYCEHLPLYRQS
FT                   EIFARQGVELSRALLSNWVDACCQLMTPVNDALYRYVMNTRKIHTDDTPVKVLAPGQKK
FT                   AKTGRIWTYVRDDRNVGSSSPPAVWFAYSPNRQGKHPEQHLRPFRGILQADAFTGYDRL
FT                   FSAEREGGALTEVACWAHARRKIHDVYISSKSATAEEALKRISELYAIEDEIRGLPESE
FT                   RLAVRQQRSKVLLTSLHEWMVEKNGTLSKKSRLGEAFSYVLNQWDALCYYSDDGLAEAD
FT                   NNAAERALRAVCLGKKNFMFFGSDHGGERGALLYGLIGTCRLNGIDPEAYLRHILSVLP
FT                   EWPSNRVDELLPWNVVLTNK"
FT   misc_feature    complement(54279..54887)
FT                   /note="Pfam match to entry PF03050 Transposase_25, , score
FT                   367.2, E-value 2.1e-107"
FT   CDS             complement(55359..55709)
FT                   /transl_table=11
FT                   /locus_tag="pCoo069"
FT                   /product="putative IS element protein"
FT                   /note="Similar to Escherichia coli Ecs1338 ecs1338
FT                   SWALL:AAR25072 (EMBL:AY458016) (116 aa) fasta scores: E():
FT                   1.4e-47, 100% id in 116 aa, and to Escherichia coli O157:H7
FT                   putative is encoded protein encoded within prophage cp-933o
FT                   z2127 SWALL:Q8XC14 (EMBL:AE005348) (186 aa) fasta scores:
FT                   E(): 2.7e-30, 66.37% id in 116 aa"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SJ35"
FT                   /protein_id="CAI79552.1"
FT                   /translation="MISLPSGTRIWLVAGVTDMRKSFNGLGEQVQHVLNDNPFSGHLFI
FT                   FRGRRGDTVKILWADADGLCLFTKRLEEGQFIWPAVRDGKVSITRSQLAMLLDKLDWRQ
FT                   PKTSSRNSLTML"
FT   misc_feature    complement(55368..55694)
FT                   /note="Pfam match to entry PF05717 Transposase_34, , score
FT                   221.8, E-value 1.3e-63"
FT   CDS             complement(55706..56131)
FT                   /transl_table=11
FT                   /locus_tag="pCoo070"
FT                   /product="putative IS element protein"
FT                   /note="Similar to Escherichia coli Ecs1337 ecs1337
FT                   SWALL:AAR25071 (EMBL:AY458016) (141 aa) fasta scores: E():
FT                   2.8e-55, 100% id in 141 aa"
FT                   /db_xref="GOA:Q6SJ36"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SJ36"
FT                   /protein_id="CAI79553.1"
FT                   /translation="MELQDWRKEPRKNYSNEFKLRMVELASQPGACVAQIARENGVNDN
FT                   VIFKWLRLWQNEGRVSRRLPVTTSSDTGVELLPVEITPDEQKEPVAAIAPSLSTSTQTR
FT                   VSASSCKVEFRHGNMTLENPSPELLTVLIRELTGRGR"
FT   misc_feature    complement(55862..56101)
FT                   /note="Pfam match to entry PF01527 Transposase_8, , score
FT                   60.2, E-value 5.4e-15"
FT   misc_feature    complement(55976..56041)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1020.000, SD 2.66 at aa 31-52, sequence
FT                   ACVAQIARENGVNDNVIFKWLR"
FT   repeat_region   complement(56193..56217)
FT                   /note="IS element terminal IR"
FT   repeat_region   56217..56704
FT                   /rpt_type=DIRECT
FT                   /note="rep5"
FT   repeat_region   56218..56223
FT                   /note="IS element target site duplication"
FT   CDS             56687..56842
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="pCoo071"
FT                   /product="single-strand binding protein (partial)"
FT                   /note="Similar to Escherichia coli single-strand binding
FT                   protein ssB SWALL:SSB7_ECOLI (SWALL:P28044) (174 aa) fasta
FT                   scores: E(): 8.2e-12, 100% id in 38 aa"
FT   misc_feature    56741..56836
FT                   /note="Pfam match to entry PF00436.11 SSB, , score 37.5,
FT                   E-value 3.9e-10"
FT   CDS             56842..57342
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="psiA"
FT                   /locus_tag="pCoo072"
FT                   /product="plasmid SOS inhibition protein (partial)"
FT                   /note="Similar to Escherichia coli PsiA protein psiA
FT                   SWALL:PSA1_ECOLI (SWALL:P18148) (239 aa) fasta scores: E():
FT                   4.2e-66, 95.18% id in 166 aa"
FT   misc_feature    56842..57333
FT                   /note="Pfam match to entry PF06952.1 PsiA, , score 301.9,
FT                   E-value 9.8e-88"
FT   CDS             57339..57653
FT                   /transl_table=11
FT                   /locus_tag="pCoo073"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas putida hypothetical protein
FT                   SWALL:Q8VMN4 (EMBL:AJ344068) (116 aa) fasta scores: E():
FT                   2.1e-21, 60.57% id in 104 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNZ2"
FT                   /protein_id="CAI79556.1"
FT                   /translation="MKWRYSLRWKLPYPCPGERELVSEVVEAGQPAPASVMSRWVAGAG
FT                   YAVCLDFISDRPVRRWSEERKAAVRRRNLEKRINRHAPLFADELIARELAERPDYFQGK
FT                   "
FT   misc_RNA        complement(57751..57815)
FT                   /gene="sok"
FT                   /note="antisense RNA of hok mRNAs"
FT   CDS             57803..58018
FT                   /transl_table=11
FT                   /gene="mok"
FT                   /locus_tag="pCoo074"
FT                   /product="modulator of hok protein"
FT                   /note="Similar to Plasmid R100 modulator of hok protein moK
FT                   SWALL:BAA78842 (EMBL:AP000342) (70 aa) fasta scores: E():
FT                   8.8e-08, 51.42% id in 70 aa, and to Escherichia coli flmc
FT                   protein homolog SWALL:FLC2_ECOLI (SWALL:P23587) (70 aa)
FT                   fasta scores: E(): 8.8e-08, 51.42% id in 70 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNZ1"
FT                   /protein_id="CAI79557.1"
FT                   /translation="MSDQHQYGLLPCKLQGGVNHETTGKRPYLVRINRVLHVVDIHTPD
FT                   PESPVRSPAEGRIQGSYGNNGLRIRR"
FT   CDS             57861..58022
FT                   /transl_table=11
FT                   /gene="hok"
FT                   /locus_tag="pCoo075"
FT                   /product="post-segregation killing protein"
FT                   /note="Similar to Plasmid R100 post-segregation killing
FT                   protein hoK SWALL:BAA78843 (EMBL:AP000342) (52 aa) fasta
FT                   scores: E(): 2.4e-14, 72.54% id in 51 aa, and to
FT                   Escherichia coli stable plasmid inheritance protein flma or
FT                   stm or parB SWALL:FLMA_ECOLI (SWALL:P16077) (52 aa) fasta
FT                   scores: E(): 7.6e-15, 74.51% id in 51 aa"
FT                   /db_xref="GOA:Q2VNZ0"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNZ0"
FT                   /protein_id="CAI79558.1"
FT                   /translation="MKLPGNALIWCVLIVCCTLLIFTLLTRNRLCEVRLKDGYREVTAT
FT                   MAYESGGK"
FT   misc_feature    57867..58016
FT                   /note="Pfam match to entry PF01848 HOK_GEF, , score 88.0,
FT                   E-value 2.3e-23"
FT   misc_feature    57870..57938
FT                   /note="1 probable transmembrane helix predicted for hok by
FT                   TMHMM2.0 at aa 4-26"
FT   repeat_region   58279..58284
FT                   /note="target site duplication for IS679: second copy at
FT                   19831..19836. Separated by IS100 insertion and
FT                   recombination"
FT   repeat_region   58285..58310
FT                   /note="IS679 terminal IR"
FT   repeat_region   58285..58464
FT                   /note="partial IS679, 3' end at 17305..19830. Separated by
FT                   IS100 insertion and recombination"
FT   CDS             58359..58469
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo076"
FT                   /product="IS element transposase (pseudogene)"
FT                   /note="Similar to Escherichia coli IS679 orf49 protein
FT                   SWALL:Q9R3N0 (EMBL:AB024946) (216 aa) fasta scores: E():
FT                   2.1e-11, 100% id in 33 aa. Interrupted by IS100 insertion
FT                   and separated from C-terminus (at 17307..17861) by
FT                   reconbination"
FT   repeat_region   58465..58469
FT                   /note="direct repeat caused by insertion of IS element and
FT                   subsequent recombination; second copy at 17305..17309"
FT   repeat_region   58470..58497
FT                   /rpt_type=INVERTED
FT                   /note="IS terminal IR"
FT   repeat_region   58470..60423
FT                   /note="IS100 element"
FT   CDS             complement(58536..59315)
FT                   /transl_table=11
FT                   /locus_tag="pCoo077"
FT                   /product="putative IS100 element ATP-binding protein"
FT                   /note="Similar to Klebsiella pneumoniae is100 ATP-binding
FT                   protein lv009 SWALL:AAR07862 (EMBL:AY378100) (260 aa) fasta
FT                   scores: E(): 5.3e-85, 95.76% id in 260 aa"
FT                   /db_xref="GOA:P74994"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:P74994"
FT                   /protein_id="CAI79560.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   misc_feature    complement(58611..59150)
FT                   /note="Pfam match to entry PF01695.6 IstB, , score 369.7,
FT                   E-value 3.7e-108"
FT   misc_feature    complement(58968..58991)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS             complement(59315..60337)
FT                   /transl_table=11
FT                   /locus_tag="pCoo078"
FT                   /product="putative IS100 transposase"
FT                   /note="Similar to Escherichia coli, Yersinia pestis, and
FT                   Yersinia pseudotuberculosis is100 transposase SWALL:P74993
FT                   (EMBL:AF550679) (340 aa) fasta scores: E(): 4.3e-139,
FT                   98.82% id in 340 aa"
FT                   /db_xref="GOA:Q2VNY8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNY8"
FT                   /protein_id="CAI79561.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHPGENQVNFDKSPLHHPLSIYDSFCRGVA
FT                   "
FT   misc_feature    complement(59459..59992)
FT                   /note="Pfam match to entry PF00665.10 rve, , score 84.2,
FT                   E-value 3.4e-22"
FT   misc_feature    complement(60215..60334)
FT                   /note="Pfam match to entry PF02796.5 HTH_7, , score 29.2,
FT                   E-value 1.2e-05"
FT   misc_feature    complement(60221..60286)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2147.000, SD 6.50 at aa 18-39, sequence
FT                   MSSRAIARELGISRNTVKRYLQ"
FT   misc_feature    complement(60287..60490)
FT                   /note="Pfam match to entry PF01527 Transposase_8, , score
FT                   64.0, E-value 4.1e-16"
FT   repeat_region   complement(60396..60423)
FT                   /rpt_type=INVERTED
FT                   /note="IS terminal IR"
FT   repeat_region   60424..60428
FT                   /note="direct repeat caused by insertion of IS element and
FT                   subsequent recombination; second copy at 15346..15350"
FT   repeat_region   60627..60659
FT                   /note="IS2 terminal IR"
FT   CDS             join(60921..60998,61000..61038,61038..61076,61075..61122,
FT                   61125..61199,61199..61309,61313..61360,61363..61839,
FT                   65423..65710)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo079"
FT                   /product="group II intron-encoded reverse
FT                   transcriptase/maturase (pseudogene)"
FT                   /note="Similar to Escherichia coli reverse transcriptase
FT                   SWALL:Q8GAR1 (EMBL:AF512503) (410 aa) fasta scores: E():
FT                   1.6e-119, 77.93% id in 417 aa, and to Pseudomonas putida
FT                   group ii intron-encoding maturase, putative pp4446
FT                   SWALL:Q88EL6 (EMBL:AE016790) (373 aa) fasta scores: E():
FT                   5.7e-14, 29.01% id in 355 aa"
FT                   /db_xref="PSEUDO:CAI79562.1"
FT   misc_feature    61056..61733
FT                   /note="Pfam match to entry PF00078.11 RVT, , score 53.9,
FT                   E-value 4.3e-13"
FT   repeat_region   61840..61865
FT                   /note="IS629 terminal IR"
FT   repeat_region   join(61840..62635,64906..65421)
FT                   /note="IS629"
FT   repeat_region   61849..61995
FT                   /rpt_type=INVERTED
FT                   /note="rep4; imperfect"
FT   CDS             61895..62221
FT                   /transl_table=11
FT                   /locus_tag="pCoo080"
FT                   /product="insertion element IS629 protein"
FT                   /note="Similar to Shigella flexneri, and Shigella sonnei
FT                   insertion element is629 hypothetical 12 kDa protein s4062
FT                   SWALL:YIS3_SHIFL (SWALL:P16941) (108 aa) fasta scores: E():
FT                   8.9e-39, 95.37% id in 108 aa"
FT                   /db_xref="GOA:Q7DK18"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DK18"
FT                   /protein_id="CAI79563.1"
FT                   /translation="MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTSAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   misc_feature    61904..62164
FT                   /note="Pfam match to entry PF01527.7 Transposase_8, , score
FT                   45.0, E-value 2.1e-10"
FT   misc_feature    61985..62050
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1328.000, SD 3.71 at aa 31-52, sequence
FT                   AAICSIAPKIGCTPETLRVWVR"
FT   CDS             join(62218..62635,64906..65378)
FT                   /transl_table=11
FT                   /locus_tag="pCoo081"
FT                   /product="transposase for insertion sequence element IS629
FT                   (contains group II intron)"
FT                   /note="Similar to Shigella sonnei transposase for insertion
FT                   sequence element is629 SWALL:T629_SHISO (SWALL:P16942) (296
FT                   aa) fasta scores: E(): 2.5e-119, 97.29% id in 296 aa"
FT                   /db_xref="GOA:O88137"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:O88137"
FT                   /protein_id="CAI79564.1"
FT                   /translation="MMPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARA
FT                   QHDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKK
FT                   VRTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGW
FT                   RVSSSMETTFVLDALEQALWARRPSGTIHHSDKGSQYVSLAYTERLKEAGLLASTGSTG
FT                   DSYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHTPPAEA
FT                   EKAYYASIGNDDLAA"
FT   misc_feature    62590..63066
FT                   /note="Pfam match to entry PF00665.10 rve, , score 160.6,
FT                   E-value 3.3e-45"
FT   misc_feature    62636..64905
FT                   /note="putative group II intron"
FT   CDS             63307..64815
FT                   /transl_table=11
FT                   /locus_tag="pCoo082"
FT                   /product="group II intron-encoded reverse
FT                   transcriptase/maturase"
FT                   /note="Similar to Escherichia coli Orf59 protein orf59
FT                   SWALL:Q9S109 (EMBL:AB024946) (502 aa) fasta scores: E():
FT                   4.7e-215, 100% id in 502 aa, and to Bacillus anthracis
FT                   group ii intron reverse transcriptase/maturase, bxa0035
FT                   SWALL:Q8KYR5 (EMBL:AE011190) (643 aa) fasta scores: E():
FT                   6.3e-29, 28.94% id in 501 aa"
FT                   /db_xref="GOA:Q2VNY5"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNY5"
FT                   /protein_id="CAI79565.1"
FT                   /translation="MQRKLATWAVTDPSLRIQRLLRLITQPEWLAEAARITLSSKGAHT
FT                   PGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLGIPALRDR
FT                   IVQRAMLMAMEPIWESDFHTLSYGFRPERSVHHAIRTVKLQLTDCGETRGRWVIEGDLS
FT                   SYFDTVHHRLLMKAVRRRISDARFMTLLWKTIKAGHIDVGLFRAASEGVPQGGVISPLL
FT                   SNIMLNEFDQYLHERYLSGKARKDRWYWNNSIQRGRSTAVRENWQWKPAVAYCRYADDF
FT                   VLIVKGTKAQAEAIREECRGVLEGSLKLRLNMDKTKITHVNDGFIFLGHRIIRKRSRYG
FT                   EMRVVSTIPQEKARNFAASLTALLSGNYSESKVDMAEQLNRKLKGWAMFYQFVDFKAKV
FT                   FSYIDRVVFWKLAHWLARKYRTGIASLMRWWCKSPKPGQSKTWVLFGKTNHGKLSGEIL
FT                   YRLVGQGKKLFRWRLPEGNPYLRTETRNTYTSRFTEVAMAFASI"
FT   misc_feature    63535..64302
FT                   /note="Pfam match to entry PF00078.11 RVT, , score 243.0,
FT                   E-value 5.3e-70"
FT   repeat_region   complement(65396..65421)
FT                   /note="IS629 terminal IR"
FT   repeat_region   65776..65998
FT                   /rpt_type=DIRECT
FT                   /note="rep11"
FT   CDS             65778..65891
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo083"
FT                   /product="putative IS element transposase (partial)"
FT                   /note="Similar to Escherichia coli Orf51 protein orf51
FT                   SWALL:Q9S116 (EMBL:AB024946) (523 aa) fasta scores: E():
FT                   7.1e-14, 97.36% id in 38 aa"
FT   CDS             join(66793..66870,66873..67226)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo084"
FT                   /product="transcriptional regulator (pseudogene)"
FT                   /note="Similar to Escherichia coli hth-type transcriptional
FT                   activator CsvR csvR SWALL:CSVR_ECOLI (SWALL:P43460) (301
FT                   aa) fasta scores: E(): 2.3e-52, 95.83% id in 144 aa, and to
FT                   Escherichia coli cfa/i fimbrial subunit d cfaD
FT                   SWALL:CFAD_ECOLI (SWALL:P25393) (265 aa) fasta scores: E():
FT                   1.9e-40, 75.69% id in 144 aa, and to Escherichia coli
FT                   regulatory protein RnS rnS SWALL:RNS_ECOLI (SWALL:P16114)
FT                   (265 aa) fasta scores: E(): 6.9e-39, 75% id in 144 aa"
FT   repeat_region   67620..67627
FT                   /note="IS element target site duplication"
FT   repeat_region   complement(67628..67650)
FT                   /note="IS element terminal IR"
FT   repeat_region   67628..68379
FT                   /note="IS1-family insertion element"
FT   CDS             67684..67956
FT                   /transl_table=11
FT                   /locus_tag="pCoo085"
FT                   /product="IS1-family insertion element protein"
FT                   /note="Similar to Shigella dysenteriae insertion element
FT                   iso-is1n protein InsA insA SWALL:INA2_SHIDY (SWALL:P03829)
FT                   (90 aa) fasta scores: E(): 1.3e-31, 88.88% id in 90 aa"
FT                   /db_xref="GOA:Q2VNY4"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNY4"
FT                   /protein_id="CAI79568.1"
FT                   /translation="MAIVTVHCPRCQSAQVYRHGQNPKGRARFRCRDCHRVFLLTYTYE
FT                   ARKPGVKEQITEMAFNGAGVRDTSRTLKIGINTVIRTLKNSRQRE"
FT   misc_feature    67684..67944
FT                   /note="Pfam match to entry PF03811.3 Ins_element1, , score
FT                   222.5, E-value 8e-64"
FT   CDS             join(67983..68075,68075..68365)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo086"
FT                   /product="IS1-family insertion element protein
FT                   (pseudogene)"
FT                   /note="Similar to Shigella dysenteriae insertion element
FT                   iso-is1n protein InsB insB SWALL:INBN_SHIDY (SWALL:P03832)
FT                   (131 aa) fasta scores: E(): 9.5e-46, 85.49% id in 131 aa"
FT   misc_feature    67986..68363
FT                   /note="Pfam match to entry PF03400.3 Transposase_27, ,
FT                   score 314.4, E-value 1.7e-91"
FT   repeat_region   68357..68379
FT                   /note="IS element terminal IR"
FT   repeat_region   68380..68387
FT                   /note="IS element target site duplication"
FT   CDS             68667..69035
FT                   /transl_table=11
FT                   /locus_tag="pCoo087"
FT                   /product="hypothetical secreted protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNY3"
FT                   /protein_id="CAI79570.1"
FT                   /translation="MKRIILSLSVIFCSHSALAGSTDWQPSVGPGQRIVYAEIGETGGY
FT                   KWNNQNECNEVVRRGYAIGVGVSGKVIYEGNKPGYNGDSISYSGIVTPYRDYKRQAPAV
FT                   YNGKKKVAHGDSYTYWAK"
FT   misc_feature    68667..68724
FT                   /note="Signal peptide predicted for pCoo087 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.895) with cleavage site
FT                   probability 0.434 between residues 20 and 21"
FT   CDS             complement(69139..70335)
FT                   /transl_table=11
FT                   /locus_tag="pCoo088"
FT                   /product="putative transposase for insertion sequence
FT                   element IS186"
FT                   /note="Similar to Escherichia coli putative transposase
FT                   insl for insertion sequence element is186a/b/c (insl1 or
FT                   b0016) and (insl2 or b0582) and (insl3 or b2394)
FT                   SWALL:INSL_ECOLI (SWALL:P08409) (370 aa) fasta scores: E():
FT                   1.6e-142, 93.22% id in 369 aa"
FT                   /db_xref="GOA:Q2VNY2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNY2"
FT                   /protein_id="CAI79571.1"
FT                   /translation="MNYSHDNWSAILAHIGKPEELDTSARNAGALTRRREIREAATLLR
FT                   LGLAYGPGGMSLREVTAWAQLHDVATLSDVALLKRLQNAADWFGTLAAQTLAVRAAVTG
FT                   CTSGKGLRLVDGTAISEPGGGSAEWRLHMGYDPHTCQFTDFELTDGRDAERLDRFAQTA
FT                   DEIHIADRGFGSRPECIRSLAFGEADYIVRVHWRGLRWLTAEVMRFDMMGFLCGLDCGK
FT                   NGETTVMIGNSGNKKAGDPFPARLIAGSLPPEKALISKTRLLSENPRKGRVVQAEPLKA
FT                   AGHVLLLTSLSEDEYSAEQVADCYRLRWQIELAFKRLKSLLHLDALRAKDPELAKEWIF
FT                   ANLLAAFLIDDIIQPSLDFPPEVPDPKRRTNSLWRITKMVILYYEGRIIKRVHYLSSG"
FT   misc_feature    complement(69292..70005)
FT                   /note="Pfam match to entry PF01609.9 Transposase_11, ,
FT                   score 135.6, E-value 1.1e-37"
FT   CDS             complement(70651..71511)
FT                   /transl_table=11
FT                   /locus_tag="pCoo089"
FT                   /product="AraC-family trancriptional regulator"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   regulator protein ydeR SWALL:Q9ALK2 (EMBL:AY009096) (286
FT                   aa) fasta scores: E(): 4.4e-81, 70.38% id in 287 aa, and to
FT                   Yersinia pestis f1 operon positive regulatory protein caf1r
FT                   or ypmt1.81c or y5193 or y1097 SWALL:CAFR_YERPE
FT                   (SWALL:P26950) (301 aa) fasta scores: E(): 6.7e-39, 41.31%
FT                   id in 288 aa"
FT                   /db_xref="GOA:Q2VNY1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNY1"
FT                   /protein_id="CAI79572.1"
FT                   /translation="MIKEATINSILKYIDENIEVFPININVLVKYSGYSRRYLQLLFKE
FT                   IIGLSIGKYIQRRRVTRAAIYLRLTNLPIAIISEKLCYDSQQTFSREFKKNSGYSPLQF
FT                   RRDEAWLFKNQIGHRDIETPFPIPELCYLPRKMFAGTIIKYKEKIPYTSTSSKIKRGVV
FT                   QSLFSQRENTLFISNKITQGNSNKNEFVINSIIWKKKDLDAEYLMEGGVYALFRYAGNP
FT                   DGYSTYINSIYLNVLPFYGLQKRNTLDLEIISIDVHGYRYFEYYLPIEDKDLDFRPERK
FT                   ELDYP"
FT   misc_feature    complement(71194..71328)
FT                   /note="Pfam match to entry PF00165.8 HTH_AraC, , score
FT                   50.5, E-value 4.6e-12"
FT   misc_feature    complement(71344..71487)
FT                   /note="Pfam match to entry PF00165.8 HTH_AraC, , score
FT                   30.9, E-value 3.7e-06"
FT   CDS             71772..72008
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo090"
FT                   /product="putative IS element transposase (fragment)"
FT                   /note="Similar to Vibrio vulnificus issod13, transposase
FT                   vv1738 or vv1842 or vv2191 or vv3176 or vva1413
FT                   SWALL:Q7M7C9 (EMBL:AP005337) (346 aa) fasta scores: E():
FT                   8.5e-23, 79.48% id in 78 aa"
FT   CDS             complement(71953..72336)
FT                   /transl_table=11
FT                   /locus_tag="pCoo091"
FT                   /product="immunity protein for colicin Ib"
FT                   /note="Similar to Escherichia coli immunity protein for
FT                   colicin ib SWALL:IMMJ_ECOLI (SWALL:P08702) (115 aa) fasta
FT                   scores: E(): 5.9e-42, 98.18% id in 110 aa"
FT                   /db_xref="GOA:Q2VNY0"
FT                   /db_xref="InterPro:IPR003061"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNY0"
FT                   /protein_id="CAI79574.1"
FT                   /translation="MKLDISVKYLLKSLIPSLIILTVFYLGWKDNQENARMFYAFIGCI
FT                   ISAITFPFSMRIIQKMVIRFTGKEFWQKDFFTNPVGGSLTAIFELFCFVISVPVVAIYL
FT                   IFIFCKRRRNQQQPVQLPHRYGS"
FT   misc_feature    complement(join(72016..72084,72163..72222,72256..72324))
FT                   /note="3 probable transmembrane helices predicted for
FT                   pCoo091 by TMHMM2.0 at aa 5-27, 39-58 and 85-107"
FT   misc_feature    complement(72094..72201)
FT                   /note="Pfam match to entry PF03526.3 Microcin, , score
FT                   22.5, E-value 7.6e-06"
FT   CDS             72494..72802
FT                   /transl_table=11
FT                   /locus_tag="pCoo092"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli p9 colicin ib structural
FT                   and immunity genes SWALL:Q47298 (EMBL:M13820) (102 aa)
FT                   fasta scores: E(): 7.7e-44, 97.05% id in 102 aa, and to
FT                   Escherichia coli hypothetical protein SWALL:Q47295
FT                   (EMBL:M13819) (102 aa) fasta scores: E(): 1.5e-42, 94.11%
FT                   id in 102 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNX9"
FT                   /protein_id="CAI79575.1"
FT                   /translation="MDSKKMWRSNYAPPLLRILWRLGIRLPPLPFMAFWQVTVLTGGLW
FT                   GISWGCAMWFIYWVPSGMVAGEAIIISITGGFLSGLCMASFHWWRRKVNLLPPWDDV"
FT   misc_feature    join(72602..72670,72683..72751)
FT                   /note="2 probable transmembrane helices predicted for
FT                   pCoo092 by TMHMM2.0 at aa 37-59 and 64-86"
FT   repeat_region   72819..73179
FT                   /rpt_type=DIRECT
FT                   /note="rep7"
FT   CDS             complement(72820..73326)
FT                   /transl_table=11
FT                   /locus_tag="pCoo093"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   SWALL:Q7WTH7 (EMBL:AY205565) (196 aa) fasta scores: E():
FT                   9.8e-60, 94.64% id in 168 aa, and to Salmonella typhimurium
FT                   YdeA protein ydeA SWALL:Q8L240 (EMBL:AP005147) (196 aa)
FT                   fasta scores: E(): 9.8e-60, 94.64% id in 168 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNX8"
FT                   /protein_id="CAI79576.1"
FT                   /translation="MLTRDIERVLERSGEAPVYGPNLRASCRRLEDAGWLRTLRALNLQ
FT                   LAVELMDAGRAVAQPLLRAEQDRLRAEQRTAEVVVLPLVPAAGLPADGTSATDLAVELN
FT                   GITYQACRGDFVVRLDGSTCLQLWNKEGRVVRREGDPLEVAQWLQACHDAGMEVRVQVN
FT                   ESITP"
FT   repeat_region   73222..73360
FT                   /rpt_type=DIRECT
FT                   /note="rep8"
FT   CDS             73358..74254
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo094"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   SWALL:Q7WTH5 (EMBL:AY205565) (712 aa) fasta scores: E():
FT                   2.4e-116, 98.99% id in 298 aa, and to Salmonella
FT                   typhimurium YdfB protein ydfB SWALL:Q8L238 (EMBL:AP005147)
FT                   (712 aa) fasta scores: E(): 2.4e-116, 98.99% id in 298 aa"
FT   misc_feature    73376..73420
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS             complement(74416..74832)
FT                   /transl_table=11
FT                   /locus_tag="pCoo095"
FT                   /product="PIN-domain containing protein"
FT                   /note="Similar to Salmonella typhimurium McK protein mcK
FT                   SWALL:Q8L237 (EMBL:AP005147) (138 aa) fasta scores: E():
FT                   1.6e-52, 99.27% id in 138 aa, and to Klebsiella pneumoniae
FT                   vagd vagd or lv096 SWALL:AAR07702 (EMBL:AY378100) (147 aa)
FT                   fasta scores: E(): 5.7e-47, 89.13% id in 138 aa"
FT                   /db_xref="GOA:Q2VNX7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNX7"
FT                   /protein_id="CAI79578.1"
FT                   /translation="MNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYS
FT                   EMRFGATGPKASPRHVQLVDEFCARLDAILPWDRAAVDATTKVKVALRLAGTPIGPNDT
FT                   AIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK"
FT   misc_feature    complement(74425..74820)
FT                   /note="Pfam match to entry PF01850.8 PIN, , score 71.4,
FT                   E-value 2.4e-18"
FT   CDS             75579..76031
FT                   /transl_table=11
FT                   /locus_tag="pCoo096"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium, and Shigella
FT                   sonnei yeda protein yeda or ybfA SWALL:Q9Z4E9
FT                   (EMBL:AP005147) (150 aa) fasta scores: E(): 3.9e-61, 99.33%
FT                   id in 150 aa, and to Escherichia coli plasmid pcolbm-cl139
FT                   d protein SWALL:Q52133 (EMBL:J03312) (150 aa) fasta scores:
FT                   E(): 8.5e-61, 98.66% id in 150 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNX6"
FT                   /protein_id="CAI79579.1"
FT                   /translation="MTVPARKRKKESPMFFIENEGQAVARTDYWQSVQAQAGYVYLSWN
FT                   AGAARLLVPDAAKHLLREMRGAEYVIISKGTLHGRDALELVFEDGSDAPFVIHMLSEQC
FT                   DRLLPENNQGGGFVVTVWTRGGNQLRYPGKYRVVENLPDVSPWSEH"
FT   CDS             76033..76818
FT                   /transl_table=11
FT                   /locus_tag="pCoo097"
FT                   /product="resolvase"
FT                   /note="Similar to Escherichia coli resolvase resd or D
FT                   SWALL:REDM_ECOLI (SWALL:P18021) (260 aa) fasta scores: E():
FT                   2.3e-99, 96.48% id in 256 aa, and to Salmonella
FT                   typhimurium, and Shigella sonnei ResA protein resA
FT                   SWALL:Q9Z4E8 (EMBL:AP005147) (259 aa) fasta scores: E():
FT                   8.1e-100, 96.12% id in 258 aa"
FT                   /db_xref="GOA:Q6JB09"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB09"
FT                   /protein_id="CAI79580.1"
FT                   /translation="MQHLPAPIHHARDVAQLPVAIDYPAALALRQMSMVHDELPKYLLA
FT                   PEVSALLHYVPDLRRKMLLATLWNTGARINEALALTRGDFSLAPPYPFVQLATLKQRTE
FT                   KAARTAGRMPAGQQTHRLVPLSDTWYVSQLQTMVATLKIPMERRNKRTGRTEKARIWEV
FT                   TDRTVRTWIGEAVAAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSI
FT                   SSTEVYTKVFALDVAARHRVQFAMPEADAVALIKQLERR"
FT   repeat_region   76121..76806
FT                   /rpt_type=DIRECT
FT                   /note="rep9"
FT   misc_feature    76132..76746
FT                   /note="Pfam match to entry PF00589.8 Phage_integrase, ,
FT                   score 193.3, E-value 4.7e-55"
FT   misc_feature    76486..76551
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1437.000, SD 4.08 at aa 152-173, sequence
FT                   TGRTEKARIWEVTDRTVRTWIG"
FT   CDS             77420..78052
FT                   /transl_table=11
FT                   /locus_tag="pCoo098"
FT                   /product="parA-like protein"
FT                   /note="Similar to Yersinia enterocolitica hypothetical
FT                   protein orf79 SWALL:Q93KR1 (EMBL:AF336309) (209 aa) fasta
FT                   scores: E(): 1e-55, 77.88% id in 208 aa, and to Xanthomonas
FT                   campestris Para1 para1 SWALL:Q7X0Z8 (EMBL:AY228335) (210
FT                   aa) fasta scores: E(): 9.9e-44, 61.83% id in 207 aa"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB08"
FT                   /protein_id="CAI79581.1"
FT                   /translation="MAWIVGFISQKGGVGKSTKARALAREASACGIKTKLADLDLEQAT
FT                   SAEWHRRRLSAGLSPVASVEVFSTAKQAIESAGDFDLLILDGPARASKGTSEIAKVADL
FT                   IVQPTGASLDDLVPAIKVFNALVKEGIPRSKLVFALSRVGTEAEELDARAYISEAGYET
FT                   LSGCLFEKPAYRKAMNSGLAVTETRYKGLNERADELIQALIDKIGEE"
FT   CDS             78052..78426
FT                   /transl_table=11
FT                   /locus_tag="pCoo099"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia enterocolitica hypothetical
FT                   protein orf78 SWALL:Q93KR2 (EMBL:AF336309) (102 aa) fasta
FT                   scores: E(): 8.4e-10, 56.55% id in 122 aa, and to
FT                   Xanthomonas campestris hypothetical protein Orf215 orf215
FT                   SWALL:Q7X0Z7 (EMBL:AY228335) (110 aa) fasta scores: E():
FT                   2.1e-06, 48.76% id in 121 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNX3"
FT                   /protein_id="CAI79582.1"
FT                   /translation="MADASKLRTKRTRSGLGVPPGPDEVATSLNAPEIAPAVAATDVQR
FT                   QQADSSPVHHEPVVTQTVTEVYTRRDGRSARKTNRTLAFATRVTPAFDQEIRDIAEREG
FT                   LKLVEVLEKAVEAYKEKQGY"
FT   CDS             78665..79639
FT                   /transl_table=11
FT                   /gene="stbA"
FT                   /locus_tag="pCoo100"
FT                   /product="plasmid stability protein StbA"
FT                   /note="Similar to Escherichia coli protein StbA stbA
FT                   SWALL:STBA_ECOLI (SWALL:P11904) (320 aa) fasta scores: E():
FT                   3.2e-42, 42.45% id in 318 aa, and to Escherichia coli StbA
FT                   protein stbA SWALL:Q9S100 (EMBL:AB024946) (323 aa) fasta
FT                   scores: E(): 1.1e-73, 67.28% id in 324 aa"
FT                   /db_xref="InterPro:IPR009440"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB07"
FT                   /protein_id="CAI79583.1"
FT                   /translation="MRIFCDDGSTNVKLAWFEGKTLKSAVSVNSFRHNWKVEGLGSSRT
FT                   YNYLLDGRKYTYDPVSEDAISTTHIEYQYSDTNVLAVHHALLNSGIEPQEIDLTVTLPI
FT                   SEFYTADCQKNTLNIERKIRNLMREVTLNKGGTFTIKSVEVMPESLPAVFTRLVADNVG
FT                   QYEKSLVIDLGGTTLDVGVIVGQFEDVSAVHGNPDIGVSMVTKATLTALKMASSDTSPM
FT                   IADELIKNRKNLDFVGQVVNEVSKLNLVLDTIDTAINKLGELVVDDLLQYRNVNRVYIV
FT                   GGGAALIADAVRKAWNHLGEKVVLMDEPQTALVQAIARFKAEE"
FT   misc_feature    78665..79624
FT                   /note="Pfam match to entry PF06406.1 StbA, , score 635.9,
FT                   E-value 2.8e-188"
FT   CDS             79643..80035
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="pCoo101"
FT                   /product="plasmid stability protein StbB"
FT                   /note="Similar to Escherichia coli StbB protein stbB
FT                   SWALL:Q9S101 (EMBL:AB024946) (130 aa) fasta scores: E():
FT                   3.6e-20, 46.51% id in 129 aa, and to Shigella flexneri StbB
FT                   protein stbB SWALL:Q99QK3 (EMBL:AL391753) (131 aa) fasta
FT                   scores: E(): 6.5e-07, 32.28% id in 127 aa"
FT                   /db_xref="InterPro:IPR019720"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB06"
FT                   /protein_id="CAI79584.1"
FT                   /translation="MYDGEERKKLSLYLHPEDSADCLALAEIETVPRKKRGELYRQALI
FT                   TGLIMHQLDERIPAVLTALFTRELNADEVISQIARITGWKPSSGDLKEVLKALGGLQST
FT                   VSPEHSQDDGEQARLKAARVKMQNLI"
FT   CDS             80409..80678
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium, and Shigella
FT                   sonnei yfaa protein yfaa or yccA SWALL:Q9Z4E3
FT                   (EMBL:AP005147) (89 aa) fasta scores: E(): 3.6e-37, 98.87%
FT                   id in 89 aa, and to Escherichia coli O157:H7 hypothetical
FT                   protein l7070 SWALL:Q9ZGS5 (EMBL:AF074613) (90 aa) fasta
FT                   scores: E(): 2e-34, 94.44% id in 90 aa"
FT                   /db_xref="InterPro:IPR016388"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNX0"
FT                   /protein_id="CAI79585.1"
FT                   /translation="MWLYACCGWLCPAYPQHFVHGSVDKIPGYPGRAGTLTGLHPMQVC
FT                   RCRRPPHPVTFRRSSSTRCGFGAAPAFVCGRPVTGAARPDGGRM"
FT   CDS             80662..80928
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo103"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Similar to Shigella flexneri orf, hypothetical yccB
FT                   SWALL:Q9AFP1 (EMBL:AF348706) (255 aa) fasta scores: E():
FT                   4e-29, 85.22% id in 88 aa, and to Escherichia coli
FT                   hypothetical protein yfcB SWALL:Q9S4X5 (EMBL:AF106329) (168
FT                   aa) fasta scores: E(): 1.4e-28, 94.87% id in 78 aa"
FT   CDS             join(80925..81164,81167..81241)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="pCoo103"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="Similar to Shigella sonnei YddA protein yddA
FT                   SWALL:Q9Z4D0 (EMBL:AB021078) (156 aa) fasta scores: E():
FT                   6.4e-42, 97.05% id in 102 aa"
FT   CDS             complement(81287..81550)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pilV'"
FT                   /locus_tag="pCoo104"
FT                   /product="pilV alternative C-terminus (fragment)"
FT                   /note="Similar to Escherichia coli shufflon protein c
FT                   SWALL:SHU5_ECOLI (SWALL:P09749) (444 aa) fasta scores: E():
FT                   5.4e-38, 98.85% id in 87 aa, and to Salmonella typhi pilv
FT                   pilv or sty4550 or t4250 SWALL:O51801 (EMBL:AF000001) (435
FT                   aa) fasta scores: E(): 6.4e-27, 68.6% id in 86 aa"
FT   repeat_region   complement(81533..81551)
FT                   /note="pilV shufflon repeat"
FT   repeat_region   81560..81578
FT                   /note="pilV shufflon repeat"
FT   CDS             81561..81818
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pilV'"
FT                   /locus_tag="pCoo105"
FT                   /product="pilV alternative C-terminus (fragment)"
FT                   /note="Similar to Escherichia coli shufflon protein b
FT                   SWALL:SHU3_ECOLI (SWALL:P09747) (442 aa) fasta scores: E():
FT                   1.1e-34, 98.82% id in 85 aa, and to Salmonella typhi pilv
FT                   pilv or sty4550 or t4250 SWALL:O51801 (EMBL:AF000001) (435
FT                   aa) fasta scores: E(): 0.89, 33.7% id in 89 aa"
FT   CDS             complement(81820..82083)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pilV'"
FT                   /locus_tag="pCoo106"
FT                   /product="pilV alternative C-terminus (fragment)"
FT                   /note="Similar to Escherichia coli shufflon protein b'
FT                   SWALL:SHU4_ECOLI (SWALL:P09748) (444 aa) fasta scores: E():
FT                   2.8e-35, 100% id in 87 aa, and to Salmonella typhimurium
FT                   orfb' SWALL:BAB91678 (EMBL:AP005147) (83 aa) fasta scores:
FT                   E(): 1.3e-33, 100% id in 83 aa"
FT   repeat_region   complement(82066..82084)
FT                   /note="pilV shufflon repeat"
FT   repeat_region   82093..82111
FT                   /note="pilV shufflon repeat"
FT   CDS             82094..82315
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pilV'"
FT                   /locus_tag="pCoo107"
FT                   /product="pilV alternative C-terminus (fragment)"
FT                   /note="Similar to Salmonella typhimurium orfa' SWALL:Q8L216
FT                   (EMBL:AP005147) (74 aa) fasta scores: E(): 3.7e-33, 100% id
FT                   in 73 aa, and to Escherichia coli shufflon protein a'
FT                   SWALL:SHU2_ECOLI (SWALL:P09746) (430 aa) fasta scores: E():
FT                   1.5e-32, 100% id in 73 aa"
FT   CDS             complement(82312..82665)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pilV'"
FT                   /locus_tag="pCoo108"
FT                   /product="pilV alternative C-terminus (fragment)"
FT                   /note="Similar to Plasmid ColIb-P9 typeiv prepilin pilV
FT                   SWALL:BAA75177 (EMBL:AB021078) (474 aa) fasta scores: E():
FT                   2.9e-38, 100% id in 117 aa, and to Escherichia coli
FT                   shufflon protein a SWALL:SHU1_ECOLI (SWALL:P09745) (474 aa)
FT                   fasta scores: E(): 2.9e-38, 100% id in 117 aa"
FT   repeat_region   complement(82648..82666)
FT                   /note="pilV shufflon repeat"
FT   CDS             complement(82695..82994)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pilV'"
FT                   /locus_tag="pCoo109"
FT                   /product="pilV alternative C-terminus (fragment)"
FT                   /note="Similar to Escherichia coli shufflon protein d'
FT                   SWALL:SHU7_ECOLI (SWALL:P09751) (456 aa) fasta scores: E():
FT                   6.8e-41, 100% id in 99 aa, and to Salmonella typhimurium
FT                   orfd' SWALL:Q8L217 (EMBL:AP005147) (95 aa) fasta scores:
FT                   E(): 3.2e-39, 100% id in 95 aa"
FT   repeat_region   complement(82977..82995)
FT                   /note="pilV shufflon repeat"
FT   CDS             complement(83024..83782)
FT                   /transl_table=11
FT                   /gene="pilV"
FT                   /locus_tag="pCoo110"
FT                   /product="typeIV prepilin (truncated)"
FT                   /note="Similar to Salmonella typhimurium typeIV prepilin
FT                   pilV SWALL:BAB91683 (EMBL:AP005147) (474 aa) fasta scores:
FT                   E(): 7.9e-92, 100% id in 249 aa, and to Escherichia coli
FT                   shufflon protein a SWALL:SHU1_ECOLI (SWALL:P09745) (474 aa)
FT                   fasta scores: E(): 7.9e-92, 100% id in 249 aa"
FT                   /db_xref="InterPro:IPR007001"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNW9"
FT                   /protein_id="CAI79594.1"
FT                   /translation="MKKYDRGWASLETGAALLIVMLLIAWGAGIWQDYIQTKGWQTEAR
FT                   LVSNWTSAARSYIGKNYTTLQGSSTTTTPAVITTTMLKNTGFLSSGFTETNSEGQRLQA
FT                   YVVRNAQNPELLQAMVVSSGGTPYPVKALIQMAKDITTGLGGYIQDGKTATGALRSWSV
FT                   ALSNYGAKSGNGHIAVLLSTDELSGAAEDTDRLYRFQVNGRPDLNKMHTAIDMGSNNLN
FT                   NVGAVNAQTGNFSGNVNGVNGTFSGQVTAL"
FT   misc_feature    complement(83030..83782)
FT                   /note="Pfam match to entry PF04917.2 Shufflon_N, , score
FT                   549.9, E-value 2.2e-162"
FT   misc_feature    complement(83324..83347)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(83693..83761)
FT                   /note="1 probable transmembrane helix predicted for pCoo110
FT                   by TMHMM2.0 at aa 12-34"
FT   CDS             complement(83782..84438)
FT                   /transl_table=11
FT                   /gene="pilU"
FT                   /locus_tag="pCoo111"
FT                   /product="prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="Similar to Salmonella typhimurium prepilin peptidase
FT                   pilU SWALL:O07379 (EMBL:AB027308) (218 aa) fasta scores:
FT                   E(): 6.6e-93, 100% id in 218 aa, and to Escherichia coli
FT                   type 4 prepilin-like proteins leader peptide processing
FT                   enzyme [includes: leader peptidase hofd or hopd or hopo or
FT                   b3335 SWALL:LEP4_ECOLI (SWALL:P25960) (225 aa) fasta
FT                   scores: E(): 0.0031, 24.74% id in 198 aa"
FT                   /db_xref="GOA:Q6JB05"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB05"
FT                   /protein_id="CAI79595.1"
FT                   /translation="MQTIVGISLSPVYILPLMFTFSIIGRTLLFRVRYFLSDTGHLWYK
FT                   THPAVLSGIWLYSIAVALIILSSSPLLYRIHAVLILSFILQMAVTDALTGLLPGTFTRR
FT                   FLIAGMLSQITTDIWWFRTTEFATAAIVLFCLHKLVNRHRLNIGTGDLWLIAGITAWSG
FT                   LYNAIWCVLLGTGGFVLWHSTWCIKGHKEGPLGPWLCFGHVLLLLDNLYQPLWVI"
FT   misc_feature    complement(83890..84207)
FT                   /note="Pfam match to entry PF01478.6 Peptidase_A24, , score
FT                   81.0, E-value 3e-21"
FT   misc_feature    complement(join(83914..83982,84019..84087,84145..84204,
FT                   84223..84291,84364..84432))
FT                   /note="5 probable transmembrane helices predicted for
FT                   pCoo111 by TMHMM2.0 at aa 12-34, 59-81, 88-107, 127-149 and
FT                   162-184"
FT   CDS             complement(84423..84983)
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="pCoo112"
FT                   /product="putative transglycosylase PilT"
FT                   /note="Similar to Escherichia coli, and Salmonella
FT                   typhimurium PilT protein pilT SWALL:O07378 (EMBL:AB021078)
FT                   (186 aa) fasta scores: E(): 3.8e-80, 100% id in 186 aa, and
FT                   to Salmonella typhimurium invasion protein iagb precursor
FT                   iagb or stm2877 SWALL:IAGB_SALTY (SWALL:P43017) (160 aa)
FT                   fasta scores: E(): 3.7e-18, 41.37% id in 145 aa"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB04"
FT                   /protein_id="CAI79596.1"
FT                   /translation="MSGGTVPLRLISLILLFSLIPPARASYVAPKQIWTNKWDNCFAAA
FT                   GARYQIEPLLLKAISAGESSLRPGAININKDKKTGKASSTDYGLMQINSTHIPKLINMG
FT                   VIKKSEDLITKPCLNIHIGSWILARHFQICGVSWNCLGSYNAGFRKDRHETREQYANKI
FT                   WRIYRDMKGICLPGQGGRQCRQS"
FT   misc_feature    complement(84483..84866)
FT                   /note="Pfam match to entry PF01464.7 SLT, , score 173.5,
FT                   E-value 4.4e-49"
FT   misc_feature    complement(84905..84983)
FT                   /note="Signal peptide predicted for pCoo112 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.986) with cleavage site
FT                   probability 0.578 between residues 25 and 26"
FT   CDS             complement(84993..85607)
FT                   /transl_table=11
FT                   /gene="pilS"
FT                   /locus_tag="pCoo113"
FT                   /product="type IV prepilin"
FT                   /note="Similar to Escherichia coli type iv prepilin pilS
FT                   SWALL:O88170 (EMBL:AB007463) (204 aa) fasta scores: E():
FT                   1.5e-71, 100% id in 204 aa"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB03"
FT                   /protein_id="CAI79597.1"
FT                   /translation="MLVENINTTLTGNNKKNEPHDKGWAILEQGTIALVVLFVIVVVLG
FT                   SLYALRTRANVATETANIQTIITSAQSLLKGSDGYTFTSSAKMTGALIQMGVIPSGMTV
FT                   QGDKTSGTATLYNAWGGAVTVAPASTSGFNNGFTVTYDKVPQDACIQIATRISKTGLTN
FT                   GITLNSTAHSDGKVTTEEASTQCKADNGSTGTNKLIFTING"
FT   misc_feature    complement(85464..85532)
FT                   /note="1 probable transmembrane helix predicted for pCoo113
FT                   by TMHMM2.0 at aa 26-48"
FT   CDS             complement(85625..86722)
FT                   /transl_table=11
FT                   /gene="pilR"
FT                   /locus_tag="pCoo114"
FT                   /product="integral membrane protein"
FT                   /note="Similar to Escherichia coli, and Salmonella
FT                   typhimurium integral membrane protein pilR SWALL:O07376
FT                   (EMBL:AB021078) (365 aa) fasta scores: E(): 3.5e-144, 100%
FT                   id in 365 aa"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB02"
FT                   /protein_id="CAI79598.1"
FT                   /translation="MREMNFSQRLRRFIVRKTFSAPYRVQFYEALRFLLENKQPLKTAL
FT                   EQMRDAWTDFGRKWHPFAELATDCIESLRENSGENSLEYTLSLWVPQEEAAVISAGIRS
FT                   GSIVDALQFATTLTDAKEQIHQAIWQMAIYPVGLLIMMTGTLYVLNTELIPELSKISSP
FT                   DSWSGALGFLYGLSVFVDNYGAICAVLFAVITGLISWSLPNWKSPDSVRTFADKIMPWS
FT                   IYQDIQGATFLLNMAALLKAKMTTLNSLNILQEFASPWLSTRLDSIIYRVRQGDHLGLA
FT                   LRQCGYQFPSREAANFLSLLQGDGATELISNYGQRWLSQTLQRVKKRANVIRLIMLIFL
FT                   VMSLMLLVFAIMDIQSISDNSMGNF"
FT   misc_feature    complement(85661..86035)
FT                   /note="Pfam match to entry PF00482.9 GSPII_F, , score 76.5,
FT                   E-value 7.2e-20"
FT   misc_feature    complement(join(85667..85735,86117..86185,86276..86344))
FT                   /note="3 probable transmembrane helices predicted for
FT                   pCoo114 by TMHMM2.0 at aa 127-149, 180-202 and 330-352"
FT   misc_feature    complement(86258..86650)
FT                   /note="Pfam match to entry PF00482.9 GSPII_F, , score 79.8,
FT                   E-value 6.9e-21"
FT   CDS             complement(86735..88288)
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="pCoo115"
FT                   /product="nucleotide-binding protein"
FT                   /note="Similar to Escherichia coli, and Salmonella
FT                   typhimurium nucleotide-binding protein pilQ SWALL:O07375
FT                   (EMBL:AB021078) (517 aa) fasta scores: E(): 7e-191, 100% id
FT                   in 517 aa"
FT                   /db_xref="GOA:Q6JB01"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB01"
FT                   /protein_id="CAI79599.1"
FT                   /translation="MDKYNLKDALLFISRGDTHEILIETNQRTRPDVQSNLQELLKLYP
FT                   DINPKVVSLSELQEAGQDEKNRGPKERIIHLKDLADVSESEKKVLSYFETARKLGASDI
FT                   HFLISESIFKVRMRIFGELQTVDEDQPALGYSLCATAILSMADVTETSFFPQREQDARL
FT                   SPQLMRKIGIFGARYSHRPTGDGLIAVMRLIPDDGDKVPTFKQLGFIPEQIRLLNIMLR
FT                   RPEGKIVLSGPTGSGKSTTLRSACRVYLDDNQGRHLLTIEDPLEGQILGATQTPIICDK
FT                   SDEDAVKLAWSRAISSAMRLDPDAIMEGEMRDLISMMSTTYAAQTGHIVLTTLHTNSAL
FT                   GIPERMITMGMNADLICDAQLLIGMISQRLVPTLCPSCRIPWEKRAPELSDDERDYLER
FT                   HCNKDSLCSTDNIWFRNHHGCSECNHDVIINGRKRGEIGKGLTGRTVIAEVIEPDNRLF
FT                   QILKTRGKVAARKYWLENMKGISRVEHLLRRINEGLVDPLEADRIIPLDEDERLSIDDV
FT                   "
FT   misc_feature    complement(87167..88051)
FT                   /note="Pfam match to entry PF00437.9 GSPII_E, , score
FT                   133.0, E-value 6.8e-37"
FT   misc_feature    complement(87572..87595)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS             complement(88299..88751)
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="pCoo116"
FT                   /product="PilP protein"
FT                   /note="Similar to Salmonella typhimurium PilP protein pilP
FT                   SWALL:O07374 (EMBL:AB027308) (150 aa) fasta scores: E():
FT                   4.7e-50, 100% id in 150 aa"
FT                   /db_xref="InterPro:IPR022753"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JB00"
FT                   /protein_id="CAI79600.1"
FT                   /translation="MRPGKLLIIPSIFFFSGFSFATTQPLVTIGELEAQQNRNILLQAK
FT                   VQGAQLQKQLEESDVTSSSETVSGFSGVTASLPSVSEQPTSKNRKELPVIMEINGKDKR
FT                   LNAVLRMADGRQTSVTTGSQLPGTSVTVKSISLSGVTLSDGTTLTF"
FT   misc_feature    complement(88646..88751)
FT                   /note="Signal peptide predicted for pCoo116 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.982) with cleavage site
FT                   probability 0.433 between residues 34 and 35"
FT   CDS             complement(88738..90033)
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="pCoo117"
FT                   /product="PilO protein"
FT                   /note="Similar to Salmonella typhimurium PilO protein pilO
FT                   SWALL:O07373 (EMBL:AB027308) (431 aa) fasta scores: E():
FT                   4.4e-170, 99.76% id in 431 aa"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAZ9"
FT                   /protein_id="CAI79601.1"
FT                   /translation="MADEDINPVVLLADPKVNHRVWAACLKWSPVVKKQRVPSHQKHKP
FT                   HVKSRRLTSLKVTVGSRSSRGKISRITGTGILARPERNHYFSLALAFCSWVRNGYGVFR
FT                   YSDKELLFLASINGQPAVMADLSGNDADVAQKVSLFLTMNEEPPEKWQVVSPLEHPDNW
FT                   ESIITRLSSADLRRCKLTVGNRSKFTLPAVLFLVAASAGTVFWMTQPEPDVVPTPEEIA
FT                   ARARLQFKKPDPPPELPHPWASQPVISDFLKACADLRKPSPVALEGWKLTGGTCTPETF
FT                   TLIYERQPGGTIEGFLARSKEIFNVIPDFNLKDGARLASVTRPLPSLPRRDEAVPTPSE
FT                   QLMRVFTWFQKKQLTPAINEIAIPEPLPGNDGEPAPVQKWKEYQFSLSTPVNPDELFPL
FT                   FQDTGVRLSNIHFELNGGTFSYSSEGHIYASR"
FT   misc_feature    complement(88744..89973)
FT                   /note="Pfam match to entry PF06864.1 PAP_PilO, , score
FT                   919.2, E-value 1.5e-273"
FT   CDS             complement(90026..91708)
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="pCoo118"
FT                   /product="lipoprotein (PilN protein)"
FT                   /note="Similar to Escherichia coli, and Salmonella
FT                   typhimurium lipoprotein pilN SWALL:O07372 (EMBL:AB021078)
FT                   (560 aa) fasta scores: E(): 1.2e-197, 99.82% id in 560 aa"
FT                   /db_xref="GOA:Q6JAZ8"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR013359"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAZ8"
FT                   /protein_id="CAI79602.1"
FT                   /translation="MKKSHQRSMKLAVLPCMIAVALSISGCTFSEINKMQKKAQEDSAH
FT                   AREKVSALSARKSQALTWLDNQWINPVPVAQVSREKKQTAPACYITQARKGEITLQELG
FT                   QRITAVCGIPVIITPDAANSTLEGGATRQMTGTLPAPDENGRLPLSSLGSTTMTTSTQP
FT                   LTLNNLMWQGDINGLLDLMASRSGLYWRMDNGRIVFYLTETRTYPLHMLNTKTSSSSSV
FT                   SSGSTSTMGATGGQDNSASGDATSSQSTTVGQEYDLYEDIRKTIEAMLTPEKGRYWLSA
FT                   SSSTLTVTDTPAVQEAVARYVDEQNSIMNRQVALNVQVLSVSNTRNEQFGLDWNLVYKS
FT                   LHSAGATLNNASGDFTGATSAGVSILDSATGNAAKFSGSSLLIKALSEQGDVSVVTSQE
FT                   STVTNLTPVPIQMADQTVYVAQSATTTTTDVGATTTLTPGMITTGFNMTLLPLIQKTGN
FT                   LQLQMNFNLSDPPTIRSFTSKDGNSYIEMPYTKLRSLSQKVNLKEGQSLVVTGFDQNNT
FT                   TTSKAGTFTPANPLFGGSQTGKNERSTLVIIITPTFPSGGNNG"
FT   misc_feature    complement(90044..90769)
FT                   /note="Pfam match to entry PF00263.9 Secretin_C, , score
FT                   34.9, E-value 1.4e-09"
FT   misc_feature    complement(90857..91099)
FT                   /note="Pfam match to entry PF07655.1 Secretin_N_2, , score
FT                   125.5, E-value 1.3e-34"
FT   misc_feature    complement(91615..91708)
FT                   /note="Signal peptide predicted for pCoo118 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.523 between residues 30 and 31"
FT   misc_feature    complement(91628..91660)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS             complement(91722..92159)
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="pCoo119"
FT                   /product="PilM protein"
FT                   /note="Similar to Escherichia coli, and Salmonella
FT                   typhimurium PilM protein pilM SWALL:O07371 (EMBL:AB021078)
FT                   (145 aa) fasta scores: E(): 3e-54, 100% id in 145 aa"
FT                   /db_xref="InterPro:IPR009987"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAZ7"
FT                   /protein_id="CAI79603.1"
FT                   /translation="MGWLVMAVGLTILIITGSYQNQKMSETTNAQQYASASVWASQILM
FT                   IANRINDIRYVSGQQDGVISSDKLALPVTPDSRIKHQLQQGRLWVWMPEQPGLVETLRS
FT                   KSRGSALIGIFQNGQLTWLSGTATGLTPPAGITAGSVVYVN"
FT   misc_feature    complement(91725..92132)
FT                   /note="Pfam match to entry PF07419.1 PilM, , score 300.3,
FT                   E-value 2.9e-87"
FT   CDS             complement(92159..93226)
FT                   /transl_table=11
FT                   /gene="pilL"
FT                   /locus_tag="pCoo120"
FT                   /product="lipoprotein (PilL protein)"
FT                   /note="Similar to Salmonella typhimurium lipoprotein pilL
FT                   SWALL:O07370 (EMBL:AB027308) (355 aa) fasta scores: E():
FT                   4.2e-119, 100% id in 355 aa"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAZ6"
FT                   /protein_id="CAI79604.1"
FT                   /translation="MKKNYLTLILPSLLSGCAGISGSNNVAPSDTPALVFVDGQISESA
FT                   GVLALTQQRLSPPKITPPPRVSVPETVKTAHPVSESRPLPSPTISQNFSRLIITGKPGS
FT                   APVTLSPTARNRTVSQWIKTLLPEGWKFRQENAATPKLNTKLVSWSANDQWTRSLNRLL
FT                   EEQHLWGHLDWDNKTLTVTTSAAAPAQDTATTISPAAMVTTSTSPESPTTANSQNKPRN
FT                   PFRGNSVSSSTPAATPTPTGSTVKSIPLMTGTPVKPVSQGKEWRAPAGTTLRENIIKWA
FT                   EETKCESMASTHWMVIWPLSVTDYRLDAPLMFRGSFESAMEQVFELYRTAQKPLYAQAS
FT                   RMQCIITVSDTRDGR"
FT   misc_feature    complement(93136..93226)
FT                   /note="Signal peptide predicted for pCoo120 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.692 between residues 29 and 30"
FT   misc_feature    complement(93176..93208)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS             complement(93260..93850)
FT                   /transl_table=11
FT                   /gene="pilK"
FT                   /locus_tag="pCoo121"
FT                   /product="PilK protein"
FT                   /note="Similar to Salmonella typhimurium PilK protein pilK
FT                   SWALL:O07369 (EMBL:AB027308) (196 aa) fasta scores: E():
FT                   3.8e-84, 99.49% id in 196 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAZ5"
FT                   /protein_id="CAI79605.1"
FT                   /translation="MKNNNVPLYLWLLWCTFCLYITTPWQYFRYLYTDHISLSYILYFC
FT                   IVVIICFSPLLFRCVLLIVRSVSKYNFTFFAKKNGSKESSIHLSPYADTRCPESMRKHW
FT                   DVLLSLISKAINNDETIVMHSHLFTPARINKLIKRLESYGLNFSVITCPRKTSLYERLS
FT                   IPFVYLLFQWSLPHLHSDGMTVVIRPLQPPHTN"
FT   misc_feature    complement(join(93665..93733,93776..93832))
FT                   /note="2 probable transmembrane helices predicted for
FT                   pCoo121 by TMHMM2.0 at aa 7-25 and 40-62"
FT   CDS             complement(93900..94352)
FT                   /transl_table=11
FT                   /gene="pilJ"
FT                   /locus_tag="pCoo122"
FT                   /product="PilJ protein"
FT                   /note="Similar to Salmonella typhimurium PilJ protein pilJ
FT                   SWALL:O07368 (EMBL:AB027308) (150 aa) fasta scores: E():
FT                   1.3e-54, 99.33% id in 150 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAZ4"
FT                   /protein_id="CAI79606.1"
FT                   /translation="MSFLFKLTIAILIVFAILFPILISSDNKLSALFWKIPKDFWVFLI
FT                   IMYGAIITVVFIESSEQARIRRQQYLQQYKMPNEIHENVVIENSIISRETTDDESDINT
FT                   LYLDSFKSKNNCKSFETNSNLLDKNGKPVEIMVCDVQELHFFVPKN"
FT   misc_feature    complement(join(94182..94235,94278..94346))
FT                   /note="2 probable transmembrane helices predicted for
FT                   pCoo122 by TMHMM2.0 at aa 3-25 and 40-57"
FT   misc_feature    complement(94274..94352)
FT                   /note="Signal peptide predicted for pCoo122 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.985) with cleavage site
FT                   probability 0.718 between residues 25 and 26"
FT   CDS             complement(94395..94649)
FT                   /transl_table=11
FT                   /gene="pilI"
FT                   /locus_tag="pCoo123"
FT                   /product="PilI protein"
FT                   /note="Similar to Salmonella typhimurium PilI protein pilI
FT                   SWALL:O07367 (EMBL:AB027308) (84 aa) fasta scores: E():
FT                   6e-39, 100% id in 84 aa"
FT                   /db_xref="InterPro:IPR018897"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNV6"
FT                   /protein_id="CAI79607.1"
FT                   /translation="MPQQHPGRLQVLVVDTHCKRKLFSTKTQTDPDELARRFCTPDNCL
FT                   VVVLCNNRFLFRLERAPGSHCRWRKGSRSRHQHLQDWLS"
FT   CDS             complement(94917..95483)
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="pCoo125"
FT                   /product="TraD protein"
FT                   /note="Similar to Salmonella typhimurium TraD protein traD
FT                   SWALL:Q52344 (EMBL:AB027308) (188 aa) fasta scores: E():
FT                   6.8e-75, 100% id in 188 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAZ3"
FT                   /protein_id="CAI79608.1"
FT                   /translation="MKLQYRIPLAIYSVWCIIAILLCKDGLYQMNIWTLVEILGMIALP
FT                   LLVRPFFILLRIIFRKNSFKTKDMSDNHTVCVFLSALADTSSKKAIKKHFKQLLEKLPP
FT                   LLRQKKRIYMKSHLLTEARTQKLICSLRRKGLDVTAERRESAMNSVMFRILIVSRILSQ
FT                   WKVPHINPRCGIVILTLKNDSGNRE"
FT   misc_feature    complement(join(95307..95375,95418..95477))
FT                   /note="2 probable transmembrane helices predicted for
FT                   pCoo125 by TMHMM2.0 at aa 23-42 and 57-79"
FT   CDS             complement(95497..96180)
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="pCoo126"
FT                   /product="TraC protein"
FT                   /note="Similar to Salmonella typhimurium TraC protein traC
FT                   SWALL:Q52343 (EMBL:AB027308) (227 aa) fasta scores: E():
FT                   5.4e-98, 100% id in 227 aa"
FT                   /db_xref="InterPro:IPR021316"
FT                   /db_xref="UniProtKB/TrEMBL:Q6JAZ2"
FT                   /protein_id="CAI79609.1"
FT                   /translation="MTTTEHPVRQLLWCALNALKTAQENHNITSETGLRHYLLEWLSGA
FT                   SRHPEFRSLPGEIMALKALTEKDRNIPIIGTLNTLFLSSATVGECPLFRFRAALGKLQK
FT                   AGWRTYVCPWPERVFNESIERACSGKRHLLQLSRTEECFLPTGDMRAPVTLQLITPLHR
FT                   KTMQLLEAAELIFSDEGFQVVRGYEHQFGIERRETLFHTLFIGLPSLPEDVWGATQEQT
FT                   TITLH"
FT   misc_feature    complement(95773..95805)
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT   CDS             complement(96435..96968)
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="pCoo127"
FT                   /product="TraB protein"
FT                   /note="Similar to Salmonella typhimurium TraB protein traB
FT                   SWALL:Q52342 (EMBL:AB027308) (177 aa) fasta scores: E():
FT                   1.3e-74, 99.43% id in 177 aa"
FT                   /db_xref="GOA:Q2VNV3"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNV3"
FT                   /protein_id="CAI79610.1"
FT                   /translation="MNIEHLNNRNWYLAQYNTAGKNRESLFSWLNEQNVVPWTPLITRK
FT                   IRRADSRCCYRERIFAIFPGYFFILANFDIHPVSALRRHSAFIDFVKFGGEIKPVNKDI
FT                   VDGLMKIYPDPVLNPGAREELNAASSIWLTKAQYQYLLRMENTLQPESRISLLLELVSN
FT                   AEHHGFMERLVNIP"
FT   CDS             complement(97410..97646)
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="pCoo128"
FT                   /product="TraA protein"
FT                   /note="Similar to Salmonella typhimurium TraA protein traA
FT                   SWALL:Q8L214 (EMBL:AP005147) (58 aa) fasta scores: E():
FT                   9.4e-14, 100% id in 41 aa"
FT                   /db_xref="GOA:Q2VNV2"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNV2"
FT                   /protein_id="CAI79611.1"
FT                   /translation="MFPELSTNQLKVCVFYAMGVPYDAIAQNCRLSPETVRTYLKRSLK
FT                   NLNLEGYDALRSAVLMRTFVFMISNTAKENEKM"
FT   misc_feature    complement(97524..97589)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1289.000, SD 3.58 at aa 20-41, sequence
FT                   VPYDAIAQNCRLSPETVRTYLK"
FT   CDS             complement(97615..97878)
FT                   /transl_table=11
FT                   /locus_tag="pCoo129"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Bacteriophage P4 ash protein cI
FT                   SWALL:VASH_BPP4 (SWALL:P05462) (137 aa) fasta scores: E():
FT                   3.5e-05, 47.82% id in 69 aa"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VNV1"
FT                   /protein_id="CAI79612.1"
FT                   /translation="MPYHKDRNLYFLSSSMVAQAGQALAWPVSDDAGIPTPVWAITNER
FT                   RNSVIAFLVVIGDLCYVTSTDTETPGHHSVGRHVSRAINKPA"
FT   misc_feature    complement(97800..97878)
FT                   /note="Signal peptide predicted for pCoo129 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.660) with cleavage site
FT                   probability 0.415 between residues 25 and 26"
XX
SQ   Sequence 98396 BP; 25786 A; 22567 C; 23420 G; 26623 T; 0 other;
     gatctaaagc agaaaaatct gcttttaaaa atagatttta ttttttttga cgcaggtcaa        60
     gattaactca ttagaggtat cggtgagggg gcgctggaag agaagagatc gttgtaatgc       120
     ttttcaaatt aacgtaaagc gggtatattt cggctgttat tagctgtgca gagggtggca       180
     ctctgtggag caaagcggcg aaagccggac ggcagaatgc accataaggc attcaggata       240
     gatggcatgt acgggcagta agtcagaaga ctgaagatgt tccggaagcc ataaaaggaa       300
     aacccccact atctttctta cgaacttggc ggaacgacga aagatagtgg gggcctcaca       360
     gaatacgggt aaagtataat gaaaccgtac cagagattca accctgtgca gtgtataaat       420
     acactgcaca atcgctccgc cataagcgac agcttgtggc aggtctgaag aatactccat       480
     ataacgcagt acactggagt cagttagcac acgaagagca gatccgtttc tgggaagact       540
     atgaaacggg aagggcgacc tcttttctgg ttgaaccgga aaggaagctc acaaatcgcc       600
     gtcgtggtga acactccact aaacccaaat gcgaaaatcc gtcctggtat cgtcctgagc       660
     gctataaggc gctgagcggg cagctcgggc acgcctacaa ccgtctggtg aaaaaggacc       720
     cggtgaccgg cgagcagagc ctgcgcatgc acatgtctct gcatcctttt tacgtgcaga       780
     aacgaacgta tgccggtcgc aaatatgctt tccgtccgga aaaacaacgc ctcctcgatg       840
     ccatctggcc ggttctggtc tgcttcagtg atgcgggcac acataccgta ggcatgagtg       900
     tttcccgtct ggccagagaa atcagcccga aagacagcaa ggggaaggtt attccggaac       960
     tggaagtgac ggtctcccgc ctttcccgtt tgctggccga acaggtacgt tttggtgtgc      1020
     tgggtgtttc agaggaaacc ctgtgggacc gtgaaacccg ccagcgtctg ccacgttacg      1080
     tctggataac accggcaggc tggcagatgc tgggcgtcga catggtaaaa cttcacgaac      1140
     agcagcagaa acgactgcgt gaaagtgaaa tccgccagca gctcattcgg gaaggtgttc      1200
     tgcgtgagga tgaagatatc tccgtacatg cggccagaaa acgctggtat ctgcagcgca      1260
     gccaggatgc actgaaacac cgtcgtgcaa aagcagcagc cagtaagcgc gccagacgcc      1320
     tgaagaaact gcctgccgac cagcagattc atgagatggc agagtatctc aggaagcgtc      1380
     tgccgccgga tgaagcctat ttctgttccg atgaccatct gaagcgactg gccatcaggg      1440
     agttgcgtca gcttgaactg acgctggctg ccccgccacc gcactagaca gcaccattcc      1500
     ctcagcactg aatcatcacc agcccctccg gggctttcgg cgctggttcc gctcagccca      1560
     aaatccgcag taatcacctt aaatcccctc agaggggcat atctgcccat aaaaccacgc      1620
     atcagtcatc agaacatggc cacgttgttt cagttatcca cataaatccg caaacaaaga      1680
     actttaagaa gctgcaaacc tgaaacagca aacctgcaat atagtcttaa ccccattatt      1740
     taatcccctg cgttgcttcg ccgcagggaa aatctttatc tctgagacca ctgtgaacaa      1800
     atacaaagag gccttcgctt gcagcggcca aggccgcgcc gctcagaatc taaaagcacc      1860
     tcccacgctg acgcgcgggc cccgaacctc accgttctga aaccacaaca aaaagacatc      1920
     aggaataaaa acaccacaca aacgcagcac cgtgcccacc cctcataact gaaaagcgag      1980
     gccgcccccg cccaaagggc gggaacaaca tcgcttttaa ttatgaatgt tgtaactaca      2040
     ttatcatcgc tgtcagtctt ctggctggat gttctcagta cacgctcgta agcggccctg      2100
     acggcccgct aacgcggaga tacgccccga cttcgggtaa accctcgtcg ggaccactcc      2160
     gaccgcgcac agaaactctc tcatggctga aagcgggtat ggcttagcag ggctggggat      2220
     gggtaaggtg aaatctatca atcagtaccg gctgacgccg ggcttcggcg gttttactcc      2280
     ggtatcacat gtaaccacag cgtgccgcct tccatgccgc tggcgcggca tatcctggtg      2340
     acgatatctg aatcgttata tactgtgtat atacgtagta atgacgaggt gataaatggc      2400
     acaggttaat atgagtttaa gaatcgacgc tgaactgaag gatgctttta tggccgctgc      2460
     aaaaagcatg gaccgtaatg gctctcagtt aatccgggat tttatgcgcc agaccgttga      2520
     acggcagcat aatacctggt tccgtgacca ggttgcggca ggacgtcagc aactcgagca      2580
     cggcgatgtg cttccccatg acatggtcga atcctccgct gctgcatggc gggatgagat      2640
     gagcaggaag attgccggta aatgatggag atattctgga ccatgctggc cagccaggac      2700
     agaaagcgca ttcgtgagta cattgcggag cagaacctga tggtcgccat tgaactggac      2760
     gaacggattg gttatttcgg acgaacgtac cggcttacgc cgggcttcgg cggttttaca      2820
     cctgtactac atgtaacctc atatacacat aaatgagtaa catactgatt aatagggtaa      2880
     atcatgacga ttgaaagctg ttttattggc acccgcctct ctggtaaacg ttacgggcct      2940
     cagagcgggg atatgcaggt ttctgaattc atttctctga tttctcccca aaatgcccct      3000
     cataaggttg tgttacctga ttttactggt ctggcaagtc ggcttgatgc acaaatcagg      3060
     aagcagtttc atcaactgaa agaggatgag cacttccttc gatatcggca gttgtcggaa      3120
     aggtggtatc aggccggctc tattagtgac agaaacaacc gcagtaagcg ttttgagaag      3180
     atcatggatg actcacttga ttttttgctt tacagccaag acgttatgcc taacatcaat      3240
     ccggataatc tccaatacca tgattacgaa aaggttagca gtaagggtaa aatgtactgt      3300
     gtagcgcttc tgttccatgt cattgcacgg gctgcatatg aacccgaatc tgtgggtgca      3360
     gatccgacac ttccagaata ttgccggtgg atgaaaaatt ggataaagaa aacattaggt      3420
     catgattttt tagagagaat aatgatcaat tatgcgctgt ttaacccagc gtattttccc      3480
     gcgttacaac gtctgagcgg agagaaagaa acgcgtgatg cccatacatt cctggctgat      3540
     tcgttagcca gagcctgtaa ctgtttttcg tccataaatt aaccttcatt tgatgctgga      3600
     ttgaacatat caaaatcagg caattacaca aatctatgta caggctcttt ttgcaacact      3660
     gatttttgat taatggtggg cttgcttaaa tctatccggc gtctctgtgg gcaaggaggc      3720
     ccgcgcctcg atgagttccg cacctgataa tcctaaaaag accctcggct tcagcgagcc      3780
     attttttctg acaggttttt aatcaggtct atttgccgtt catgtcatca ataatcagtc      3840
     ttcgcaaaac cagacaggta acttgtatct tattgtttaa aatgagccaa ttgagttttg      3900
     tcagtatcta tatcaggcct gatattcttt ttgcagagca gtgattgccc aggctattcg      3960
     ggccagttta ttcgccagag cgcaggcgac aatatttgaa tgcttgttgt cgagttgctt      4020
     tcgaacccat tcagcgagtc taccctattg atgctccagc cgcatcatga acgagcgggc      4080
     gcactgaaca agtaaccgac gcaaattttt gtttcctcgt ttgctgatcc ccaacagcgt      4140
     tgatttacca ccggtactgt attatcgggg aacaagtcct gtggatgctg caacatccct      4200
     gctgcacgaa aattgtttac catcaccaag ctgggatgag agctggctgg ccgtcatcgg      4260
     cccaacaccg gggattgtca tgatgcgttg cgcagtagcg tcagctttga ttgactggtt      4320
     taactctgat tccagttctg ttatttgctc aataagataa agatagtgag catgtaattt      4380
     catcagcaag cgactcagat attcagctac ttcgtgttca gccaacacca gagacaaccg      4440
     ttttattgcg gcatcccctg tcggcagact gattccaaat tccagcaaga aaccgtggat      4500
     ctggttggtt gttttcacct tatctctgat gagcgattct ctgacccggt gtaatgccct      4560
     catagcctgc tgggtttctg ttcttggctg gataaaacac attgatggtc gtgaagccgc      4620
     ttcgcatatg gcttctgcat caataaaatc attcttatta cttttgacaa acggacgcac      4680
     gaattgcgga gagataagtt ttgcttcatg accgatgtcg ctgatacgcc gggccataaa      4740
     atacgcacca gcgcaggctt ccataacaac tactgaggat ggacatgttg ccagaaactg      4800
     catcaacttc gtacgcgtaa acttcttacg caaaagcgca ttgccagatt tatcctgaca      4860
     atgaatatga aaagaatgtt taccgagatc gataccaata agcgcaacgt tttgcatgat      4920
     ggtgccctct aaaataatcc accctgtcag cgtaccgctc accgggtggg ggtgaccatc      4980
     tcattagacc cgggcatcag tatcagtcac ctgaacaaca gagaaaaaac aaagatcgct      5040
     gatgccctga gacaaacata tcccctgaca gaattactgc atgttctggg ccttgcccgt      5100
     agcagttatt tttatcacca ggctgcactg aaagccggta ataaatacgc cacgatacgt      5160
     acgatgctga cagatatctt taacagtaat taccagtgtt atggctatcg tttcctgcat      5220
     atgatgctca ggcatgaggg gggcggctat ctgaaaaggt tgtacgcaga cttatggtgg      5280
     aggaacagct tgtcgtcagc cgtaaccgtc gtcgccgcta cagctcatat tgcggagaaa      5340
     tcggaccggc tccggataac cttatcgcca gagattttaa ggcggagcaa cctaatcaga      5400
     aatggctgcc agatatcacg gagttccagt tccctgcagg taaagtctgg ctatcaccgg      5460
     tggtggactg cttcgatgga aaagttgtga gctggtctct cagtacacgc cccgatgctg      5520
     aactggtcaa cactatgctg gatagcgctg tcgaaacgtt aaatgctggc gaacaaccgg      5580
     tgatacacag tgacagaggt gggcattatc gctggccagg ctggctggaa agagtgaatg      5640
     cagcaggtct tattcgctca atgtcccgta aaggatgttc acctgataat gccgcatgcg      5700
     aaggcttttt cggcagactg aaacggaaat gtattatggg cgtaaatggt cgggcatcac      5760
     gccagaaaag ttcatgcagc aagtggatgc ttacatcaga tggtataacg agcggcgtat      5820
     aaaattatcg ctgggtgccg tcagcaccaa aatgtaccgc caataatgtg gactggcata      5880
     ataaagccgt ccaggaaatt atccagatcc ccccccacag tgagtcataa tcatcctgac      5940
     tttccagaac catatggatc gcccgctgac ggacttcggg ggagaagtgc gtatttttat      6000
     tcatcttgtt tacctctttc tctgggagtt tagtcaccaa gaactcgggg cagttcaaaa      6060
     tggttgtcgg aatataactg tgaatgccaa catgaatcac tgaacaacat gatgtcgcag      6120
     gaataaatcg atatttaaat gtcaccaagg gcaagcgcca ttggctgctt taatatttgt      6180
     tgtaatggtt gctgtgtgtt atttatttat ttgattgttg attgctgttt gtttaaagtg      6240
     gccaagtgtt aggagggggt atgcgaaaat tatttttaag tttgcttatg attccctttg      6300
     ttgcgaaggc gaactttatg atctatccaa tatcaaaaga aatcaaagga ggcagtagtg      6360
     aactggggat ccggtgattg attgagcaag ctttatgctt gtaaaccgtt ttgtgaaaaa      6420
     atttttaaaa taaaaaaggg gacctctagg gtccccaatt aattagtaat ataatctatt      6480
     aaaggtcatt caaaaggtca tccaccggat caattcccct gctcgcgcag gctgggtgcc      6540
     aagctctcgg gtaacatcaa ggcccgatcc ttggagccct tgccctcccg cacgatgatc      6600
     gtgccgtgat cgaaatccag atccttgacc cgcagttgca aaccctcact gatccggacg      6660
     atacaaattc ctcgtaggcg ctcgggaccc ctatctagcg aacttttaga aaagatataa      6720
     aacatcagag tatggacagt tgcggatgta cttcagaaaa gattagatgt ctaaaaagct      6780
     tgtagttaaa gctttttaga catctaaatc taggtactaa aacaattcat ccagtaaaat      6840
     ataatatttt attttctccc aatcaggctt gatccccagt aagtcaaaaa atagctcgac      6900
     atactgttct tccccgatat cctccctgat cgaccggacg cagaaggcaa tgtcatacca      6960
     cttgtccgcc ctgccgcttc tcccaagatc aataaagcca cttactttgc catctttcac      7020
     aaagatgttg ctgtctccca ggtcgccgtg ggaaaagaca agttcctctt cgggcttttc      7080
     cgtctttaaa aaatcataca gctcgcgcgg atctttaaat ggagtgtctt cttcccagtt      7140
     ttcgcaatcc acatcggcca gatcgttatt cagtaagtaa tccaattcgg ctaagcggct      7200
     gtctaagcta ttcgtatagg gacaatccga tatgtcgatg gagtgaaaga gcctgatgca      7260
     ctccgcatac agctcgataa tcttttcagg gctttgttca tcttcatact cttccgagca      7320
     aaggacgcca tcggcctcac tcatgagcag attgctccag ccatcatgcc gttcaaagtg      7380
     caggaccttt ggaacaggca gctttccttc cagccatagc atcatgtcct tttcccgttc      7440
     cacatcatag gtggtccctt tataccggct gtccgtcatt tttaaatata ggttttcatt      7500
     ttctcccacc agcttatata ccttagcagg agacattcct tccgtatctt ttacgcagcg      7560
     gtatttttcg atcagttttt tcaattccgg tgatattctc attttagcca tttattattt      7620
     ccttcctctt ttctacagta tttaaagata ccccaagaag ctaattataa caagacgaac      7680
     tccaattcac tgttccttgc attctaaaac cttaaatacc agaaaacagc tttttcaaag      7740
     ttgttttcaa agttggcgta taacatagta tcgacggagc cgattttgaa accacaatta      7800
     tgatagaatt tacaagctat aaggttattg tcctgggttt caagcattag tccatgcaag      7860
     tttttatgct ttgcccattc tatagatata ttgataagcg cgctgcctat gccttgcccc      7920
     ctgaaatcct tacatacggc gatatcttct atataaaaga tatattatct tatcagtatt      7980
     gtcaatatat tcaaggcaat ctgcctcctc atcctcttca tcctcttcgt cttggtagct      8040
     ttttaaatat ggcgcttcat agagtaattc tgtaaaggtc caattctcgt tttcatacct      8100
     cggtataatc ttacctatca cctcaaatgg ttcgctgggt ttatcgtccg cgcagatcag      8160
     ttggaagaat ttgtccacta cgtgaaaggc gagatcacca aggtagtcgg caaataatgt      8220
     ctaacaattc gttcaagccg acgccgcttc gcggcgcggc ttaactcaag cgttagatgc      8280
     actaagcaca taattgctca cagccaaact atcaggtcaa gtctgctttt attattttta      8340
     agcgtgcata ataagcccta cacaaattgg gagatatatc atgaaaggct ggctttttct      8400
     tgttatcgca atagttggcg aagtaatcgc aacatccgca ttaaaatcta gcgagggctt      8460
     tactaagctg atccggtgga tgaccttttg aatgaccttt aatagattat attactaatt      8520
     aattggggac cctagaggtc ccctttttta ttttaaaaat tttttcacaa aacggtttac      8580
     aagcataaag cttgctcaat caatcaccgg atcccctatt cgtatatatt ctaaatcaaa      8640
     agatacacaa tatataaaag tgtatactaa aaaagtttta aatccgggga caaaggaaga      8700
     atacgaggta gacaccccaa attgggaggg agggttggtt actacgccgt ccaaagtaat      8760
     cttaccgggt gggggcagta agtccgttcg gttaagtcag ttaaaggaca tcagtagcga      8820
     agatgtctac agagtgtatt ttgaatcaat taaaccagaa aaacaggatg gtttatcgaa      8880
     aaataaatcg ctgaaaacag acctatctgt caacattata tatgcggcat taataagagt      8940
     gctccccaag gatgggaaaa gtgatatgag agcatcatta tcacccaaga gcagtcttct      9000
     tataaagaac acaggaaatg tgcgggtcgg aataaaagat gctttttttt gtaaaaaaac      9060
     aagcattaac aatgatgact gcataaagaa aacatacaac aagaatatct atcccggttc      9120
     atcatttgat acaggggtta tacaaaatgg attctcgcat atttttatcg atagtgttga      9180
     tggaagcgcg ggcaagcaag gaaagcgaat gctaataagc attcattgag tattacttgg      9240
     gtatcttaat tttccataat aaaacataat ggagtttata tgaaactaaa gaaaacaatt      9300
     ggcgcaatgg ctctggcgac attatttgca actatgggag catctgcggt cgagaagacc      9360
     attagcgtta cggcgagtgt tgacccgact gttgaccttc tgcaatctga tggctctgcg      9420
     ctgccgaact ctgtcgcatt aacctattct ccggctgtaa ataattttga agctcacacc      9480
     atcaacaccg ttgttcatac aaatgactca gataaaggtg ttgttgtgaa gctgtcagca      9540
     gatccagtcc tgtccaatgt tctgaatcca accctgcaaa ttcctgtttc tgtgaatttc      9600
     gcaggaaaac cactgagcac aacaggcatt accatcgact ccaatgatct gaactttgct      9660
     tcgagtggtg ttaataaagt ttcttctacg cagaaacttt caatccatgc agatgctact      9720
     cgggtaactg gcggcgcact aacagctggt caatatcagg gactcgtatc aattatcctg      9780
     actaagtcaa cgtaattatt cagaattaca acggaagtct tttaagccag agcagcggtg      9840
     tgatgctgct ctgtttctgt ttgtctagag gaatatatga ttggtggaaa gtcgagcaag      9900
     gtggtcattg tgttatccgt tcttattgga tcttcttccg gatttgccag caaatacaac      9960
     cttgttgata ttccggagtc ttttcgtgat ttatggggag agcaggacga attactcgaa     10020
     gtcagacttt atgggcaatc tcttggcgtt catcgtatta agtccactcc tactactgtg     10080
     gcatttgagt ctccggataa tttattagat aaaattgaga ttaataaagg aaaggaagct     10140
     gacttaagag tacttatgcg aggttcattc caacggaatg gaaatatgag ttgccaggga     10200
     tatacgggac agaacaactg caattacatt aaaacaaaca cagttgcggt tatcgtagat     10260
     gatgttgaaa atgtacttaa tctttttata ggaaatgagt ttcttgcttc cggagagaat     10320
     gacagtgatt attatcagcc atccaagaac acaaaaaaag cattcataca tagccagaca     10380
     attaatttat ctgataccgg taattatgaa aacttgtcca ttgtcgggac gggttcgctt     10440
     gggataacag ataacagtta tgctattttg ggttgggcag caaattataa tcggtataaa     10500
     tcttacaatt acaatgaaca gtcgattaac agcctgtatt tcagacatga ttttgaaaaa     10560
     aatttttact atcagttggg acggatagac agatccgact tatcgcaaag tagtggcgga     10620
     aactttaact tcgatctact tcctgtacct gatatttatg gtatgagagc cggaacgact     10680
     cagtcatata tcaagaatac gggaaagtca gttgcatctc cggtcacaat tatgctgacc     10740
     cacttttccc gtgtagaagc atatcgaaat gggcaattac tgggagtttg gtatttagat     10800
     gcaggtatca gtgagttaga tacggagcgt ttacctgacg gaaattacga tctgaaatta     10860
     aaaatatttg agcaggagca acttgtccgt gaagaaattg taccttttaa caaatcaggt     10920
     tcttcaattg gtgacacgca ttgggatgtt ttcgtgcagg caggcgatat tataaatgat     10980
     aatggccgat atgttgaaaa acagaaaaac cataaatcag ccattaatag tggattacgt     11040
     ttaccgttaa caaggaatct tgcagtacag ctgggggggg ctgttattga taataaaaat     11100
     tattacgaga ctgggattct gtggaactca ggactccttg atggttctct caatagcaaa     11160
     ttcactttcc tttttggtga cgacacacat ggaaactatc agaatgtttc ctatactgat     11220
     ggtttcagct tatcgttcta tcataatgat aagcgagttg atgattgtgg taaagattac     11280
     aatatgggct ggagtggatg ttatgagtct tattcagcgt ctttaagtat ccctgtgaaa     11340
     gggtggaata gcactcttgc atacagtaat acgtacagta cgtctgtata cagatatgat     11400
     gctgtttctg aatatgttcc ttattactat tataaaggaa gaactaaaag atggcaactt     11460
     actgcttcta cggtggtaag atggggggac tataacatta tgccaacaat aggagtatat     11520
     aatagtgaac agaaacaatg ggctgataaa ggaggctatt tatccttaac gcttactcga     11580
     gttgatggtg gcaagtcctt gaatgctggt tattcctata actactcccg gggtaattat     11640
     acttctaatg atgcatttgt tgaggggcat ctggtttcag atacaaatgt cagttatcgt     11700
     gaactaagtg cacgcgtcag tggtaataga tattacactg agggaggagt ttcagggcgc     11760
     attaacaata gatttggtga tctgaatggg acacttaatg ttaataaaaa cagaaaatca     11820
     catgatacaa ctcactctct gacagctggt tacagttcgt catttgctct tacgaccgat     11880
     ggcatctact ggggaggaag cgcatccggg ctgacgaatt tatccggagg aattgtaaga     11940
     gtaaaatcaa atgaggatga gagtgaacta ttgaatgtga aaggctcatc atatggtcat     12000
     tattccctgg gcagcaatga tagtttattt atacctgtac ctgccctgat gcaagccagc     12060
     cttactattg aagagaatac aaataaatct aaaaatattg atgtgctcgc accaacaaaa     12120
     aacacttttt ttatgttacc tggaagtgtt tatcctattg atgtttcagc caatgttagt     12180
     tttacttacg ttggacgtgg agttgatgtt aagggacgac ctttatctgg tgcatatatt     12240
     ttgaatgcgc aaaatattgt gttggatgaa aatggtggat tttcttttga gagttcagag     12300
     aatgagaagg aactcttttt attaaaagat aaaacaattt attcctgttc attagacaga     12360
     agcgaaatgc gcaatggtat tgctttcgtt ggtgaggttg catgcaattc taccatcaaa     12420
     gaacttcttc ctgaaaaatt ggttacaaat tctcgcattc atgatttatt agcttacaat     12480
     caggatactg aatgaaaaag atatttattt ttttgtctat catattttct gcggtggtca     12540
     gtgccgggcg atacccggaa actacagtag gtaatctgac gaagagtttt caagcccctc     12600
     gtctggatag aagcgtacaa tcaccaatat ataacatctt tacgaatcat gtggctggat     12660
     atagtttgag tcatagctta tatgacagga ttgttttttt atgtacatcc tcgtcgaatc     12720
     cggttaatgg tgcttgccca accattggaa catctggagt tcaatacggt actacaacca     12780
     taaccttgca gtttacagaa aaaagaagtc tgataaaaag aaatattaat cttgcaggta     12840
     ataagaaacc aatatgggag aatcagagtt gcgactttag caatctaatg gtgttgaatt     12900
     cgaagtcttg gagctgtggg gctcacggaa atgctaacgg aacacttcta aatctgtata     12960
     tccctgcagg agaaatcaac aaattgcctt ttggagggat atgggaggca actctgatct     13020
     tacgcttatc aagatatggc gaagtcagta gcacccatta cggcaattat accgtaaata     13080
     ttacggttga tttaactgat aaaggtaata ttcaggtatg gcttccaggg tttcacagca     13140
     acccgcgtgt agacctgaat ctgcgcccta tcggtaatta taaatatagt ggtagtaatt     13200
     cactcgacat gtgtttctat gatggatata gtacaaacag tgatagcatg gtaataaagt     13260
     tccaggatga taatcctacc aattcatctg aatataatct ttataagata gggggcactg     13320
     aaaaattacc atatgctgtt tcactgctta tgggagaaaa aatattttat ccagtgaatg     13380
     gtcaatcatt tactatcaat gacagtagtg tactcgaaac aaactggaat cgagtaaccg     13440
     cagttgctat gccggaagtt aatgttccag tattatgctg gccagcaaga ttgctattaa     13500
     atgctgatgt aaatgctccc gatgcaggac agtattcagg acagatatat ataacattta     13560
     cacccagtgt cgaaaattta tgacaaatat gcatatttgg caaagaaaaa tctgacactg     13620
     ggcattgtat gtggcgatgg gaggtaactc tgataaatcg ggataggaac tgttctcacg     13680
     attccgactc atcccactgt accgtacata cggggtcgta tacggcggtt tggttatgtt     13740
     gattgtcgcc tgcctatatt tcaggcagga tcagtctggt gaacagatta tagagtacag     13800
     gtgtcttgta tgataacgcg atggcggaga gcatcaatag tcttgacaaa gcgagggctt     13860
     taagtgcttt gtcgaaatcg aagggctggg acatgtgtca ttcctttttg attgtatatt     13920
     actggaatga cacagaattt ctaacactct cgagctgaca ccctaagttc acagataaaa     13980
     tattctctag gatactcggg gcggttcatt tcccgttatg ttcagcactt cattcagcat     14040
     tctgaacaga taaatatcga atatttccgt acagtatggt cttattggta aatatacgtc     14100
     gtctgttggg ataaagttca ttaacctagc ttctaaggaa tgaggtggtg agcgactcgg     14160
     gaaaaggcag agatctactg tcacgtggag ttcgggaagc tgaacgaaag taaactgtcc     14220
     gatgaagcat cgaaatctta gatgatgtca aaatggggct ggatttgccc ctatatttcc     14280
     agacatctgt tatcacttaa cccattacaa gcccgctgcc gcagatattc ccgtggcgag     14340
     cgataaccca gcgcactatg cggatgccat tcgttataat gctcgaacgc ctctgcaagg     14400
     ttctttgctg ccgttaaccc gtctggtttg ggcatgatac tgatgtagtc acgctttatc     14460
     gttttcacga agctctctgc tattccatta ctctccggac tccgcaccgc cgtgttcttc     14520
     ggttcaagtc ccaacatccg ggcgaactgg cgtgtttcat tagcccggta gcatgaacca     14580
     ttatccgtca gccactccac tggagacgac ggaagatcgt tgccgaagcg gcgttccacc     14640
     gctcccagca tgacgtcctg tactgtttca ctgttgaagc cgccggtagt gaccgcccag     14700
     tgcagtgcct cacgatcaca gcagtccagc gcgaacgtga cacgcagtct ctctccgtta     14760
     tcacagcaga actcgaaccc gtcagagcac catcgctgat tgctttcttt cacggccact     14820
     ctgcctgtat gtgcccgttt cgatggcggt acagcaggtt ttcgctcaag caacagcgca     14880
     ttctggcgca tgatccggta aacacgtttg gcattgatcg caggcatacc atcaagttct     14940
     gcctgtctgc gaagcagcgc ccatacccga cgataaccat acgtgggcag ctctccgata     15000
     acatggtgta tacggagaag cacatccgta tcatcagtgt gacgactgcg gcggccatcc     15060
     atccagtcat cggttcgtct gagaatgacg tgcaactgcg cacgcgacac ccggagacaa     15120
     cggctgacta agcttactcc ccatccccgg gcaataaggg cgcgtgcgct atccactttt     15180
     ttgcccgtcc atattcaacg gcttctttga ggagttcatt ttccatcgtt ttcttgccga     15240
     gcaggcgctg gagttcttta atctgcttca tggcggcagc aagttcagag gcaggaacaa     15300
     cctgttctcc ggcggcgaca gcagtaagac ttccttcctg gtattgctta tgtcaacgac     15360
     ggatgaaaag tgatccactt atatctccac caacggccca atattgatcc accgttttac     15420
     tcaggattag cttctgctat aaccccggcc tttcgtttct gtctgagtcg atagctttct     15480
     cctttgattt gaacgacatg tgagtggtgt aagatacggt ccagcatcgc tgaggtcagg     15540
     gctgcatcac cggcgaacgt ttgatcccac tgcccgaacg gcagattgga tgtcaggatc     15600
     attgcgctct tttcgtaacg tttagcgatg acctggaaga acagttttgc ttcttcctga     15660
     ctgaacggca gatagcctat ttcatcaatg atgagcaggc ggggggccat tactccacgc     15720
     tgaagcgtcg ttttataacg cccctgacgt tgcgccgtgg ataactgaag taacagatct     15780
     gctgctgttg tgaagcgaac tttgatacct gcacggactg cttcatagcc catcgctatt     15840
     gccagatggg ttttccccac acctgatggc cccagtaata cgatattttc attacgttct     15900
     atgaagctga gtgagcgtaa cgactggagt tgcttctgcg gtgctccggt ggcgaatgtg     15960
     aagtcatact cttcgaacgt tttcaccgcc gggaaggctg ccattcgggt atacatcgcc     16020
     tgtttacgtt gatgacgtgc cagtttttct tcatgaagca gatgctccag gaagtccata     16080
     taactccatt cctggtctac tgcctgttgt gacagcgcag gcgctgcgct tataaggctt     16140
     tccagttgca actgcccggc gagcgccatc agtcgttgat gttgcagttc catcatcacg     16200
     ccactcctct gcagaatgag tcgtagatgg agagtggatg atgcaggggg gatttgtcga     16260
     agttcacctg attttcacca ggatgcacgt catactcttt tttctccgga ggcagtgcca     16320
     gcatggactg ctgctcttcg agccagcgat cgcagggacg ggcctggatt gtttcatgct     16380
     ttcgttggtt agcgacatca tgcagccagc gcagaccgtg gcggttggct gtttcaacat     16440
     cgacagtgat ccccatcggg cgcaggcgag tcattagtgg gatgtaaaaa ctgttacggg     16500
     tgtactgcac catccgttcc accttacctt tagtctgtgc cctgaagggg cgacacagtc     16560
     ggggagagaa gcccatctcc ttgccgaact gccacagcga aggatggaac cggtgctgac     16620
     cggtctgata tgcgtcacgt tgcagaacca cagttttcat attgtcatac aacacttcgc     16680
     gcggcacacc accaaagaag cggaacgcat tacgatggca ggtctccagc gtgtcataac     16740
     gcatattgtc agtgaattcg atgtacagca ttcggctgta tccgagaaca gcaacgaaca     16800
     cgtgaagcgg tgagcgacca ttacgcatag tgccccagtc aacctgcatc tgtcgtccgg     16860
     gttcagtttc gaaccgaacg gcaggctcct gctcctgagg aaccgagaga gaacgaataa     16920
     atgccctgag aatggtcatt ccgccacgat atccctggtc tctgatctcg cgggcgatta     16980
     ccgttgccgg gattttgtaa ggatgagcat cggcgatgcg ttgacgaata taatcccggt     17040
     attcatccag gagtgaagca acagcaggtc gcggcgtata ttttggcggc tcagattttg     17100
     cctgcaaata acgtttaacg gtattgcggg agatccccag ttctctggca atcgcccggc     17160
     tactcattcc ctgcttgtgc aggattttaa tttccataac tgtctcaaaa gtgaccataa     17220
     gctctcctga atcaggagag cagattaccc cctggatctg atttcaggcg ttgggtgtgg     17280
     atcactattg caccgttcgt gacatttctg cgcagaccgg tgtcagcaaa accgccattt     17340
     tttctctggt gaggcgattt caccaggtat tcactgactg gcctctttcc ggtgaatatt     17400
     cctgcgggca actggcccgg gctcttttcc cggggcgata cccttcagcc ccgaccgtga     17460
     ctcagcctgt gaaagcagag aaaccccgcc ggaaccgatt ttcaccggag tttaaatgga     17520
     gactggttca gcaaactctt ttacccggtg cctgtgtcgc acaaatagct cgagagaatg     17580
     gaattaacga taacctgctc tttaactggc ggcatctctg gcgtaacggt ggcctgcaac     17640
     cgcccggcga acatgaaaca tcgctacttc ccgtgacgtt aactccggag ccggataata     17700
     aaatcccggc accagtgcag atacctgaac agataaatac actgccagac agtctgtgct     17760
     gcgagctggt tctgccggcc ggaactctca ggctgaaagg tgaactgaca ccggcgttat     17820
     tacagacact tatccgcgaa atgaaaggga gcagccactg atgatatctc tccctgccgg     17880
     ttcgcgtatc tggctggttg ccggtatcac cgatatgcga aatggcttta acggcctggc     17940
     ctcaaaagtt cagaacgtcc tgaaggatga cccgttctcc gggcatctgt tcatcttccg     18000
     cggacgccgg ggtgaccaga taaaagtgct gtgggctgac agtgacggac tgtgcctctt     18060
     caccaaacgc ctggagcggg gccgcttcgt ctggccggtc acccgcgatg gaaaggttca     18120
     ccttactccg gctcagttat ccatgcttct tgaaggtatc aactggaagc acccgaaacg     18180
     aacggaacgc gctggcatcc gcatataacc cgttgtaaag tgaggatatg gacacctcac     18240
     ttgctcatga gaatgcccgc ctgcgggcac tgttgcagac gcaacaggac accatccgcc     18300
     agatggccga atacaaccgc ctgctctcac agcgggtggc ggcttatgct tccgaaatca     18360
     accggctgaa ggcgctggtt gcgaaactgc agcgtatgca gttcggtaaa agctcagaaa     18420
     aacttcgcgc aaaaaccgaa cggcagatac aggaagcaca ggagcgaatc agcgcacttc     18480
     aggaagaaat ggcagaaacg ctgggtgagc aatatgaccc ggtactgcca tcccccctgc     18540
     gccagtcttc agcccgtaaa ccgttaccgg cttcacttcc ccgtgaaacc cgggtcatcc     18600
     ggccggaaga ggaatgctgt ccggcctgtg gtggtgaact cagtccactg ggatgtgatg     18660
     tgtcagagca actggagctt atcagcagtg cctttaaggt tatcgaaaca caacgtccga     18720
     aacaggcctg ttgccggtgc gaccatatcg tgcaggcacc ggtgccttca aaacccattg     18780
     cacgcagtta tgccggagcg gggcttctgg cccatgttgt caccgggaaa tatgcagacc     18840
     atctgccgtt ataccgccag tcagaaatat accgtcgcca gggcgtggag ctgagccgcg     18900
     ccacgctggg gcgctggaca ggtgccgttg ctgaactgct ggagccgctg tatgacgtcc     18960
     tgcgccagta tgtgctgatg cccggtaaag tccatgccga tgatatcccc gtcccggtcc     19020
     aggagccggg cagtggtaaa acaaggactg cccggctgtg ggtctacgtc cgtgatgacc     19080
     gtaacgccgg ttcacagatg cctccggcgg tctggttcgc gtacagcccg gaccggaaag     19140
     gcgtccatcc acagaatcat ctggccggtt acagcggtgt gcttcaggcc gatgcttacg     19200
     gtggttaccg ggtgttatac gaatccggca gaataacgga agccgcgtgt atggctcatg     19260
     cccggagaaa aatccacgat gtgcatgcaa gagtgcccac cgacatcacc acggaagccc     19320
     tgcagcgtat cggtgaactg tatgccatag aggcagaagt ccggggatgt acagcagaac     19380
     agcgtctggc ggcaagaaaa gccagagctg cgccactgat gcagtcactg tatgactgga     19440
     tacagactca gatgaaaaca ctgtcgcgtc actcggatac ggcaaaagcg ttcgcatacc     19500
     tgctgaaaca gtgggatggc ctgaacgtgt actgcagtaa tggctgggtg gaaatcgaca     19560
     acaacatcgc agagaacgcc ttacggggag tggccgtagg ccggaaaaac tggctcttcg     19620
     cgggttccga cagcggtggc gaacatgcgg cggtgttgta ctcgctgatc ggcacatgcc     19680
     gtctgaacaa tgtggaacca gaaaaatggc tgcgttacgt cattgagcat atccaggact     19740
     ggccggcaaa ccgggtacgc gatctgttgc cctggaaagt tgatctgacc tctcggtaaa     19800
     tatcaatacg gttctggcga gtcgcttacg attattctct ttttcctcct gttctgactc     19860
     tgattactgc tgccctgatt attgtctgtt ttgttgttct cctgcttatg ccttttccgg     19920
     gcgtccccct ggcggggcgg gctatcgtga acggagccag cgaagctgtc tccgccctga     19980
     cgggcttcca tccctgacgc gaaaccccgg gcttgcagcg accgttccgg tcgcgccgcc     20040
     tctgtcgcgc cgtggcctgc gctccctgca tcccggcaaa aggccgccgg gatgtaaggc     20100
     gcaacgccgt ttcgcaaacc gcgcttcacg tcgttgcggc gggtccctgc ccgttgttgt     20160
     gtccggtgcc attcacctgt ttaagcccct gtcgccgggg gctgatacag ccacaacctg     20220
     ccgcactgac tgtccagggt aaatgaacag cccacaaaat tttttaccta aaacccggta     20280
     aaaaattttg cgttctgccc aggacaggtg cgtcaggccg tggcagtgat gccccttgcg     20340
     gcgaaggttc tcaaaaaggt gatggtgaat accggaggga acaaaaggca ggtccccgca     20400
     aaacgtcaaa accgcggctc ccgaaactca aaagatgatg ggggctgaaa accagagaga     20460
     ggagaaagct ggatgagtac ccgaaatatc cacgttaaca ccgcgtcgta cacgattctt     20520
     gttgccggga gggaaaaaac accggggaag agtgggacgt cctggaattc agcagcctga     20580
     ctgagctgaa aaaatatcgc aaaagccacc cggaaaagat ggccttcagc tatagctacg     20640
     cgctcagccg gggtgtggat acgcagttcc gccatatcaa cattgcggaa gccgatcact     20700
     tcaaacagtt cctgcgtcag attgagcgtg tcaattcgaa agtttttttt gacgttcagt     20760
     atagtgctga aatatttaat gtggagagaa tggatgggat atatcacata tgttacagat     20820
     caacgacccg gtgaatcaga tatcctgagc gggaatgctt ttgctgatct ggagattcgt     20880
     gattctgatg ggcatattct gctgaaaatg cctgctcctg aaagcggctg gacacatgaa     20940
     agcctcagtc ttgttcagcc acagaaggtg cgggatgggg aagaagcatt tgatgcttat     21000
     ctgaatggta tgtggatcgg atcgacagaa gtctgaacgg accatgccag caggagacgc     21060
     tactggcatt ttctggcatc cgcgcggtat gcatgatgca gctatgcttc ttcttgcaag     21120
     tgacccggta atttgcagca cctgaatgct ggaacttcta ctagttataa aggtgcgtat     21180
     aattacgcac tttacataaa acagtatatc ctatggcaag gctccccaag aaaatagatc     21240
     aggaaattaa tccactggat ttgcgccagt ttgtaagttc tgcggcacaa aaacggcatc     21300
     ggcatccgca gcaaagcgga taaatctgac aatgactgat gatgatctgg atacagagca     21360
     ggaggaattt tactctatgg aacaatgcat ctttgatttc ggcattataa actataatcc     21420
     cgccattaca tggactgtgc cagctgtatt tttcttttta gcgttgctgg caggtatagt     21480
     tttcaatatc ggcaggaaaa ataatctaat cgtttttgtt tgggcaatat cgcttcctgt     21540
     aataacagtt ttcattttta tatttctggg tggtaagata aatatatgct gaaccgctta     21600
     ggtcgtccga tttggattcg tcctcgtgga atacagtata tgaagactct catattcgga     21660
     taaaggcatt tgtacagcag acagcgttat agccagtgat atatcaatat tactggtatt     21720
     attttcattt atttctaggc agggattgta tcttaagtta acgttacccg ctgatgtcga     21780
     tattctcgcg gagagagata acaaaacgca ctatgcggat ggttttcatt gtaatattcg     21840
     atcgccaatg caaggttatg caatgccgtt cttaaatttt gtttcggcat gaatgcgatg     21900
     tagtcttcct tcaccaatat tcgaccttta tgtttccgct gcggcattgc tgtgttgtct     21960
     gttatgcctc aaattcatca actggccttc catgctgctg tcgcggcata acatatttca     22020
     ttgcccttgc atgtttttta tatttcgata aatgttctgt attttttctg cataagtttt     22080
     cctgcgccga tcctgttcct ctgtgttgcg aaaaccagca ttgtaagcgc cgaccgctct     22140
     ccatgttact ccccattttt tgaacgctat tgctaggtaa tacgcaccgg tataaatatt     22200
     catgcaagga tctgttacca ggtgttccgg ttctattcca taacgggaca gttccttaaa     22260
     atgctgggag tcgatttgca tcaggccgga gccatatccc gtaacagggt taatgccatg     22320
     aaatcgctct cagtaaatcg ggatcgattt tgtaatctct accagccagt tcaaaacagt     22380
     cctgagcaat aacatgagat gaaagagtga gtaatccaat aagaagaagt ttggtcatgt     22440
     tttatattcc atattcatta ttgtgcatta gtcagaatgc catttttaat aaaaaacggc     22500
     aacgtccatt aatactgaat cctgcccggt gcgaatattt tcatatacct gctccttaac     22560
     atcaaaagcc cacacccgtc gcaagattta atcttgcatg attagtcatg taaaacagta     22620
     tgttatgatt gttgtaaagg tgtctttttg attgtgatgt ctcagtgtgg agtataacca     22680
     cactctattt atactctaat cagagtatag agatactctg attagagtat ctcagcaaat     22740
     tcagtatgtt atatagagta tagtctagag tgtactctgt ttttgatatg ctctacactc     22800
     gcctctatac tctgtttttt gaaatgatat actcgcctta tactatggat agtagtattc     22860
     aggttatatt ttaaattgat cataataatt gattcatgaa ggagcaacga tgccacgtat     22920
     acaaactttt gtcagcaatc aggttcgtga agaaattgag aatctggtaa ctgaaaggag     22980
     gcaggagggg gctacggaaa atgatgctac ggtatcatct gttacttcaa tgcttataga     23040
     gcttggcctc agagtataca gaattcagag agaaaaaaag gaaagtggat ttaatcagat     23100
     ggagtacaac aaactcatgc tggataatat atcaagagtg agatttatgt gtagtgaaat     23160
     tatgaacatg agcatgctca atcaggagtc tgttgccagc ggttatttca cgattgaaaa     23220
     gattaagccc gctatggaaa aattcgttaa tgagcaggtg ggtatttttt ttcatgacga     23280
     tgaggagaca gactgactcc agttacttat atatcatggc accttgtgag ttttgttgca     23340
     caaggtgctt tcatgttttt ttcttaaatg ccgtgcaatt acaattctgc ttttctcttc     23400
     cctctgtata ataagcggcg acctcttaat gtttgattct aacacaagcc attcttttta     23460
     attatccctg agaatcatga tgcatatctg tcggttgctt tttgtatcat cattcatggt     23520
     gtgaccattt ttatttaatt attcaggttg aaaatgtcat tttttttgtg atggctgtca     23580
     aaaaattagt gtttatatca taatttattg aggggcgttc tgaggttgga tatatttgtt     23640
     ttaaggtgaa tcaataattc cagggaggcg agtgtagatt attaaattga tttactttag     23700
     tcgcgatgac aagggatgcc ccccttgtca tcgctagcca ccaataacgc aatcattttt     23760
     aacaggaggt cacgatggct atcatcgatc ctatccgtat ggaaatttta cgcaaggttt     23820
     ttcctgaaat taatgatatc aagatcgagg ttttcacact ttttgctttt ggtatgacta     23880
     tcagggagat ttctgtttac aggaatacaa ctcatcaggc ggtgtataaa acgctaaaag     23940
     agttatgtga tcaatacaat tccccctcaa atgaggcact taaaactttg tacattacaa     24000
     ggctggcctt acattccttt cttgaactaa gaattgaact cacccctgaa cagtaagtga     24060
     gctgattagt ggtaaaacgt gatgtgatct gcgtcacgtt ttattgttga tttagatcaa     24120
     tttgcggttg catgaatttt cctatacata tctaaagtta tttattttca ttgggttatg     24180
     agtagtgaaa atagatttat ctgcaactgg acaaccactt tttttttagt tcaacatata     24240
     tatagatttt ggatgtgtgg agcgttatta aatgactaaa aacatacccc tcaaacctcg     24300
     ccctgctggt aagtttattc gggtatatgt ggatgggatc gtttatgaag agttgagaaa     24360
     aatagccaag aaggattcca gaaatatacc caagactgct gcgcttaaaa ttgaagaggc     24420
     tttgggaatg aaggagtaat tctgtcacag aatcattcgc gatggttctg tgccggattg     24480
     acttaacctg tcaataccgc tctggttttt ttgtaaataa caaaatggag tttttatgaa     24540
     tttatcctta tctgaaggcg gtcgccccgc gtctgtaaaa aaccgtgcat ggcattattg     24600
     ccagatggca tggcgtggag tgtgcacccc aaaagcactg tcccgtctgg ctgcgttctc     24660
     tccgctgctg ttactgggga tggggcagat ggctcatgcc actgacctgc tggccggggg     24720
     caagaacgat gtaaaagcga cctttggtgc cgactcattc gtcatcatgt gtatttatat     24780
     cgctgaaatc gttatcggtg ttgcgacgta tatccgaacc aagaacctgc tgattctgct     24840
     gggactcgtc gtggttattg tcttcaccac cgttggcctg acattcgtca actgatatgt     24900
     cgggaaacga tttagaaaaa ttccgtttcc cgaaaactct gtcagagcag aaccgcatta     24960
     tcggactgcc gcttgatgaa gccatccccg cagctgtgtt agtgctgtgg ggatttttcg     25020
     ccaagaaata tgtatttggt ctgattattg cgacagtggt ctggcagcta atccgggcgg     25080
     caaaacgcgg aaagagttcc cgctggttat ataactggtg ctactggcat ctgcctgttg     25140
     aattattccg ggttgtctac cgcgttattc ccgactccag ttacaggaaa tggataaaat     25200
     aaaatattac agggccatct tatggaaata agcgctcgta actcatccac aaaaattatt     25260
     gccattatta ttctgtcact cacggctctg gtctttattc tggggtttgc tgttacctgg     25320
     ctggcggtga ctaacagaac actcattcat gagcagcgta cggtcgtcac cccgatgacc     25380
     tataacgcgc ctttcgcggt atctgaaaca aaagcggata ccgagttttt ccggatgatg     25440
     acgctgtcct tcctggccct gcgtcttaac gtctcccccg aaacggtaga ttcaaaccac     25500
     gcttttctga tgtcttttgt cgaaccagaa gtcagagagg aatttaaaaa agttctgcag     25560
     gaagaggctg cacagataaa ggccagtgat gtgaattcca cattctacac cacggaaatc     25620
     aatgtctatc ccgtagacgg gcgcgtggat gtcagggggg tgctgaaaat gtggatcggc     25680
     aactcaaaac ccaccacgga attaaaaaac tatcgtctcc gccttaagta cgccggtggc     25740
     tttacccgca ttggccgttt ctatgaggta accaatgaaa aataactttc cggcgctgct     25800
     tttgggcacc gccctgatga tcacttcgcc tgtgacagta tatgcacagt cacctgccac     25860
     actcagcttt ccgcagaggg ggcagttccg gctcagtatc agtaataccg atcccaatat     25920
     gatttttatt ccgggagata aagtcacagc catcacagct cagaacggga tgctggcaga     25980
     taaacgactg acgtctgccg gtggggtgct gttcacttcc gtggctaatg gtgttgcggc     26040
     cttcacggta ctgatggggt atataccatt cagttctgcc agttacggca tccccggtct     26100
     gctgatgctt gctggagcgc tgctggtctg gcaggtcagg gacacgctgc gtcccgccct     26160
     gtttgctgtc tggctgttgc tggttgccct gcttaatgcc cgacacggtg atgtgatgat     26220
     gttttccggc gtgattctga cgctgacggt gctgttctgt gtccacgggc tggtaccggc     26280
     ttccggacga cgtctgcagg caggacgctg gtttgcgcca gcgtatgcca ttcatctgtt     26340
     ttttattggc tttctggtca gagttctctg accgttcctg actccgatac agtggtctgg     26400
     tgctttagta ttactgaaca gcaaaaaaat gcctccctca gagatgaagg gaggcggaag     26460
     aataaggctt gtctgatgaa acaactccca tgcacgctgg aagttggatt acggttgttt     26520
     ttttaacata tttagcaggc ggaattaaag aggagagggg aaatgaatgg attcagaaac     26580
     cgttcacgaa gcagtctagt ctggcgttat aggtgtgtcg gaaaccgtgc tgtccggctg     26640
     gaggtcaggg aactctgggc agaggctgcg gatgtatggt ggctggctgc ccatattgct     26700
     ccccgcactg actggcagca gtttgcatgg cagagagcag aacactgcca gcggcgcagc     26760
     aggggtaagg ccggacatca accacgccct tcaggaggta gaggatgcct ggcgaaaacc     26820
     aaagaacata caagtcaggt gggctgacgc cttcgcgttg ctcagttgtc caaccccgga     26880
     aacgggaaaa agcaagtttt ccccgcttcc ggcgtttcga tattatttag tgaatggcat     26940
     ttgtcatata tacaaacata atgtcaacaa tataaattaa tatggaaagt ccgatattaa     27000
     tattggtttt ttttaattgt gctgaggatt cataagaaat tgtcagtgtt tttctggttt     27060
     tgatttgttg caccagaaac cgccgctccc gcccggggtc ggcacacagg tttatgtatt     27120
     ttctgttttt tcgtcatttc attatcaaaa tcacattaaa cggtcgtaat cagacatgat     27180
     ttgtgcgcca acacagatca tcgtcacaac tttcaagtcg ctgatttcaa aaaactgtag     27240
     tatcctctgc gaaacgatcc ctgtttgaga attgaggagg cgagatgtcg cagacagaaa     27300
     atgcagtgac ttcctcatct ggcgcaaaac gagcatacag aaagggtaaa cctttgagtg     27360
     aggcagagcg acagagagca gcttctgcgc gcaagcgatc tgtatgtaaa gagatcaagg     27420
     ttttcgtcag accagaactg aaaaactacc ttaccagtct gtgtgcagcg gaaggtgtaa     27480
     ctcaggcaga gttgatagaa aggcttatcg agaaagaggc ctgtcaccgg aatatggcgt     27540
     gatgggatca cgttcttgct agttttttct gtcagtgcta gattactgat cgtttaagga     27600
     attttgtggc tggccacgcc ataaggtggc atggaactgg ttctgatgtg gatgtacagg     27660
     agccagaaaa gtgaaaaccc cgataatctt ctctaacttt ggcgagtaca gaaagattac     27720
     cggggccatc taaataccgt atagccaaca attcagctat gcggggagta tagttatatg     27780
     cctggaaaag ttcaagactt ctttctgtgc acactccttc tgcgcattgt aagtgcagga     27840
     tggtgtgact gatcttcaac aaacgtatta ccgccaggta aagaacccta atccggtgtt     27900
     tacaccccgt aaaggtgccg gaacactgaa gttctgcgaa aaactgatgg aaaaggcggt     27960
     gggcttcacc tcccgttttg atttcgccat tcatgtagcg catgcccgtt cgcgtggtct     28020
     gcgtcggcgc atgccaccgg tgctgcgtcg acgggctatt gatgcgctcc tgcaggggct     28080
     gtgtttccac tatgacccgc tggccaaccg cgtccagtgc tccattacca cgctggccat     28140
     tgagtgcgga ctggcgacgg agtctgctgc cggaaaactc tccatcaccc gtgccacccg     28200
     tgccctgacg ttcctgtcag agctggggtt gattacctac cagacggaat atgacccgct     28260
     tatcgggtgc tacattccga ccgacatcac gttcacactg gctctgtttg ctgcccttga     28320
     tgtgtctgag gatgcagtgg cagctgcgcg ccgcagtcgt gttgaatggg aaaacaaaca     28380
     gcgcaaaaag caggggctgg attccctggg tatggatgag ctgatagcga aagcctggcg     28440
     ttttgtgcgt gagcgtttcc gcagttacca gacagagctt aagtcccgtg gaataaaacg     28500
     tgcccgtgcg cgtcgtgatg cgaacaggga acgtcaggat atcgtcaccc tggtgaaacg     28560
     gcagctgact cgtgaaatct cggaagggcg cttcactgct aatggtgagg cggtaaaacg     28620
     cgaagtggag cgtcgtgtga aggagcgcat gattctgtca cgtaaccgta attacagccg     28680
     gctggccaca gcttctccct gaaagtgacc tcctcagaat aatccggccc acgccggagg     28740
     cattcgcacg cctgaagccc gtcagtgcac aaaaaatcag caccacatac aaaaaacaac     28800
     ctcaccatcc accttctggt gcatccggtt ccccctgttt ttaatacaaa atacgcctca     28860
     cagacgggta attgtgctta tccacattaa actgcaaggg acttccccat aaggttacaa     28920
     ccgttcatgt cataaagcgc cagccgccag tcttacaggg tgcaatgtat cttttaaaca     28980
     cctgtttata tctcctttaa actacttaat tacattcatt taaaaagaaa acctattcac     29040
     tgcctgtcct gtggacagac agatatgcac ctcccgccgc aagcggcggg ccccaaccgg     29100
     agccacttta gttacaacac tcagacacaa ccaccagaaa aacccctgtc ctgcgcagaa     29160
     ctgaagccac aaagcccctc ctcataactg aaaagcgccg ccgccccggc ccaaagggcc     29220
     ggaacagagt cgcttttaat tatgaatgtt gtaactatac tccatcatgg ctgttagtct     29280
     tctggctgga agtgttgaat acacgctcgt aagcggccct gacggcccgc taacgcggag     29340
     atacgccccg acttcgggta aacccttgtc gggaccactc cgaccgcgca cagaagctct     29400
     gtcatggctg aaaacgggta tagtctggca gggcaagggg tgggtaaggt gaaatctgtc     29460
     aatcagtacc ggcttacgcc gggcttcggc ggttttactc cggtatcata tgaaacaatg     29520
     gagttccgcc ttccatgccg ctgacgcggc atcaaaaacc ctttcttccc cagtgatctc     29580
     tgtactcaat gtatattttc atttattgat gaaatttgat atttgcgcaa ttttcccgtt     29640
     atggtgtatt ttattctttc ggaggctata atatgtttaa tgtgattact cacccgaccg     29700
     cactggatga gctgctggaa ttaccagaca atctgcgtgg tcgcatggcc agactgattg     29760
     aacggctgga acaggaaggt aacaaaatga aaatgcctca cagccgtgta attggcggag     29820
     gactttttga actgagagtc ggggataaaa atatcgcaag gacactgtac gcttatgcaa     29880
     cgggtaacga aatttatctg ctgcatgcat ttgtgaaaaa gacgcaaaag acaccaacga     29940
     aagctattga aatcgccagg atgcgcctga aggagatgaa ataatgaaag taaaaggtgt     30000
     tccgttcagc caggtaaagc aaaaactgct taatactcca gaagctgtta aagggtatga     30060
     agatgctgac aaagaactgg agatggtaga aatgttatac gaaatgagag aaaaagcggg     30120
     gttaacaaag tctgcgctgg ccgaacgaat gggattacgc ccgtcagcca tcagccggct     30180
     ggaaagtaat cctttaggag ccagtatgaa aactttaaca agatatgctc aggcctgtgg     30240
     tgcaaccatc aatattcacg cagtctattg atttaacgta taggaaattg aaaaccagac     30300
     gataccgctg tccacgcctt atgccacgtg agcctttctg cttttcccac cactccggtg     30360
     gtttctctct ctgtatggtc gatttttata ccgtgacagg ctgtttttta tacttgcacc     30420
     gattcccggg cacacttagc ctgtgtcagg ccggcaatta gtagccggtt taaaactggg     30480
     ataacggaaa aatctggggt tccggcgtag aaccccatcc ttatctccct gccataagca     30540
     gccttagaaa tctttgcgat tggtcagtga tgctgtcaat cagaggggga tttgtctaga     30600
     atagaagaaa taatctttct aactcctgaa cacatctctg gagacttatg tcagttttgc     30660
     aagtgttaca tattccggac gagcggcttc gcaaagttgc taaaccggta gaagaagtga     30720
     atgcagaaat tcggcgtatc gtcgatgata tgttcgagac gatgtacgca gaaaaaggta     30780
     ttggcctggc ggcaacccag gttgatatcc atcaacgtat cattgttatt gatgtttcag     30840
     aaaaccgtga cgaacggctg gtgttaatca atccggagct tttagaaaaa agcggcgaaa     30900
     caggcattga agaaggttgc ctgtcgatcc ctgaacaacg tgctttagtg ccacgcgcag     30960
     agaaagttaa aattcgcgcc ctggaccgcg acggtaaacc atttgaactg gaagcagacg     31020
     gtctgttagc catctgtatt cagcatgaga tggatcacct ggtcggcaaa ctgtttatgg     31080
     attatctgtc accgttgaaa caacaacgta ttcgtcagaa agttgaaaaa ctggatcgtc     31140
     tgaaagcccg ggcttaagga taagaactaa cgtgtcagaa tcactacgta ttatttttgc     31200
     gggtacacct gactttgcag cgcgtcatct cgacgcgctg ttgtcttctg gtcataacgt     31260
     cgttggcgtg ttcatcgata ggaattaaaa tccccaaaag actaaaaaag caccatgaaa     31320
     cggatgtttc ttcaacaccc cttgtgcacc atatgagcgg aaacgactat taaacaggat     31380
     gacactgatt gatacagggt atgaatggcg gttttttgct ccgtttccgg taaaatggac     31440
     gcaacttccc ctctgcggct ctcagccgca cacctgctgt cgtgccagtc gctcatgcat     31500
     caggaccagc tctgccagtc ggtaaccccg cttcagcccc gtaaaacgca tctgacttcc     31560
     gcacagaatg cacttcagcg ggtcaacctt cagtaacctc tgatacatcc ctctccacct     31620
     gatttgcatc gccgtttttc tcaccgtctc cgttatgacg tacacaactt cttccagtaa     31680
     accgggtacg cgatctgttg ccttggaaag ttgatctgag ctctcagtaa atatcaatac     31740
     ggttctggtg agccgcttac gaataataca tcatccacaa aagccgtgaa acgttgcgct     31800
     ggctgaaagc aaacccgaag ttcaggatga tttatcagcc agtttactgg ccgtgggtga     31860
     atcatgtcga acggttgtgg caggcgcttc atgagacaat aatccgaaat caccagtgcc     31920
     gttcaatgtg gcagttgttg aaaaaggttc gtcactttat ggataccgtc agcccattcc     31980
     ccggtggaaa acatgggctg gttaaagtgt agcggcatta gaatcagtta tttagtaaga     32040
     aacaactagt ggaaatactt gtactttata atttcaaggg tacgggtccg cttcgtttaa     32100
     tttgcgtgtt tttaacaatt ttaaaaccca gacatactgt tccggatgtg gccccaccaa     32160
     aatttccact gttttgttca tttgtcgggc aatcatttta ttgtccgcgc tggcaatgca     32220
     agcatccatt ggtggccgaa tttcaatagt caggagatgt ttcttttcat cataaaccgg     32280
     gaaaagtggt ataatcatag cctgactgat gttcatcaga cgtccaatga ttggtaatgt     32340
     tgctttatag gtcgcaaaaa aatctgcaaa ttcactgtat tcaggaccat gatcctgatc     32400
     tgggaggtaa tatccccagt atccctggcg tactgactga ataaatggtt ttatcccatc     32460
     ctcccgggca tgtaagcgcc ccccgaattt acgccgtact gaattccaga tataatcaat     32520
     cactggattt cgttgctgat gaaacatggc ggccattttt tccccctgag ctgccagcaa     32580
     cattgcagga atatccacgc tccagccatg gggaaccaga aaaatcacat ttctgttatt     32640
     gtgtcgaatt tcctcaagaa tttcgaggcc tttccagaac actcgtttct ggaacttttc     32700
     cggaccacga attgccagtt ctgccatcat cactatggat tgcaatgctg tggcaaacat     32760
     tttgtcgaca attatttctc gttctgtatc actcttttcc gggaaacaaa gcgataaatt     32820
     aatcgtcgcc ctgcgacgag cttttttgct caatctgccc gcccaacgcc ctattttggc     32880
     caagacagga tctctgaatg aagggggaaa cattgaaata cctgcaatca ttcccaaaag     32940
     gaaccatgta gaccagtaaa caggggaaag ataatttttc ttaaattcag gaataaactc     33000
     agatttatat tttttcatta tttagtgcga atgcctctac caaaattatc attactgttt     33060
     tattcagaga atacatcaaa ccttaattta aatcctggtg ttctgagtgt acaggatatg     33120
     catccaaaga gcggatagta gtttcatgga tataatccag caaagcgtat cgttttcggt     33180
     actcagagcg ttttttactg gctatatcgc ttagcggctt tcgaatcacc tgggttggta     33240
     atctgtacca gtcaccacag gtttttcctg ctacagactc ccagaaatca ctatagaccg     33300
     caacaaagat tttgcgtttc tgataccagt atctcaattg ccggaaaaca tgactgtgct     33360
     cactgactgc cagacactca gagatattgc aagctttcat caacgcacaa aatgcttcaa     33420
     aaataatccg ttttgggaaa atcccataac aggcccgggt tgcgcaccga ataacatcag     33480
     gtccggtatt tttaggggct ccctgtaatc cgccaataaa agcaatgtgt ccattttgag     33540
     tcagaatgac tgaaaatgtt aaccgggcaa taactgtttt attgtaaaac aatgacaaca     33600
     tcaactctcc ttcccggtca aaaccactgg gagaacactg gatatcaaaa ttctctccat     33660
     ctttcccgat gaattggact aatgataccg atttttgtgg aaacaaaaat ttagaatatt     33720
     tttctggcaa attttgcaca aagcgataat gctcaagaat atattgtcca cgggtccagg     33780
     cgcgcccccc tttatgcaaa taagggcgat gaattcttgc tggcaacgtg gggtgtattg     33840
     ccagaatatc ctcaatgcac ggcaaggaac gcagttcata ataatatcga atactgacaa     33900
     ccggatttat agaacatcgc aaaatgtaca tgaaccgaaa ttttctgtgt tcccacttcc     33960
     ccggtagtga atctgaggaa aaaataatcc ttttaaggaa accgataaat gataagttac     34020
     ttatagaaaa catattgtta cttttgcttc gctaatgtga gtatttttaa cgcagtttta     34080
     ttaatatcaa accgctcttc tatatcctgt tttgccaggc gagccatctg ataaaaacgc     34140
     ccagggtcat taaaaaaatc attcagggcg cacatccatg cgtgcttatt acctgctggt     34200
     aacaatgtcc cggtctggtt gttctgaata acctcaggga ttccaccaat ctgagtggcc     34260
     actacaggca cagaaaatgc cgatgcttct gccagcacca taccaaaaga ttcgttttct     34320
     gaaggcagaa ccaccagact ggcaacccga tatacggggg cggcaggaaa aatattgtca     34380
     gcaataaaaa catcatcatg catgcccata ctgtcaatct gatactgtaa atgttcccgc     34440
     agttcaggtg aaccagaccc cacaatcaac caacagaact gtcgtccatt catttttaaa     34500
     tggaacagta aattcaacat aaattcgtgc cctttttccg ggcgcaacat tcctacctga     34560
     gcaattacgg ggcatcctct tcgggacgcc agccaggaaa gaacactcgg aggcaaactg     34620
     tttcgggaat caacgtataa ttcctggaaa tcaaagccag gaggcacaac agtaacccga     34680
     gttcgacatc cttcctgctc cagatgtgtc ttcatatttg ttccgggaac aatcacctca     34740
     tcgcaaaaat gatttattga aaaaaatttt gtttttcgtg tcaaatatgt cttttgcctg     34800
     ataattctga atggatgttt ccaggtaaaa aaccgtacca aaccaacaat attactatca     34860
     tgtccactgt gacaaacgat tgcatcgggc tgaaaactat gaactattcc gagtaatctc     34920
     catacagtag gaatgtgaag actgtttcga aataacgcga atgtgatatc aattccaaac     34980
     ttactggctt caaaagcaat tttgctgttc tccctgcaga caagcagaac tgaatgcccc     35040
     attttcttca gggccttcat ttgagcaaca gcctgtaatt cctgaccacc tatattcggt     35100
     gatgattccg taaatagtat attcattatt agtcatccgg taatcttggc cccttatgaa     35160
     gggccagcaa cgatgaaaaa aacggtgttg tataataaaa aagtcgtctt ttcagccata     35220
     cgcaattttc ccgttccttg gtgcttattc ttcctatccg tgtagttcct ttagcaggag     35280
     cattcattct tctttctgtt gtatataaat aatggaatcc aagttcttca gcgatctgaa     35340
     tataatcctt gttataataa ccttccggcc aacacaaatg tttactgcat tttcctgtca     35400
     ttttttttaa atattctctc ccgctcaata agtcctgccg aagatgttta cactgttctt     35460
     ctcgtgaagt gaacttttta tcccaacgtg tatgagtatg tgtatgaaca tgaaattcga     35520
     ccaggccaga ttgcaacatt tcgttcactt cagaccagcg aagcataaca ttatcagcat     35580
     tcccggttgc tatttgatgt tcgcaatcgc gatgagaata ttcctttcca ggagagtgac     35640
     gaaccggacc atttccaata aaactggtaa ttaaaaaaat atgtgccttg agattaaact     35700
     cgtttaataa aggatatacc tgaaaccagt tgtcaaggta tccatcatca aatgtcaaca     35760
     taacgctttt acggggaagt tttccgcccc gataaaaaaa ctccagttca tctgatgaca     35820
     gtgttttcca gttgttttca gccaaccatt tcatttgttt ccggaatgtc tcgggagaaa     35880
     gtgtaaccag tcctgggcaa tggctgacat gatgatacat taataccgga acatgatttg     35940
     ctttaaacaa aatgccccct ccgtttaaaa tttaaagttt ctggcaccca gtaagtagag     36000
     ataaaaggaa agcctaataa agttggtgaa ctttatatgc tactaaatca aatatcaaca     36060
     atttataaac aataatatat tatcatatct tttaaaaacg gctcactaag aaccttgagg     36120
     tgacacacta aatttagcta cctgaacaga ggtgatatgc ttacctctgt tcaggtgctc     36180
     caatgaaaaa aagaaatttc agtgcagtgt ttatttacag agtgacactt tcattaacct     36240
     gtacacgaac ttctattccg gcatcgtgac aggcatgcag ccactgcgcc acgtccagcg     36300
     gatcgccctc caggcgtacc accctgcctt ctttattcca taactgcaga catgtgctgc     36360
     cgtcgagacg taccacaaaa tccccacggc aggcctgata cgttatgccg cccagcgcca     36420
     ccggcaggtc tttggcagaa gtgccttctg cgggcggaac tgacaacggg atcagcggca     36480
     gtacgacaac ttccgccgtg cgctgttctg cccggaggcg gttctgttct gccagcagaa     36540
     gagggtgtgc tatggcccgg ccggcatcct ccagacgacg gcaagaggcg cgcaggtttg     36600
     gcccgtagac cggggcttcc ccgcttcgct ccagcacccg ttctatgtcc cgcgtcagca     36660
     cgtggcctgg ccgtttttca tcaagggcag ccagcacaat cagcactctc cgctgcagtg     36720
     gagacggtcg gcgactctga gtcattacct gtcaccatcc ggccagatga ggtttctgag     36780
     gcgctgaaag tcggcgtcaa tgagctcctg tctctttatg gcattcattg aagaatagcc     36840
     atttatggcc agttcatgcc agaagatcag catggctccg gctttggctg attcgcagag     36900
     ataagtcacg ccctggctgt ccagattgca tttccggatg ccttgttccg caaaccgggt     36960
     cagttgttca tagctgagtg aaaacaccct ttcttcatcc atcctgcatg cttcatctga     37020
     taatgttatt acagataaaa atcatatttg atatgatttt atgagtattg cttaattatc     37080
     atattatctg gggcttttct gccccgcaga tccgatttct gtgagttccg gatccgcgga     37140
     tccttcgctg ccgcccgccg gcccgctttc acatgatgtg gtgtctagct ctgctgacat     37200
     gacactgtat gttgtgtttc ttcccgtgtt cccgagccag tcatcagcga cagaaaagat     37260
     cgcttcgctt attcactgat cgttattcat ttccggctat tattgccatg atcacttttt     37320
     atgttggtta ttgatgtgag tgttaataat agcctgatag caatattccg ttgccggagg     37380
     catgctatag cgtaatactg gtgtatactt aattgtgtgc agagagtatg taagatgagg     37440
     tgcattatga agcagcgcat tacagtcacc gtcgacagtg acagctatca gttgctcaag     37500
     gcatatgatg tcaatatctc cggtctggta agcaccacca tgcagaatga agcccgtcgt     37560
     ctgcgtgccg aacgctggaa agcagaaaat caggaaggga tggctgaggt cgcccggttt     37620
     attgaaatga acggctcttt tgccgatgag aacagggact ggtgaaatgc agtttaaggt     37680
     ttacacctat aaaagagaga gccgttatcg tctgtttgtg gatgtccaga gtgacattat     37740
     tgacacgccc gggcgacgga tggtgatccc cctggccagc gcccgcctac tgtcagacaa     37800
     agtctcccgt gagctttacc cggtggtgca tgtcggggat gaaagctggc gcatgatgac     37860
     caccgatatg gccagtgtgc cggtctccgt tatcggggaa gaagtggccg atctcagcca     37920
     ccgcgaaaat gacatcaaaa acgccattaa cctgatgttc tggggaatat aaatgtcagg     37980
     ctccgttata cacagccaga tgtcgatggt tcatgatgaa ctgccaaaat acctgctcgc     38040
     ccctgaagtg agtgccctgc tccattacgt cccggatctg cgccgcaaga tgctgctggc     38100
     cacactgtgg aacaccggtg cgcgcattaa tgaagcactg gtgctgatgc ggggggattt     38160
     ttcgctcacg cctccgtatc cgtttgtgca gcttgcgccc ctgaaacaac ggaccgaaaa     38220
     agcagccagg acggcaggaa gaacgccagc caggcagcag actcaccggc tggttccgct     38280
     ctccgactcc tggtacgtca gccagctgca gacgatggtg gcaacactga aaatccccat     38340
     ggaacggcgt aataaacgaa caggcaggac agagaaagtg cggatctggg aagtgacgga     38400
     cagaacggtc aggacctgga ttggggaggc ggttgccacc gctgctgctg acggtgtgac     38460
     gttctctgtt ccggtcacac cacatacgtt ccgccattcc tatgcgatgc acatgctgta     38520
     tgccggtata ccgctgaagg tcctgcagag cctgatgggg cataagtcca tcagctcaac     38580
     ggaggtctac acgaaggtgt ttgcactgga tgtggctgca cggcaccggg tgcagtttgc     38640
     gatgcctgag tccgatgcag tgtctatgct caaaagaatt ccttaagctc tgactttttt     38700
     aaatcccttt cggatatctc atggatatat ttgataattg ccagatcctg ctcactgaaa     38760
     tacgtcattc gagtcagtgt taactcatcg tctggcaatg ccagtaatga ttctctttcc     38820
     gatagagaaa gaatctgcct ccttgccata tagttctcct tgtgaattat tcagtacgtt     38880
     atttttgatg aaaaagttat tgcataaggg tacaccctga cgcaataacc aaaatgtgac     38940
     ggtgtacgtt aaatgacata acctatatac gatagaataa atgcaacaat ctaaatgcga     39000
     taacatggtg ataaaatgtt catcagagct tatttgaggg catcgacgga agatcagttc     39060
     gccgagcggg caaaagagat gctggagcag ttcgttcagg aacgggggca taaaatcgcc     39120
     agctactacc gggaaaatat cagcggtaca aaacttgacc gcccggaact gaaacgctta     39180
     ctgatggaca gccactgtaa tgatattttg ctggtcgagc agatagaccg cctgacgcga     39240
     ctgagtaaca gcgactggat aacgctgaaa aagcagatag aacaacacga actgcggatt     39300
     gtcagtcttg atgtaccaac atcatggcaa gccctgtcag ataaagatcc ttcacaatct     39360
     gatccgatta ctcgtgcagt gataacagca ataaataata tgcttataga cctgatggcc     39420
     gcgatgtcgc ataaagactg gttaagtcgt cgccaacgtc aaaaacaagg aattgaacga     39480
     gcccatacgc tggggaaata tcggggaaaa caggccgatc gggaacggca tcagaaagtg     39540
     atgtactacc gacaggtcaa gaaactgagc atccgtgaaa cggcagaggc gacaggctat     39600
     agtacttccc aggtttgtcg cattcaggct ctctataaag aggttaaacc tgattaaaaa     39660
     acagccttaa cgtacaatat tttccgtttc ccaaacggag ccctataata tcgccagtga     39720
     gcgaatgaga taacaggggg cgcctggaat tcggaaaata tcccacgcta ggactatttt     39780
     taaccaaatc gtttttagtg atcgccagaa tagcaaggct gcggcggttt ttgtgtccta     39840
     aaccaaccgg tttcggacat tgttaaacag atatgtccga aagtcagcga aatcactttc     39900
     ttctttgtaa aatctggttt gtaatgcctc tggcaaaatc tctgatttca cgtagcgctc     39960
     tgccagtaac tatctatggt taatgatcta cgtttggtga tgcaacagga tttttttata     40020
     actcgccaga acagtgatgt ttaggaaatt tctgtattca gatgaaaaca catcttcctt     40080
     ccgatatctc atatatttat agccacgcac tattcatgtg tttaatttca gatagaggca     40140
     cagaagggaa aaaatatcct tgagtgcccc ataatccagt attcattgat aatccattgt     40200
     aatagatatt ttctacacct tcagctataa tatttgggca taattttttt aaattattaa     40260
     taactccctt aaaatatggt ttgcctatgt tttcctgata aaataatttg tcaagtttta     40320
     tggcgtgata tttatttttc atcgctgtgt gcatggtgct attcccacta ccaaaatcat     40380
     caagccagat atactctgta agagagcaaa gaaaaggtat aacatcattg ttctgagtta     40440
     gctcaggata tgtttctgat atttcaagtg ctataaattt attttcggat attgtttttt     40500
     gaatttcatt attacaacta atatataggc aggtttcgta atcaatattc acagaacaca     40560
     gtactccatg atgttcgaaa aaatccctgt gattaattat ttcttttatt tgagacttaa     40620
     gtagattgat tttcattgcg gttgtaaaca tgcttaaaac tctctgcgta gagagaggaa     40680
     ctccagtttt agaataaaat ctactcaata gttcaacagc aattagtttg ttaatgtttg     40740
     tggatattat tggttctgca atgtaaatta cttccatata tactccacct taaaatagat     40800
     ttgtcgagga taaattatga ctaaacatat actatatgtc atgttaacat tctttcctaa     40860
     cttttttata agtattattc atttagatgt agttcagtga ttttcaattt agataagcaa     40920
     aaaatgtgat gtacatcaat aaatttatat ttcacgcatg tgcttgattt ctgtttctgt     40980
     atctatctat tctttaaaaa agccttttga gaaggatagt agctatgccc ggagtgtgtt     41040
     actttattct cataaagaaa ccaataaatt ttcagtttct taaggatttc ctgatattaa     41100
     actatggtga tgttctgttg cttaagcatt cagaaagaga ttttttgcag agctattcag     41160
     ataaatatct ggaaattgaa cttaacgaag ataccgttag aaactattta tcgtattaca     41220
     accactgtga gaaacagttt ctggagaccc ccccctgcat tttaaggaaa agctttgctt     41280
     atccagattt attaataagt atgatagata atataaattc acaaaatcat atacatccag     41340
     attttaagga tgcaatattt ttttcattgc tctcagtatt tagtgatgta gcaaacttaa     41400
     gagcattcct cacatcagga atgcctacgt tttcaggaaa agttcgaagc atttttcttt     41460
     cagatgtttc taaacactgg aaactgagag atttagctga ttatctttac atgagtgaga     41520
     gcttaataaa gaagaaacta ttattagaaa acacttcttt tagtaaaata ttacttgata     41580
     ccaggatgtc gcttgccatt aaattgctaa agcaaaatca tccgataaaa tatgtgtctg     41640
     aaatgtgtgg gtttagcagt acatcgtact ttgtatgcct tttcagacaa tactatgagt     41700
     gtacgccacg taaatatcta aaacattaga gaacacctgt ctttacttcc ttattttacc     41760
     aatgatttca gctaagagat tttgagcgaa tgtccgttaa tcggtaagcg ccccgagaag     41820
     tacggtgctc cgttgacgct tacaaaagaa caataaaaaa tgatgctaaa attgcaacgt     41880
     tttataaata aattcaatta attacccaaa caaggtgaga cttatagagg aaatgggcgc     41940
     gaccccccca tatcctgcta taataagaag gcggctccct attatggaag ccgtcgctgt     42000
     actatcgtta aggtgatatc agctccctta actagttcgc attatgttgg atagctgcgc     42060
     agctatcaaa atcagaaata ataacggaag ttagcattta tagagttgtc tatattatat     42120
     ctcccaaacg ccgacttctc caactccaga ccaaaacgca tattgtcttt aacttccaca     42180
     ttcgttccca cgttcattag catcctgctg tctttttcac ctttgaagtg ttttttacca     42240
     gaagcatcct gtaaaacagt ttctccattt gccagcaaat cgaactggta actcagtcct     42300
     gcacgtgctg ttactttcca ggtatctcca gagaacactc tacctacatc cacgcctgtt     42360
     cgaccaatta gtgggtgata gtctttgtct ttcatactca attgcattcc ctggtctttc     42420
     cagttaaatg actttcctga taccgaacca taaaccagtt ccatctgtgg ttccacccat     42480
     gtattttctg acatgtgata acgatacccg atttcagctc cagcatacaa agaatgggtg     42540
     gtatagcttc tttcccccag ggaggcaaaa ttcaacgtat accgattatc atgatggaga     42600
     tatttaccaa tcaggtcaaa ataagctcca gactcaaaga gacctgatgc atacacccct     42660
     ccccctagcg attttgtttt accgctgaaa gcctggctgc tggcattgct gtctgtatag     42720
     gtcagtaatg caccggtgaa taaatttaga ccgttcagct catgctttct gtctgcacca     42780
     atctgaacgt gggtatagtt atctctgtaa ccactctcac ctgaaccggt accattcatg     42840
     atacgcgccc accctccagc atctccctga ctatcccgta aatcccccat acgtttgttc     42900
     agattattga cttccgtcag gaaggattta taacctgaat ccataaagtc cgttgcgatt     42960
     ttcgaggctc tggcatcagc gacagactga tatccagtca gcacccactt tgtggctgta     43020
     tccgtatttt ctgtcctgat ttctggcgtg atattactga atccaatctg ctgggttccg     43080
     gccttgaatg tattttcatc actgcctttt ggtgcagtga ttaacgtcac atttgtacca     43140
     ttggctgctt tgttaaaaaa gttaacaaga atagtattat tgctgccctg cagtttgccg     43200
     gtaacattca actggtcagc ctggccattg tttacatgta caagaaacac tgagttagac     43260
     gcaataagct cttttacccg cagttttgca aaatgccctc ttccacctaa ctctatttgg     43320
     gagtcgttgg ctttcagctc tttgatttcc gaatttctat cagagtgcca cagagcattg     43380
     ttcatattca ctgagctctg tggccccata atattgccct gcaaaacagc attatatccc     43440
     ctcattaagg tattgaataa tggagagtcc gtcttcccga tagttgcatt actgtctccc     43500
     agattaataa ttgctgcaga gtcctctgct ataatatttg aactcagata gcccatattt     43560
     ttcactgaaa ggctggcccg ctcaccgaga tgaattcctt ctgtagtcga gattacaggt     43620
     gaataatacc ccggctttcc tacagaaggg atccctgtca gagtcagaga ggcgttttct     43680
     tttatttcca tagtgttatt tgtgaaaata ccactctgtg cagtcagttt tgctcctttt     43740
     tcgagaagca gactactatt aataaagcta ccaacatggt caagaatagc attctgagag     43800
     gtcacactaa cagaactgtc ataagcctca ataccaccag taaaattctc cctgacctcc     43860
     agagacgaat ggttttcgag cagcacatta ccactgtaat aactttggtc agcagctgtt     43920
     gttgcagtgg aactcccttc aacagaagat actgcattac cggttccatc attcttgtca     43980
     gtaaagaccc gagaacttcc cagaatgacg gtacttccgt tggcagcact aatatctcct     44040
     tgcatacgag tatttctgga gagatggaat gttgctgcat caagcttcag tttatccatt     44100
     gtaaactgac ggttttccca atcactctgg ccggctgagg ttgtcattcc agcatgaatc     44160
     accggatgcc cctggaatat cagagtacct gactttttcg ttatcacccc ttcaggcaga     44220
     ttaacagaac catcaagagt cagcacatcc ttaccagaga gtggatgtat atttacatcc     44280
     atataaccat taagttgtcc atgaaacata taaggttgag agctttcctc aatcttctgc     44340
     tgtttcacga tttgaatcgc tttatcacga tcgtgaccaa cattttgcca gacattggta     44400
     ttatctaaat cactgaaaaa tggaccgtac gcctttgatt tcaggataaa gtaagtattt     44460
     gatgcagaaa cataatataa gtcacctgga ctaccacgcc ccccaaaaac ttcatatgtc     44520
     ttcacatcaa cactaatgtc attttcattt agtgtttgta atttaagtgt taattcagat     44580
     ttgtttttgt tattgttaga aataatagca ccataatctg cagcctgaag acgagtaaag     44640
     gttacattat ttccatttaa atcaagagtg ccgcctctat atccccatga tattttatct     44700
     gggttaactt gattagcatc tgaaagtata actgttgcac gaccactgga aatgttaata     44760
     gagctaaagg cttgcttgtg tccattatca tcagggcgtt gattcagaat tacggttcca     44820
     tcaccgactt tcagtcctcc attattaacc ccttttccat taacagttaa tgtgccttca     44880
     ccaactttat gtaagttatc attattaaca ccattaacct gccaaagcac atttacacct     44940
     ttttcagtaa tgataccacc tccggtccat gtttggtcag ttaaggatgt aactgtgtag     45000
     ttgttaaaaa actgcagata gccagcccct tgatctatag agtcgtgtaa aataacctct     45060
     ccattatttc ctgtaaattg aagattttta cctgcattta ggtcttcccc tttttttcca     45120
     tgcatgtccc acacaactcc ctcttgactt aatgttccca ctcctgcgtc tttatcatat     45180
     ctccattgta agctcccctt tttagagtca tatgatattg ttttatcaaa atcatgcttt     45240
     tgttgctgat taagaaaatc ttgagttgtg acaacccagt tattaccata ctcacttcct     45300
     gatgaaagaa cgccaattaa aacccatttt ttttccagag agtcatacgc aaataaagga     45360
     gagccactat cacctttatt tagatagttt gcaagaggcc cattagcagg attaaaaata     45420
     tctcctgtag gtgcagtaat catttgccca ttgttatatg agcttaaagc actgatagtt     45480
     cctccagtta ggaaaccacc atttgtatat accggtgtaa gatttccatt tttatccttt     45540
     atatattgca atccacctcc aagcctataa aaggctgtaa aacgcccccc ttcttgataa     45600
     gcgccattta cagctccaac actggagact tctgcagggg cgacctccgt gacaatctta     45660
     tttaaacgtc gtgttttaat atcaaggcta ttatggttgt tctctcctac tacagtataa     45720
     ttattttgaa tatgtccaaa actcattata tctgatccat taacatgctt tgctgtgaca     45780
     acatattgag gtgagtacag tgtatggtct cctggtggta atgtccctgt attcatcgtg     45840
     gcactactaa aatcaggcat tggagcttta tcaagcactc caactaacac tccattctta     45900
     tcgtagatat ttatatttga tgcgccaact ataaaagctc ctttattttc ggcaaaatcc     45960
     cgaaatgttt gatacgatat atctgcatta actgttgcag caagagatgg gggggcataa     46020
     gaaacaatag caattgttat tggtgaaata attattgatg aagcactctt cagtttccct     46080
     ttaacagaaa cgcgacgggc aagttcagaa acagcaataa aacctttggc taaaaaacta     46140
     tacttaagag agaacacttt attcatatat agaatcctgt cttttatcaa aaaatatcca     46200
     cacaacaaat aaagacaaca taaataacat ttattgtctt ttaaaagaga tagctccttg     46260
     tactttcagg ttaaaataaa agtgatcttt taccctccat tttctgtttg cattacatac     46320
     tctccccgtc cagtgttact atacggcaag ggattgttgc cttattaagt tgttgtatct     46380
     catctattac gattcatatt aatagagacg aagtaaaatc gtattcccgc tatcctttaa     46440
     cttaaagggg atatataaac taaagttgta tttggtaaag ggattgctaa catgttaaaa     46500
     gcatagtctc cttgtctaac atctacttaa atctcccatg gtagtattct ataaagcttt     46560
     gaaagtataa gagattgcgt ttggtttgtc tatatctatt tctgtgataa tatccatttc     46620
     tgagctttat ggaatgtttt tactttcagt tgacaaacca gttctatcaa tagatttgac     46680
     tatatttgaa taaggatttt tacatatcta ccggatagtc atatcgaggg taaatggcgg     46740
     cgcctcttta ataatggctt tgtgcctaga gtaaataaaa ctgtccttga cccacgatat     46800
     tcagacagtc gttgtatctt aagttgacgt tacccgctga cgttaatatt cccggggttt     46860
     gagggccaat ggaacgaaaa cgtacattaa ggagataatt cgttgtttat atttaaattt     46920
     aggtagtgac tccaacttac tgatagtgtt ttatgttcag ataatgcccg atgaccttgt     46980
     catgcagctc caccgatttt gagaacgaca gtgacttccg tcccagcctt gccagatgtt     47040
     gtctcagatt cagattatgt cgctcaatgc gctgagtgta acgcttgctg ataacgtgca     47100
     gctttccctt caggcgtgat tcatacagcg gccagccatc cgtcatccat accacgacct     47160
     caaaggccga cagcaggctc agaagacgcg ccagtgtggc cagagtgcgt tcaccgaaaa     47220
     cgtgcgccac aactgtcctc cgtatcctgt catacgcgta aaacagccag cgctgacgtg     47280
     atttagcacc gacgtagccc cactgttcgt ccatttccgc gcagacaatc acatcactgc     47340
     ccggctgtat gcgcgaggtt accgactgcg gcctgagttt tttaagtgac gtaaaaccgt     47400
     gttgaggcca acgcccataa tgcgggcagt tgcccggcat ccaacgccat tcatggccat     47460
     atcaatgatt ttctggtgcg taccgggttg agaagcggtg taagtgaact gcagttgcca     47520
     tgttttacgg cagtgagagc agagatagcg ctgatgtccg gcggtgcttt tgccgttacg     47580
     caccaccccg tcagtagctg aacaggaggg acagctgata gaaacagaag ccactggagc     47640
     acctcaaaaa caccatcata cactaaatca gtaagttggc agcatcaccg tttatattta     47700
     aatttagagc tctcagctat ccttttaaaa tatcctctgg cagtgtgaat gtataatggc     47760
     ccaacatatt gatatgcccg agcataaggg gagatagccg agcgatatct tcatctataa     47820
     tttcttctcc attacggcgc atccagctca acacttcctg catatagagc gtgtttcaca     47880
     gaaccactgc attagtaacc agccccagag ccccagttga tcttccagcc cttcacgata     47940
     acgctttctg atctctccgc gttgtccgta acaaatcgca cgagccacag cgtggcggcc     48000
     ttctcctcga ttgagctgcg tcaggatccg ccgacgataa tcttcatcat caatataatt     48060
     gtaagcgtaa actgaccgcc gtatgtagcc attaagccag tattggtaac gtaggtgccc     48120
     accttttcaa ctgaagtgcg ccccaaaggt tagacactag accaaaaact gaggatgcat     48180
     ggaaaagttt tcattggagt ttaaaaaggt agtatcagaa aagtacctgg agggagagct     48240
     gagtctgaaa tctgtagcaa ggatgtacgg tatcagtccc tgcacagtaa gaaaatgggc     48300
     ttatgcctat cgggaacatg ggataagcat acttacgggt aaaaaaggac gctattctgc     48360
     tgagttaaaa ctaacagtag taaaagaagt cggtaatggt gccaacttac tgatttagtg     48420
     tatgatggtg tttttgaggt gctcccgtgg cttccatctc catcagttgt ccctcctgct     48480
     cagctactga aggcgtggtg cgtaacggta aaagtactgc cggacatcag cgctatctct     48540
     gctctcactg ccgtaaaaca tggcaactgc agttcactta caccgcttct caacccggta     48600
     cacaccagaa aatcattgat atggccatga atggtgttgg atgccgggca accgcccgca     48660
     ttatgggcgt tggcctcaac acgattttac gtcacttaaa aaactcaggc cgcagtcggt     48720
     aacctcgcgc atacagccgg gcagtgatgt gattgtctgc gctgaaatgg acgaatagtg     48780
     gggctacgtc ggtgctaaat cacgtcagcg ctggctgttt tacgcgtatg acaggatacg     48840
     gaggacggtt gtggcgcacg tcttcggtga acgcactctg gccacactgg agcgtcttct     48900
     gagcctgctg tcggcctttg aggtcgtggt atggatgacg gatggctggc cgctgtatga     48960
     atcccgcctg aagggaaagc tgcacgtaat cagcaagcgt tacactcagc gcattgagcg     49020
     acataacctg aatctgagac aacatctggc aaggctggga cggaagtcac tgtcgttctc     49080
     aaaatcggtg gagctgcatg acaaagtcat cgggcattat ctgaacataa aacactatca     49140
     gtaagttgga gtcattaccg gcatccgcat agtgcgctgg gttatcgctc gccacgggaa     49200
     tatctgcggc agcaggcttg taatgggtta agtgataaca gatgtctgga aatatagggg     49260
     caaatccaga agaataaaga atgttatggt gtgaaagctt cacacaaaac acctttatcc     49320
     tttcttaaac cgagcgatac gttatacatc gttgctcatg gcaacacatc agttattgga     49380
     tctggttcag ctactgggcc aacgttgaat cccgtagcat tagcctctct attaatacac     49440
     aaacgtttac caaagaactt catagatatc agagtgttgt cctgcgcctc ggggatacat     49500
     tcgagaaccc cagccttcgc acaacggctg aaagaaatta tgaaagtaca tgggtatcat     49560
     agtctggtcg ttaccggata ccttggtgag gttgatgtat cgagagactg gagattaaaa     49620
     aatgatgatg gtatggagtt ttatacctta agaaaaaaag ggattattcc tgttaaggat     49680
     gtattaagtg aatcccagag agcgctttgt ggttctgatc tgaaatacgc cctttctgat     49740
     ttcaagaaac gattttgaat aggagtagtg cactgacgtc agagccgtta tgcaagtaag     49800
     cggctcgcca gaaccgtatt gatatttact gagagctcag atcaactttc cagggcaaca     49860
     gatcgcgtac ccggtttgcc ggccagtcct ggatatgctc aatgacataa cgtagccatt     49920
     tttctggccc cacattgttc agttttttct gaattttaac tgtatttgtc ctttattgtt     49980
     cttgtttgtt tccttcgtgc tgttttagtc gatttttatc ttcatttttc tttatttttc     50040
     tgtttgtggg cgatatcagg tctttactga tgcgtgtttt taggtgataa tctttttcgg     50100
     caccatattt ttctaaaaaa atccatttta ttctgtgagg ttctggatgc gtatctttgt     50160
     agatgacggt tctaccaaca tcaaactggc ctgggttgaa gacggtgcag tgaaaacgtt     50220
     aattagtccg aatagtttta aaccggaatg gtctatgacg ctgcagggac tgactgatgc     50280
     cactataccc gcttccgcaa actatgagat tgatggagag aaatacagct ttgatcaatt     50340
     gagtccggat gcagtgcgca ccacagaaac gcgttatcag tacagcgacg ttaatgtggt     50400
     tgctattcat catgcgttga tgcagtcagg tattgctccg caacctgttg atattattgt     50460
     tactttacct ttaggtgagt atctggatga gaacgatcag ccaaatctgg ctaatatcga     50520
     acgtaagaaa aataatgtca gacgagctgt aacagttcag gggcgtgaaa actttaccat     50580
     tcgtaaagtc agtgtcttgc ctgagtccgt gcctgccggt tttgacgtgc tgaaagatct     50640
     gaatgatctg gagtcgctgt tgatcgttga tatcggtgga acgacccttg atattgcaca     50700
     tgtccgcagc aaaatgtccg gtttcacaaa aacttattgt gaccccaaga caggcgtttc     50760
     catcattact gaagcagtta agcatgcgat ggatgtgaat gtgagtacac gaaccagttc     50820
     ttattttgca gatcgtctaa tccagagtcg ggatgacaat gaattcctga ctcgttatat     50880
     cccgaatgca gaacagcgtg agcagatcct gacagtatta cgtgaccggg aaaaaaaact     50940
     gcagcatcgt gtggcggatt cagtaggacg ctttgctggt tttactcatg ttatggttgt     51000
     tggcggtggt gccagccttg tggctggggc agtaaaaaaa gcgacaggag tgggtgataa     51060
     ccgtttcttt gtcagtgaca atcctcagtt cgatctggtg ttgggaatga tggcaatgaa     51120
     gggatgagta tggctgataa tcgtaagtgc tctttttata tttatccgga acgaaatgca     51180
     gctgatcggg tagctgacag gtttcttgaa aaattgcctc agaaagaacg tggtcgggca     51240
     atgcgggcca tgatgttgtg tggtgctgca ttgatgaaac aggatgaacg attgccgttc     51300
     ctgatagctg aattcctgac agacagcacg tctatgcagg atattcaacg aattatcagt     51360
     agtacgctac cacaacagga aaatggtgaa gttgttcgtt tgctggaggc atttctgcag     51420
     tctgccggta ataatgcaaa aacgatcctg cctgcggttg attctgctac gcaagaaata     51480
     tctgctccag tcgatcagaa tctcctggaa acaagaaaca acattaagaa cttgtttccg     51540
     gatgatgaat aagaactgaa ctctgttaaa ggacgctgtt gcgtcctttt ttcttttccg     51600
     acaaaggatg ttgccgggct cctcttttta ctgcgccggc tgacgcggcg cggcagaaac     51660
     gctgcctgtg gtcagtgtcc cgcgtccggc gggcacggga cgggcgcttt taccgctccc     51720
     ggctggcgtc gttgacagtg tacgccagcc agtcgccctt ttctgatgaa cgcccttcaa     51780
     gccgctttcg cgaatgaaag ggacatctta ttcggtcttt acgctgggga gttactttgg     51840
     aagactgcgt caacacgatg ataagcgtac aaagccattg ttaagggatc ctctatgact     51900
     gttgttactg tcggtattga tttagctaaa aatgtgttcg ctgtgcatgg cgttaatgct     51960
     gcaggaaaag ctgttttagt taagcctctt gtgcgtcggg ctaaattgct tgaattgatt     52020
     gcaacacttc cagcatgtct gattggaatt gaagcatgta caggtgcaca tttctgggca     52080
     agagagttcc agaaaatggg gcatacagtt cgaattatgg cgccgcaact ggtttctcca     52140
     taccgtatgg gtggccgtca tgggaaaaat gatgctgcag atgccgctgc catttgtgaa     52200
     gctgttaccc gtcctaatat gcggtttgtt cccataaaat cagttgagca gcaagggcag     52260
     ttatttgtac acagagctca tcagggatat gtcagtgaga gaacagcatt gattaatcgc     52320
     atccggggat tgctcagtga gttaggtatt gttctcccgc aggcgtttaa agcgttttta     52380
     tccggggtgg ctcaggtcct tgaggatttg cccggtttct gtaatcaggt tattggtgat     52440
     cttcttaatg agctttatca catagaagaa aagattaaaa acagtgaaaa actcattcag     52500
     caacttgcca gagataactc agcagcacaa ctactaatgc aattcagggg gataggcccg     52560
     atgactgcaa cagcaatcgt tgccagcata ggtaatggtc atggtttcaa gaacggacgt     52620
     cagtttagtg cctggctggg gctaacacca agacaacaaa gttccggggg gaaagcacgg     52680
     ttagggagaa taactaaagc cggcgacagc tatctcagaa cacttcttgt tttgggggcg     52740
     agatctgtat tgttgggagc agctaaaaat gatgatccgg tcagtcgatg ggccctgcag     52800
     ttaaaagaaa ggcgaggata tggacgagcg cttgttgcga tagcagcaaa aaatgcacgt     52860
     atgtgctggg caatgttgca cctgagagat gaattcagat ttcctgccta gtctactgat     52920
     tattaatgag tttatgaaat tgatttcttt ccttgcatga cgactgcacg atgatgattt     52980
     aaaaggtttg gacctgcgcc atggtttact cgagatatgc aagaggctgc catgtttatg     53040
     tggatatctg tttcgcggat ggagtctatc tgcgggaaaa ttttaacggt gtcagggtac     53100
     agtgtggcga cttcatggaa tggcagccgg tgcagtatta cagccggatt ataatgaatc     53160
     cgccgttcag ccacgggcag gatatccggc atatcctgcg agccttttcc ctgctgcgtc     53220
     cgggtggcgt gctggttgcc gtctgtctca acgggccacg ccagcaggag aagctgttac     53280
     cgttttctga catccgcgag gagctgccgc gcggcacgtt tgcttatacc catgttccga     53340
     cgatgattat tcgtctgcgc gcctgatgac acagggcagg cgggaggata aatgcccgtc     53400
     tgcccgtgca ggaaaaagac cgcgcgccgg tggcgctgaa aggggccgcg ctcacgcgcc     53460
     gcccctttca ttgcgcggac gttctgctgt gggcttctgt cttttcagac ctgtcatttg     53520
     tctgttactg atgatgtggt tgttcctgct actgctactg ctactgttct tcttttttct     53580
     gctgctctga ttactgcctg ttttgttgtt ctcctgctta tgccttttcc gggcgtcccc     53640
     ctggcggggc gggctatcgt gaacggagcc agcgaagctg tctcgtaagc gtcaacggag     53700
     caccgtattg acgcttattt attggtgagt actacgttcc atggcaggag ttcatcaact     53760
     cggttggaag gccattccgg cagtacgctc aggatatggc gcagatacgc ttccggatcg     53820
     ataccgttca gacggcaggt gccgatcagc ccgtacaaca gtgctccacg ctcgccgccg     53880
     tgatcgctgc caaagaacat aaagtttttc tttccgagac agactgcacg aagcgctctt     53940
     tccgcagcat tattatccgc ctccgccaga ccgtcatcac tgtaataaca gagggcatcc     54000
     cactgattca gtacatagct gaacgcttcg cccagtctgg attttttcga cagcgtacca     54060
     ttcttctcca ccatccattc atgcagcgac gtcagtaaca ctttgcttcg ctgctgcctg     54120
     acggcaagac gctctgactc cggtaatccc cgtatttcat cctcgatggc gtacagttca     54180
     ctgattcgct tcagtgcttc ttctgccgtc gcacttttgc tgctgatgta tacatcgtgg     54240
     atttttcgcc gggcatgggc ccagcacgca acttctgtca gtgcaccacc ttcacgttct     54300
     gcactgaaca acctgtcgta acctgtgaac gcatccgcct gcaggatacc ccggaagggg     54360
     cggaggtgtt gctccgggtg tttcccctgc cggttcggcg agtacgcgaa ccagaccgct     54420
     ggaggagatg acgaacccac attgcgatca tcccggacat acgtccagat acgccctgtt     54480
     ttcgcctttt tctgacccgg tgccagtacc tttaccggtg tgtcatcagt gtgaatcttg     54540
     cgggtgttca ttacataacg gtacagggca tcattcaccg gtgtcattaa ctggcagcac     54600
     gcgtcaaccc agttggagag taaggcccgg ctcagttcga caccctggcg ggcaaagatt     54660
     tcactctgac gatacagtgg cagatgttcg cagtattttc ccgttaacac gcgggcaagt     54720
     aatccggggc ccgcgatacc acgctctatc gggcgggacg gcgccggtgc ttcaacaata     54780
     cagtcacatt ttgtacaggc tttttttacc cgttctgtgc ggatcacttt cagggcactg     54840
     ctcaccagtt ccagctgttc agcgctgact tcccccagat aatccagctt accgccacac     54900
     tccgggcaac agctttcttc tggctccagg cggtgtattt cacggggaag gtgtgccggt     54960
     aacggacgac gatggcgcga ctgtcgcaac tggcggggaa cctgaggatc gtcttcccgc     55020
     ccactgtaac gatcgctgtc ctgttcacgt tgtttcagca gagcctcagc cagttcaact     55080
     tcacgacgca gtttttcaga acgggtaccg aacagcatcc ggcgcagttt ttctatctga     55140
     gcccgcagat gttctatttc ccgttcatct tcttcgatct tttcttcggc acgtgtcagt     55200
     gcagagcgca ggaaggcttc cgtctcttca accagactca gttgctggtc tttctgacgg     55260
     agggcttcag cctgctcaga gagcaacctt tccagctctg cgatgcgaat gaggtatttc     55320
     tgactcatga ccgtttttat aatgcggtca ggagtttttt acaacattgt cagtgagtta     55380
     cggctggatg tttttggctg acgccagtcc agcttatcga ggagcattgc cagttgcgag     55440
     cgggtaatgg ataccttgcc gtcacgtacc gcaggccaga taaactggcc ttcctccagg     55500
     cgtttggtga acaggcacag accatcagca tcagcccaaa gaattttgac ggtgtcaccc     55560
     cgtcggccac ggaagataaa caggtgaccg gagaagggat tatcattcag cacatgttgt     55620
     acctgttctc ccagtccgtt gaaggattta cgcatatcgg taacgccggc aacgagccag     55680
     atacgggtac ctgatgggag tgagatcatc ttcccctccc ggtcagttca cggatcaaca     55740
     ctgtgagcag ctctggcgat ggattttcca gcgtcatgtt accgtgacgg aattccacct     55800
     tgcaggaact ggcactgact ctggtctgag tggaagtgga taaagacggc gcaatggccg     55860
     ccacaggttc tttctgctca tccggcgtta tttctacagg taataattca acgccagtgt     55920
     cagaagaggt cgttaccgga agacgccgcg aaacacgccc ttcgttctgc cagagcctga     55980
     gccatttgaa aataacatta tcattgacgc cattttcacg tgcaatctgt gcaacacaag     56040
     ctccaggttg tgatgccagt tccaccatac gaagtttgaa ttcattcgaa tagtttttac     56100
     gaggttcttt tcgccagtcc tgtaattcca tacttagatg tccgtctata tcagatgggc     56160
     gtctaagtta ccaattctcg tctgatggct acatacggcg gtcagtttac gcttacgctg     56220
     tctccgccct gacgggcttc catccctgac gcgaaacccc gggcttgcag cgaccgttcc     56280
     ggtcgcgccg cctctgtcgc gccgtggcct gcgctccctg catcccggca aaaggccgcc     56340
     gggatgtaag gcgcaacgcc gtttcgcaaa ccgcgcttca cgtcgttgcg gcgggtccct     56400
     gcccgttgtt gtgtccggtg ccattcacct gtttaagccc ctgtcgccgg gggctgatac     56460
     agccacaacc tgccgcactg actgcccagg gtaaatgaac agcccacaaa attttttacc     56520
     taaaacccgg taaaaaattt tgcgttctgc ccaggacagg tgcgtcaggc cgtggcagtg     56580
     atgccccttg cggcgaaggt tctcaaaaag gtgatggtta ataccggagg gaacaaaagg     56640
     caggtccccg caaaacgtca aaaccgcggc tcccgaaact caaaagatga tgggggctga     56700
     aaacatcaac agaaggagat tcatcatggc agttcgtggc attaacaagg tcattcttgt     56760
     cggtcgtctg ggaaaagatc cggaagtccg ttacatccca aacgggggcg cagtggcaaa     56820
     cctgcaggtg gccacgtcag aaaccgttct cagtggctgt atgccgtcga tgtgctgatt     56880
     gaaacacagg gcgaggtctg cctccttccc cttcccggcg atgcagcaga gcagttgttc     56940
     ccgtcagtgc ggttccgtgt cagggaacgc agtcgccata aatccgcact ggtcatgcag     57000
     aagtacagcc gccagcaggc acgggaggca gagcagaaaa cccgtgcgta ccagacgctg     57060
     gttgctcagg cagaaatcga actggcgttc cattcgccgg aaacagtcgg aagctggcat     57120
     gcacgctgga gtgaccgggt ggcagagcat gacctggaaa ccctgttctg gcagtggggc     57180
     gagcgttttc cgtcactggc cgggatggaa cgctggcagt ggcaggatat gccattctgg     57240
     caggtcaccg cagaggctgg tatggcggca agggaggccg gtcatgccgt ccgtgagatg     57300
     gagcggtgga tggtgccgaa caaactccgg gaggcggcgt gaagtggcgt tactcactgc     57360
     gctggaaact gccttatccc tgtcctggcg agcgtgaact ggtttcagaa gtggtggagg     57420
     cggggcagcc tgcaccggca tccgttatgt cacgctgggt tgccggagca gggtatgcgg     57480
     tctgtctgga ttttatttct gaccgcccgg tgcgccgctg gagcgaagaa cgtaaggctg     57540
     cggtacgacg gcggaatctg gagaaacgta tcaacaggca tgcaccactg tttgcggatg     57600
     aactgattgc ccgtgaactg gctgaacgac cggattattt tcagggaaag tgaatgtggt     57660
     cagcgtgctg gtatatgggc tatgatgtgc ccggcgcttg aggctttctg cctcatgacg     57720
     tgaaggtggt ttgttaccgt gttgtgtagc agaaggcaga aagccccgta gttaattttc     57780
     attaacccac gaggcccact gtatgtctga tcaacaccag tatggcctct taccgtgcaa     57840
     attgcaagga ggagtaaacc atgaaactac cgggaaacgc ccttatctgg tgcgtattaa     57900
     tcgtgtgctg cacgttgttg atattcacac tcctgacccg gaatcgcctg tgcgaagtcc     57960
     ggctgaagga cggatacagg gaagttacgg caacaatggc ttacgaatcc ggcggtaagt     58020
     agcaacctgg aggcgggcgc aggcccgcct tttcagggct gatgctggtc tgactgcact     58080
     gaagcgcctt tataaagggg ctgctggttc gccggtggcc cctttctcct tgctggcatt     58140
     gtgcgggcat gaacaaccag actgccagga aggccgtttc ccttcgggaa cggggatgaa     58200
     cgcgcgcctg cggcgcccgt tcttttcccc cgccttctct gtttatgacc tgtcagaaat     58260
     cacatcacct tccctttgat tattcgtaag cgcatcattt aaaccgtctt tcgcctccct     58320
     tccctgtttc cgatactaat gtccattttc gcagtaaaat gacatttaag atgaatgcac     58380
     gaaaggcggt actggcagat aatccggaat tgatcctgcg tgtgctacaa ctgagatttg     58440
     acgagtcact gtcgtacccg cgcatttctt gtcaacgacg gatgaaaagt gatccactta     58500
     tatctccacc aacggcccaa tattgatcca ccgttttact caggattagc ttctgctata     58560
     accccggcct ttcgtttctg tctgagtcga tagctttctc ctttgatttg aacgacatgt     58620
     gagtggtgta agatacggtc cagcatcgct gaggtcaggg ctgcatcacc ggcgaacgtt     58680
     tgatcccact gcccgaacgg cagattggat gtcaggatca ttgcgctctt ttcgtaacgt     58740
     ttagcgatga cctgaaagaa cagttttgct tcttcctgac tgaacggcag atagcctatt     58800
     tcatcaatga tgagcaggcg gggggccatt actccacgct gaagcgtcgt tttataacgc     58860
     ccctgacgtt gcgccgtgga taactgaagt aacagatctg ctgctgttgt gaagcgaact     58920
     ttgatacctg cacggactgc ttcatagccc atcgctattg ccagatgggt tttccccaca     58980
     cctgatggcc ccagtaatac gatattttca ttacgttcta tgaagctgag tgagcgtaac     59040
     gactggagtt gcttctgcgg tgctccggtg gcgaatgtga agtcatactc ttcgaacgtt     59100
     ttcaccgccg ggaaggctgc cattcgggta tacatcgcct gtttacgttg atgacgtgcc     59160
     agtttttctt catgaagcag atgctccagg aagtccatat aactccattc ctggtctact     59220
     gcctgttgtg acagcgcagg cgctgcgctt ataaggcttt ccagttgcaa ctgcccggcg     59280
     agcgccatca gtcgttgatg ttgcagttcc atcatcacgc cactcctctg cagaatgagt     59340
     cgtagatgga gagtggatga tgcagggggg atttgtcgaa gttcacctga ttttcaccag     59400
     gatgcacgtc atactctttt ttctccggag gcagtgccag catggactgc tgctcttcga     59460
     gccagcgatc gcagggacgg gcctggattg tttcatgctt tcgttggtta gcgacatcat     59520
     gcagccagcg cagaccgtgg cggttggctg tttcaacatc gacagtgatc cccatcgggc     59580
     gcaggcgagt cattagtggg atgtaaaaac tgttacgggt gtactgcacc atccgttcca     59640
     ccttaccttt agtctgtgcc ctgaaggggc gacacagtcg gggagagaag cccatctcct     59700
     tgccgaactg ccacagcgaa ggatggaacc ggtgctgacc ggtctgatat gcgtcacgtt     59760
     gcagaaccac agttttcata ttgtcataca acacttcgcg cggcacacca ccaaagaagc     59820
     ggaacgcatt acgatggcag gtctccagcg tgtcataacg catattgtca gtgaattcga     59880
     tgtacagcat tcggctgtat ccgagaacag caacgaacac gtgaagcggt gagcgaccat     59940
     tacgcatagt gccccagtca acctgcatct gtcgtccggg ttcagtttcg aaccgaacgg     60000
     caggctcctg ctcctgagga accgagagag aacgaataaa tgccctgaga atggtcattc     60060
     cgccacgata tccctggtct ctgatctcgc gggcgattac cgttgccggg attttgtaag     60120
     gatgagcatc ggcgatgcgt tgacgaatat aatcccggta ttcatccagg agtgaagcaa     60180
     cagcaggtcg cggcgtatat tttggcggct cagattttgc ctgcaaataa cgtttaacgg     60240
     tattgcggga gatccccagt tctctggcaa tcgcccggct actcattccc tgcttgtgca     60300
     ggattttaat ttccataact gtctcaaaag tgaccataag ctctcctgaa tcaggagagc     60360
     agattacccc ctggatctga tttcaggcgt tgggtgtgga tcactattgc accgttcgtg     60420
     acagcttacg ccagagaaat aactggctgg ctgctacacc atgttgccgg gcaacgaggg     60480
     agaccgtcat ccccggttca aagctctgct gaacaattgc gatcttttcc tgtgtggtac     60540
     gccgtctgcg tttctccggc cctaagacat caatcatctg ttctccaatg actagtctaa     60600
     aaactagtat taagactatc acttatttaa gtgatattgg ttgtctggag attcaggggg     60660
     ccagtctaga ggccgtagag ccgtcccctg ataagcgcag aagtcacctg cttactgact     60720
     gcgcggtatc cggtgtgaag gtagcaggag cccgagccag accatctcag ggaatgtgag     60780
     aacctgtttc cggcacgtat cgggcaacag gggcggactc attcgtagta gtgatgaaag     60840
     atctgtaatg ggtctggagc gaagggatgg ggatcacatt cattgcagaa gacacaatcc     60900
     aaaaggggat gacgtaactg atgcaacgaa aatcatttga aataccaaaa gcactggtct     60960
     gggcatcata tctggacgtg cgtcgcaaca aggaagcccc ccggatgcga cgggcagatt     61020
     ttgaaaatct ggaaccgcta tgttcgggaa catggtttcc gccacccgtg ctggaaacgg     61080
     atcccgaagt cgaatggcaa ggagcgcatt ctggggatcc cgtggtgttc cggtgctttg     61140
     agcaccagat catgtctcac atggtcgaaa aacgcactga tgtccacttc cagtatccag     61200
     ctataacgcc agcaccggat ggcacattgt ttcagagcgt catgagctga tttgcctggt     61260
     cggtaaccat atgaatcagc atggaaaatc gggtcaagct tttcttccat gaaaagtttt     61320
     atcgctccct gagcaattcg atcggatact gttgggatgc ctaaatgggt catcctgtac     61380
     tgtcgacgct ggatggaagc gccaatgcag agttgtgaaa atggagaatt aataacccga     61440
     acgcgaggca ctccgcaggg cgggatcatt agtccgctac ttgctaactt gttccttcac     61500
     tatgcatttg atttgtggat ggaaagagaa tatcgggggg taccgtttga gaggtacgct     61560
     gatgatattg tagtacattg ttcacgaatg agtgatgcaa caaggctgaa gaacaggtta     61620
     tcggagtgct tctcggaagt cgggctggtc ctgaatgcag ggaaaacgaa tatcgcctac     61680
     attgacacgt ttaaaaggag aaacgtaacg agtttcacct ttctcggata tgacttcaaa     61740
     gtgcgtacgc tgaagaattt caaaggcgaa ctgtaccgaa agtgcatgcc gggtgcgtca     61800
     aatgcagcaa tgcgcaaaat aacagaaaca atcaagaagt tgaaccgccc cggaaatcct     61860
     ggagactaaa ctccctgaga aagaggtaaa caggatgact aaaaatactc gtttttcccc     61920
     cgaagtccgt cagcgggcga ttcgtatggt tctggaaagt caggatgaat atgactcaca     61980
     gtgggcggca atttgttcca ttgccccaaa gattggctgt acgccggaga ctctgcgtgt     62040
     ctgggttcgc cagcatgagc gggataccgg gggcggtgat ggtgggctca ccagcgcgga     62100
     acgtcagcgt ctgaaagagc tggaacgtga aaatcgtgaa ctgcgccgca gtaacgatat     62160
     ccttcgccag gcttccgctt attttgcgaa ggcggagttc gaccgcctct ggaaaaaatg     62220
     atgccactgc tggataagct gcgtgagcag tacggggtcg gaccggtatg cagcgaactg     62280
     catattgccc cgtcaacgta ttaccattgt cagcaacagc gacatcatcc ggataaacgc     62340
     agtgcccgtg cgcagcacga cgactggctg aagagagaga tacagcgcgt atacgatgaa     62400
     aatcatcagg tgtacggtgt gcgtaaagtc tggcgtcagt tgttacggga aggaatcagg     62460
     gtggccagat gtacagtggc acgtctcatg gcggttatgg gacttgccgg tgttctccgg     62520
     ggtaaaaagg tccgtacgac catcagccgg aaagccgttg ccgcaggcga ccgcgtaaac     62580
     cgtcagttcg tggcagaacg acctgaccag ctgtgggtgg ctgattttac ttacggtgtg     62640
     cccggagttc agggcgggca tggatgctta aatgaaccgc gagtctgtct ggaatattga     62700
     accggtaact cacgatgaga aacccaacaa tcccaccggg tgtgacggtg gagaacctga     62760
     gcggcagtga cctgcggcat gcccgcaggg tgatgtaacc cgctgacaac ggggattgag     62820
     gcgagatcac taagccgaga tgatcctcaa ggttaagtac tgaaaggctg aagaacatga     62880
     acccgttaat ccgcctctgt gggttgaaaa cgtcaccacg gcctacgtga tctgacaggc     62940
     cgtgcaggag gaactggcag taatacgtaa gcactgccgg tcgaaggtgt tttgacatgt     63000
     atgcgaaaca ccggggcagc agcgtctatc acgcttgcgt tgctgacttc tgccaacttg     63060
     cggcaagcaa ggataaagag tgcgacgggc agcctcctca gtatgcctga gtccaggcag     63120
     gtaaaccggg gaaggtcagc gacggatgtt aagggggcat ggctccgatg acgcgctggc     63180
     tggcggagct tccgtagtag tccgcgatgg ggaaagccca ttacatggcg aagggaagca     63240
     gtttgaatgt gtttgcgacg tgaattaact gacctaacga ggtgaagacc tttgataatc     63300
     agcgaaatgc aacgcaagct tgccacatgg gcagtcaccg atccgtccct acggattcaa     63360
     cggctgctgc gtctgataac acaaccagaa tggctggctg aagcggcgcg gatcacgctt     63420
     tcatcaaagg gggcccatac ccccggcgtt gatggcgtga acaaaacaat gctacaggcc     63480
     agactggctg ttgagctgca aatcctcagg gatgaattac tctcaggcca ctaccagccc     63540
     ttgcccgcca gacgggttta catccctaaa agcaacggca aactgcgacc actgggtatc     63600
     cccgcgttgc gggatcgtat tgttcagcgg gccatgctga tggcgatgga gccgatatgg     63660
     gagagtgatt ttcatacact ctcatatggc ttccggcctg agcgcagtgt ccaccacgct     63720
     atccgcacgg tgaaattaca gctcacagac tgtggtgaaa cccggggacg ctgggtgatt     63780
     gaaggcgacc tgtccagtta cttcgacacc gtacatcatc gactgctgat gaaggctgta     63840
     cgccgcagga tcagtgacgc acgtttcatg actctgctgt ggaaaaccat caaggcggga     63900
     catatcgatg tcggtctctt tcgggcggcc agtgaaggtg tgccacaggg cggtgttata     63960
     tcgccgctat tatcgaacat catgctgaat gagttcgatc aatacctgca tgagcgctac     64020
     ctgagcggga aagccagaaa agatcggtgg tactggaata acagtatcca acggggccga     64080
     agtacggcgg tcagagaaaa ctggcagtgg aaacccgcgg tggcgtactg ccgctatgcc     64140
     gatgattttg tcctcatcgt caaaggcacc aaagcacagg cggaagccat cagggaggag     64200
     tgtcggggtg tgctcgaagg cagtctgaaa ctcaggctga acatggataa gactaaaatc     64260
     acccatgtta atgacggctt tatctttctg gggcacagga tcattcgcaa acgcagtcgt     64320
     tatggcgaga tgcgagtggt ctcaacgatc ccgcaggaga aagccagaaa cttcgccgca     64380
     tcgctgacag cactgttatc aggcaactac agtgaaagca aagtcgatat ggctgaacaa     64440
     ctcaaccgaa aactgaaagg ctgggccatg ttctatcagt tcgttgattt taaggccaaa     64500
     gtcttcagtt atatcgaccg tgtcgtgttc tggaagctgg ctcactggct ggcccgcaaa     64560
     taccgtacag gtatcgcttc cctgatgagg tggtggtgta aatcaccgaa accgggtcag     64620
     agcaaaacgt gggttttatt tggtaaaacc aatcacggca agctcagcgg cgaaatactg     64680
     taccggttgg tggggcaagg caagaagctg ttccgctggc ggctacccga aggtaatccc     64740
     tatctgagga cggagaccag aaacacgtat acatcgcgct ttacagaagt ggcaatggcg     64800
     ttcgccagca tttaaatgga gagccggatg cgctgaaagg tgcacgtccg gttcggggag     64860
     gagaggcagg gaaatagtcc gactacgccc tgcctcttac tctactcagc acatggcagg     64920
     gcttcgtcta tgtggcgttt atcattgatg tgtttgccgg atacatcgtg gggtggcggg     64980
     tctcatcgtc tatggaaacg acattcgtgc tggatgcgct ggagcaggcg ttatgggccc     65040
     gtcgaccgtc tggcaccatc catcacagcg ataaaggctc tcagtatgtg tcactggcct     65100
     atacggagcg actaaaagaa gccggattac tggcatcaac agggagtaca ggcgactcgt     65160
     atgacaacgc gatggctgag agcatcaatg gtctttacaa agcggaggta atacaccgta     65220
     agagctggaa aaaccgtgca gaagtggaac tggccacact aacgtgggtg gactggtata     65280
     acaatcgacg attgctggga aggctgggcc atactcctcc ggcagaagca gaaaaagctt     65340
     attatgcttc catcggaaac gatgatctgg cagcctgagt tcacagataa aacactctcc     65400
     aggaaacccg gggcggttca agtggcgtat acatcgctca acaggtgaga gtttgctgga     65460
     ttttgcgagg cgctacaatg cgatagtgag aggctggatc gggtactacg gaaagttctg     65520
     gtccagaaat ttcaactatc gactgtggag tgcaatgcag tcacgtctgc tcaagtggat     65580
     gcagtctaaa tacagacttt cgaaccggaa gactcagcga aagctgacgc tggtaaggaa     65640
     ggagtatccg aagctatttg tcctctggta tttactgcgt gcatcgaatg agtggtcaag     65700
     agccgtatga cgcgagagtg tcacgtacga ttccgtgagc agccggggag tgaaattctc     65760
     tccggctgat tcgactcgcg ggttccggca gcggtggcga acatgcggcg gtgttgtact     65820
     cgctgatcgg cacatgccgt ctgaacaatg tggagccaga aaaatggctg cgttacgtca     65880
     ttgagcatat ctaggactgg ccggcaaacc gggggcgtga tctactgcct tggaaagttg     65940
     atctgagctc tcagtaaata tcaatacggt tctgacgagc cgcttacgca acagctgaaa     66000
     aaggttcatt attttatgga aaccgtgagc ccattccccg gtgataaata tgggctggta     66060
     aaagagtagc ggtattagat gtagctatct aagaaaaata tcataaatat gtcttaattt     66120
     aggcatatgt gaaaccccaa aagtgcacat ttagctaaca cttgtcattt ttttctttaa     66180
     aatatcactt tcccttacat ctgagtgatt tattaacttg ctaattggat gatttttgag     66240
     ttgtgttttt tatttcaatc tactgtttat agagagtata tccttagaat aaaggatagt     66300
     ttttttgtaa actcacaaaa acaatataag tataaaatat actgatgagt gactgttttg     66360
     cattcaataa aacatataac tatatatttt gattttttct ttttgagttt cgattaatga     66420
     acgcttcaca aaacattgct ctatctatgc accactttat attatcaggc actttacaca     66480
     aaagtgatgc ttgcttccat agttcaaagg cagaaatcat atctgttttt ctttctgcta     66540
     aagcagcttc ttgagataaa gagtgaaaag attcttttac cataaaagta cattacttaa     66600
     gcaggtatat tagattttgg tagtatacaa tacgaatatc ccgtcaagat gataaaaaaa     66660
     tggagggtta agaaagtctg ggtgcggaag ggagggttaa aaaaatatcg ctttgtttgc     66720
     aggtggggag gcaagattac aaagacagat taagcaagaa aatcaagcca cctaattttt     66780
     atggatagcg agatggactt taaatataca gaagaaaaag agttaataaa aataaataat     66840
     gtaatgattc ataagtatac tatactatat tatatacatc gaattgtatt ttgaatatat     66900
     cttttggtga agataagatt acatgtttca ataacaggct tgtgtttctt gagagagggg     66960
     ttaatatctc tgtgagaatc caaaaacaaa atttaacaga aaaaccatat gtcgcattca     67020
     gattgaatga aaatgtgctt agacatttaa aaaacacgtt aatgataata tatggaatgt     67080
     caaaaataga ctcctgtgag tgtaggggag tatcgagaaa aataatgaca actgaagtag     67140
     ataaaatgtt attggatgtg ttaaaagaga tgaaggggca tcataatgat gattcatctt     67200
     ttatatctgc actaatatat ctaattgttg aataaatcga actgttgctg agttgaagga     67260
     tcagacacac atcccctgac aacacaggca ttcctgtggc aaagcagcag ttcagaatca     67320
     ccaattggca cagggcaggt atgagtcagc aaccccttca tcacgggaac cctcagcgct     67380
     attctgacct cgctatcacc actgttctgg tgattgatta catcgggctg aaagttttcg     67440
     gtgacggtga gtggaaagtc aaaaaacatg gcaaagaacg gcgtcgtact tggcggaagc     67500
     ctacgatggt caggttactg aggcactggc tatcgcgccc tgaacaaaat gacgaaggcg     67560
     ggtatgccag aaagcgtgca aatttcctga aaacccaact ggatacagag cgtctcacct     67620
     gaaactgggt gatgcctcta attggttgaa ttgaagtata atgctcgctt ttgaggtttt     67680
     ctcatggcca tcgttactgt ccattgtccc cgttgtcagt ctgctcaggt ttaccgccat     67740
     ggtcagaacc ctaaaggccg tgctcggttt cgctgccgtg actgccatcg tgtatttctg     67800
     ctcacctaca cctatgaagc ccgtaagccc ggcgtcaaag agcaaatcac cgaaatggcg     67860
     ttcaacggag caggtgtccg cgatacctca aggacactca aaattggaat aaataccgtc     67920
     atccgcactt taaaaaactc gcgccaaaga gaataacgtc ctctccggtc gctcatgcag     67980
     atgtcgcgct catctgcgag cccgatgaac agtggagctt tgtcggcagc aaggcccgac     68040
     agcactggct ctggtatgcc tacaacacca aaacagttat acgttcggtc cacgaacgga     68100
     tgaaacctgt cgtgagctgc tggctctgct caccccgttt aatatcggca tgataacgag     68160
     cgactactgg ggaagttatg ccagagaagt cgtgaaggaa aagcatctga ccggtaaact     68220
     attcactcag cgcattgagc gtaacaatct gacgctgaga acccgcatca agcgtctggc     68280
     ccgcaaaaca atctgctttt cacgctcaat tgagctacat gaaaaggtta tcagggcctt     68340
     aattgaaaaa tacatgttct actaattgga agcatcacct gaaactgact tatccaacaa     68400
     agcaacttaa tattatatat acaaaaccct ctaaaaatta gaataattaa aacttctatc     68460
     aaattcaatt ccaatgatga atgaaaattt tcttacgttt aatggcatta tgcaacataa     68520
     gaaggaagtc aataaagtat ttcgataaaa acatcaacca gcactccggt tttatgtaag     68580
     ttattatttt ttttagctcc gagagaagtg cgggtgtttt aaaatccgtg agatagtaat     68640
     acatctgtaa atgtaaggga atacaaatga aaagaattat actttctctt tctgtaattt     68700
     tttgttctca ttctgcttta gcaggcagca ctgattggca gccatcagta gggccaggac     68760
     aacgtatagt atatgcagaa attggtgaga caggaggata taaatggaat aatcagaatg     68820
     aatgtaacga agttgtgcgc agaggatatg caataggagt aggtgtctcg ggtaaagtta     68880
     tatatgaagg aaataagccg gggtataatg gggattcaat tagctattca ggtatcgtca     68940
     ccccttacag ggattataag cgacaagcac ctgccgttta taacggaaag aaaaaagtgg     69000
     cccatggcga tagttatacg tactgggcaa agtagtaatc agaaataaaa tctcactata     69060
     gttaagtata gcgcaaaagc aatgttatgc taccttgtga tttcaagatg gcatatttat     69120
     aaaaatgatt taaaaacatt atcccgatga taaatagtgg acacgtttaa tgattctgcc     69180
     ctcgtaatat aggatgacca tttttgttat tctccacaac gagttagttc ttcttttcgg     69240
     atccggcact tctgggggga aatccagcga tggctggatt atgtcgtcaa ttaaaaatgc     69300
     ggcgagtaga ttagcaaata tccactcttt cgcgagttca ggatcctttg cacgcaaagc     69360
     atccaagtgc agcaaacttt tgagccgctt aaaagccagt tcaatttgcc atcgcagacg     69420
     gtaacaatca gccacttgct ctgctgaata ttcatcttcc gataatgatg ttagcaatag     69480
     cacatggccc gctgctttca gcggttccgc ctgaactact cgtccttttc gaggattctc     69540
     gctgagcagt cgggttttac tgattaatgc tttttcggga ggaagtgatc cggcaatgag     69600
     acgtgccgga aagggatctc cggctttttt attacctgaa ttgcctatca ttacagtggt     69660
     ttcaccgttc ttaccgcaat ccagcccgca cagaaacccc atcatgtcaa agcgcattac     69720
     ttctgcagtt aaccagcgca atcctcgcca gtgaacccgg acgatataat cagcttctcc     69780
     aaaagcaagt gagcggatac attcgggacg cgaaccgaat ccccggtcag caatgtgtat     69840
     ctcatctgcc gtttgcgcaa atcgatccag ccgttcagcg tctctgccgt cggttagctc     69900
     aaaatcagta aactgacagg tatgaggatc atatcccata tgtagtcgcc attcagcgct     69960
     gccgcccccg ggctcgctga ttgctgttcc atcgacaaga cgcaatccct ttccgcttgt     70020
     acaacccgta actgcggcgc gtacagcaag tgtttgtgcg gcaagtgtgc caaaccagtc     70080
     ggcggcattc tgcagccgct tcaggagagc cacgtcagat aatgttgcaa cgtcatggag     70140
     ctgagcccat gcagtgactt cacgtaatga catccccccg gggccgtaag ccagccccag     70200
     acgtagcaga gttgcagcct cacgaatttc gcggcggcgg gttagagctc cggcattacg     70260
     tgccgaagta tccagttctt cgggcttacc aatatgggcc agaattgctg accagttatc     70320
     gtgagagtaa ttcatcagca cgttaaatca tatcagacgt aataccacaa cccttaagtt     70380
     atcgcttatg ggtaggtcca cccggctgat aagggctttg ttaatacgat atatagaaag     70440
     agccgtagat tctctaaatc gcaaaagggg cccgctaaat gagcagctaa tttttcatct     70500
     atccccgttg gcaaaaaaat ctcaagcttg gataggggtg agtagggaga gaggaagaat     70560
     ttctgtggta aaaatttttt gccatgtgat ttaatgccgt aacaatccaa aaagtcagtt     70620
     atttattttt taaatgtaac aaatattatt ttatgggtaa tccaactcct ttctttccgg     70680
     cctaaagtca agatctttat cttcgattgg cagatagtac tcgaaatatc tgtatccatg     70740
     aacatctata gagattattt ccaagtcaag ggtgtttctc ttttgcaatc cataaaaagg     70800
     caacacatta agataaatac tatttatgta agtagaataa ccatctggat tgcctgcata     70860
     tctaaataga gcataaacac cgccctccat taaatactca gcatctaagt cttttttctt     70920
     ccatattata gaatttatga caaactcgtt tttattgcta ttcccttgcg ttattttgtt     70980
     tgatataaac aaagtgtttt ctctttgtga aaatagagac tgtacaacac cccgttttat     71040
     ttttgagcta gtagatgtat atggtatttt ttctttatat tttataatgg ttccagcaaa     71100
     cattttccgt ggaagataac ataattcagg tattggaaat ggagtttcta tatctctgtg     71160
     gcctatttga tttttaaaca accatgcttc atctcttctg aactgcaatg gactatagcc     71220
     agagtttttc ttaaactctc gagaaaaagt ttgttgagaa tcatagcaaa gcttttcaga     71280
     aattatagct atcggaagat ttgttaaccg taaatagatg gctgcccgag ttactctccg     71340
     tctttggata tatttaccaa tagacagccc aatgatttct ttgaaaagta attgtagata     71400
     tcttctacta taccctgaat atttaaccag aacatttata ttaataggga aaacttcaat     71460
     gttttcatca atatatttca atatcgaatt tattgttgct tcttttatca tcactcatcc     71520
     cttaaactta cattagtacg gcattcaaat agctgcgcag aatagtaacc ccctttgagg     71580
     gaactcagct cggattgtgc gagctgagca atcgagaaac atcccaaatc accaaccgga     71640
     ctgacgatgc cgataatagc actaataccc ggcacaaaac gatgcatgat gcaaaaaatg     71700
     atccataaaa cgcgcgataa catcatacct acagactgac tgcgatgctg atgttgcact     71760
     agagtgatct tactaccaat cccgttatca aacacaaagc cggtttgctc aatctggctg     71820
     aagaactcag caacgtatca aaagcctgta aaatcatggg cgtttcgcgt gatacgtttt     71880
     atcgttaccg agaactggcc gatgaaggcg gtgtggatgc gctgattaat cgtagtcgcc     71940
     gcgctcctaa ccttaagaac cgtaccgatg aggcaactga acaggctgtt gttgattacg     72000
     ccgtcgcttg cagaatataa atattaagta aatggcaacc acaggaactg atataacgaa     72060
     acagaataat tcaaatattg cagttaagct tccaccaact ggatttgtaa agaagtcttt     72120
     ttgccagaat tctttccctg taaaccttat taccattttc tgtattattc tcattgaaaa     72180
     aggaaaagta atggcgctga taatgcatcc gatgaacgca taaaacattc ttgcattttc     72240
     ctggttatct ttccatccca gataaaaaac tgtaagaata atgaggcttg gtatcaggct     72300
     cttcagtaaa tactttacag atatatccag tttcatctgg tttctccttt attgttatcg     72360
     tgtatcggtg cgtgataaca taatcatagc atgataataa taatcaataa caataagctg     72420
     tgtcacgttt acatcatgga acggaggtgc tcctgtgacc tttgagcaga aaaaagcccg     72480
     ggccattgcc ctgatggaca gcaaaaagat gtggcggagc aattatgccc ctcctcttct     72540
     gcgtattctc tggcggctgg gtatccggct tccgccatta ccctttatgg cgttctggca     72600
     ggtcacggtg ctgacggggg gcttatgggg catttcctgg ggatgtgcaa tgtggtttat     72660
     ctactgggtg ccgtcaggaa tggtggcagg tgaagccatt attataagta tcacgggtgg     72720
     ttttttgtcc ggactgtgca tggcctcttt ccactggtgg cgcaggaaag ttaacctgct     72780
     gccaccatgg gatgatgtgt aaatcgtgca ggcatgtttt tacggggtga tgctttcatt     72840
     aacctgcaca cgaacctcca ttccggcatc gtgacaggcc tgcagccact gcgccacttc     72900
     cagcggatcg ccctcccggc gtaccaccct gccttcttta ttccataact gcaggcaggt     72960
     gctgccgtcg agacgcacca caaaatcccc acggcaggcc tgatacgtta tgccgttcag     73020
     ctccaccgcc agatcagtgg cagaagtgcc gtctgcgggc agacctgctg ccgggaccag     73080
     cggcagtacg acgacttctg ccgtacgctg ttctgcccgg aggcggtcct gttctgcccg     73140
     cagcagtggc tgtgccacgg cccggccggc gtccatcagc tccactgcca gctgcaggtt     73200
     cagagcgcgc agggtacgta gccagccggc atcctccaga cgacggcagg aggcgcgcag     73260
     gtttggcccg tataccgggg cttccccgct tcgctccagc acccgttcta tgtcccgcgt     73320
     cagcacggag cccggccgtt ttttatcaag ggcagccagc ggcggtagcc agcatctcag     73380
     ctatggagaa cggaacgcct ttgcgattgt gttattcatg tatgaatgcc tgtcaaaaaa     73440
     cccgggactg attatccttg atgatcccat atcctctttt gataaaaaca agaagtttgc     73500
     cattcttgaa atgctgttca gacgtgcaag tggtgaatgc ctgaagaacc ggactgtact     73560
     tatgctgacg catgacgtgg agcctgtgat tgacacgctg aagtcagtca gaaggttgtt     73620
     cagtaatcag gtgaccgcct cctgcctgcg cctgtctgct ggagtcatag aagaattacc     73680
     tgttaacgac ggcgatatca tgacattcat gcagatctgc aaatccatca ccgcgtcagc     73740
     agactgtgag gagatcatta agctcatcta tcttcgtcgc tactttgaaa tcgttgacga     73800
     acgtggtgat gcttatcagc ttctatccaa tctattccat cgacgcgtcg ccccgctgga     73860
     ttatcgcgag cctgccgctg cgggctcggg ctaccccaaa atggttcctg agaaaattca     73920
     ccaggccttg cgggatatcc gggagtatgt ggacagtttt gattacccgc gacttcaggc     73980
     tctcgtcagc agcccagatg aaataaaaaa cctgtaccgt cgctgtcgta acggctatga     74040
     aaaactgcag gtattccgtt tactggaact ggatcaggac catccggtaa tacgaaaatt     74100
     cgttaacgaa acgtaccaca ttgaaaatga gttcatctgt caactagatc cgtccagatt     74160
     cgatctcatc ccggagtatg tgattatgga atgtgacaag ctcatcgccc tgccaccggc     74220
     agcaaaccag agctcggttg cccgtatcgc ttgagccact gtttttgccg ccggaagata     74280
     ggctttagct ccctgatagt ctgatcttcg aagataccct acagtttagg accgcttact     74340
     gtagatatct gttaaaacag cccgtatacg ggctgtttct tggtgccctt atctcctgac     74400
     tttgaaaaga gtgtcttact tcacccagtc ttccagcacc aggtcaggca cccgctcaaa     74460
     ttctcttgta ttattcgtta ccagtatcgc cccggcggcg atggcgtgcc cggcaatcgc     74520
     cgtgtcgttc gggccgatcg gcgtcccggc cagccgcagt gccactttaa ccttcgtggt     74580
     ggcgtctact gcggcgcgat cccagggcag gatggcatcg aggcgggcgc agaattcatc     74640
     gaccagttgg acgtgacgtg gtgaggcctt tgggccggta gccccgaagc gcatttcaga     74700
     gtaggtgatg gccgagacca ctatacggtg gccgcgtagc accgcctgct ccagacgctt     74760
     caggacggct tctggctgtt cacgcatgat gaacgagcag atacaggtat caagcatata     74820
     agtcttgttc acaggttaaa tcgcccttcg tcgctgacaa catcctcgcg ctccgccata     74880
     aaatctggat cggctttttc gtactctagg aatgatcccc aggttggccg gacggggcgc     74940
     aggatgatgc tgtccccttc ccggacgatc tcgagctcgc tcaccccctc aaaatccaga     75000
     tcacgaggca gacggatggc gcggttgttg ccatttttaa atatcgatac ggttctcatg     75060
     ttctttctct cccgagcata tggatatgtg aaacatatcc ggaatattca aagcaccggg     75120
     tgtgtgcata tgtttagtat aggcagatgt gtggcatatg tatagcggta gcatatgtag     75180
     atgccaggca tatgtttagc atatctctat ttctttcttt tttatcggag atccgaaaaa     75240
     aggttgtcac ggatcttcct ctcccccaca caacgccacc tcctgttagc acaacatgta     75300
     gtgctgcgct cagttgctta tgacactata tgttgtgtca tctccctggc ctgtgatgcg     75360
     ccgcgcaggg gcggaaaaca gcgatatgat tatttcctcg gcgtggtaca cttccggaaa     75420
     gttgtgatat tccggaaagt cggatctgac ggaaacggct ctccggtaat ttaacggcgt     75480
     ggttatatgg atgcttgtta tcatggtgat gatgataacg gcatgatgtt atcagacggc     75540
     gtgacggtaa gggcagtgat gatggatgac gttatcgcat gaccgtccct gcccggaaaa     75600
     gaaaaaagga gtcacccatg ttttttattg agaatgaagg tcaggctgtc gccagaacgg     75660
     attactggca gtctgtacag gcgcaggccg gatatgtcta cctcagctgg aatgccggcg     75720
     cagccaggct gcttgtcccg gatgcggcaa aacatttact cagggagatg cggggggctg     75780
     agtacgtcat catcagtaag ggaacgctgc atggccgcga tgcgctggaa ctggtatttg     75840
     aagacggcag cgatgcgccg tttgtgatcc acatgctgag tgagcagtgc gatcgcctgc     75900
     tccccgaaaa caaccaggga gggggttttg ttgtcaccgt ctggacgcgt ggcggtaacc     75960
     agctccgtta tccgggaaag taccgtgttg tggaaaacct gcccgacgtt tccccgtgga     76020
     gtgaacactg atatgcagca cctgccggca ccgatccacc atgcccggga tgtcgctcag     76080
     cttcctgttg ccatcgatta tccggcagcg ctggcactcc gccagatgtc gatggttcat     76140
     gatgaactgc caaaatacct gctggcccct gaagtgagcg ccctgctcca ttacgtcccg     76200
     gatctgcgcc gcaagatgct gctggccaca ctgtggaaca ccggtgcgcg cattaatgaa     76260
     gcactggcgc tgacgcgggg ggatttttcg cttgcgcccc cgtatccgtt tgtgcagctg     76320
     gccactctga agcagcggac agaaaaagcc gccaggacgg caggaagaat gcccgccggt     76380
     cagcagactc accggctggt tccgctttcc gacacctggt acgtcagcca gctgcagacg     76440
     atggtggcca cactgaaaat ccccatggaa cggcgtaata aacgaacagg caggacagag     76500
     aaagcgcgga tctgggaagt gacggacaga acggtcagga cctggattgg ggaggcggtt     76560
     gccgccgctg ccgctgatgg tgtgacgttc tctgtcccgg tcacgccaca tacgttccgc     76620
     cattcctatg cgatgcacat gctgtatgcc ggtataccgc tgaaggtcct gcagagcctg     76680
     atggggcata agtccatcag ctcaacggag gtctacacga aggtgtttgc actggatgtc     76740
     gcggcgcgcc atcgtgtgca gttcgccatg ccggaagccg atgcggtagc gctgataaaa     76800
     caacttgaga ggcgttaaaa agccgtattc gcggttcagt caagggggag ctggtgcatc     76860
     catctgtgga agatagagca ccaaactcat agaggccacg ttctcaggcc agaacagtct     76920
     tatatctctg gcgctgacaa cccatagtac ttgcctggat gggaaactct tcttgtgctg     76980
     agcgtaagag ccatctgccg gaacgcttcc tcgccagttc gctcgctacg cacagttaca     77040
     tggctgcggc gagggctgcc tgattctaat aatgatattt cagcatgata gcagcaataa     77100
     aatagattgc agctatcatg ctgtacacat acggcctagc gctctgctta tgttatgctg     77160
     tctgcaatct tgcggcaatc ttgcttcatc tgtcgatgcg attctgaatg aggtttcttt     77220
     tattgttaac gtgacacaag tattcggctg tcaattccag cactctgcta agtagcaaga     77280
     tttaatcttg ctactagatt ttttattgtt gcaatcttgc tgcaagctgt tatcttgttc     77340
     tggaagagtt actctaccta acctcaatct ggtttatatt tatgtttgct gcaagatagc     77400
     agcaagtaaa gggggctaaa tggcctggat agttggtttt atttctcaga aaggtggtgt     77460
     gggcaaaagc actaaagcga gagcgttagc gcgtgaagca tccgcctgtg gtatcaaaac     77520
     aaaattagct gatctcgact tggaacaggc aacgagtgct gagtggcatc gtagacgtct     77580
     gtcagctggt ttgtcaccgg ttgcttcagt tgaagtgttt tcaacagcaa agcaggcgat     77640
     agaatctgcc ggcgattttg accttctgat tcttgatggc cctgctcgtg caagtaaagg     77700
     tacttcagaa attgctaagg tcgccgacct tatcgtccag ccaacggggg cctcccttga     77760
     cgatcttgtc ccggcaatta aagttttcaa cgcgttggta aaagaaggta taccacgttc     77820
     aaaactggtc ttcgctttaa gccgggtagg taccgaagcg gaagagctgg atgctcgtgc     77880
     atatatcagt gaagcaggtt atgaaacttt atctggatgt ctttttgaga agccagcata     77940
     cagaaaagcg atgaattcag gactcgctgt gacagaaaca cgttataaag gtttaaacga     78000
     gagagctgat gaacttatcc aggcactcat cgataagatt ggagaagagt aatggctgat     78060
     gcgtcaaaac ttagaactaa aagaacccgt agtgggttgg gggtaccccc gggccccgac     78120
     gaagtggcta ccagcttgaa tgcgcctgag atagctccgg ctgtcgctgc cactgatgtt     78180
     cagagacaac aggcagactc atcgccagtg caccatgagc ctgtggttac gcaaactgtg     78240
     accgaggtat atacccgccg cgatggccgt tctgccagaa aaacaaacag gacgctggca     78300
     tttgcaacac gtgtcacacc tgctttcgac caagagatcc gggatatcgc agagcgtgag     78360
     gggttgaaac tggtggaagt tctggaaaaa gcagttgagg catataagga aaaacagggc     78420
     tattaatccg ggatgcagca atcttgctgc attctttttt tgtgtgcaat cttgcagcaa     78480
     gatttatgct agataaatgc tagattgctg caagataaat gatataatgc tcaaattgag     78540
     tagttaactg ccccagtgaa gtacgcagct tgagtactta cctgtggttt atgaacgtat     78600
     ttacttaatg tgagtagtta ttgggtgaag attaatactc aaattgagta taaatggaga     78660
     tggtatgaga attttttgcg atgatggttc tacaaatgtg aaacttgcct ggtttgaagg     78720
     caagacgctg aaaagtgcgg tatcagtgaa ctcttttcgc cataactgga aagtcgaggg     78780
     cttaggcagc agtcgtacct ataactattt gcttgatggc cgtaaatata cctacgaccc     78840
     ggtcagcgaa gatgcgatca gcacgactca tattgagtat cagtactctg atacaaatgt     78900
     gttggcagtt caccacgcat tactgaacag tggaattgaa ccccaggaga tcgatctcac     78960
     cgttacgtta cctatcagcg agttttacac ggccgactgc cagaaaaata cgcttaacat     79020
     tgagagaaaa attcgcaacc tgatgcggga agtcaccctg aacaaagggg gaacttttac     79080
     cattaaaagc gttgaagtga tgcctgaatc actcccggct gtatttactc gcctagttgc     79140
     tgacaatgtt ggtcagtacg aaaaatcatt ggttatcgat ctcggtggta caactctgga     79200
     tgtcggggtt attgttggcc agtttgagga tgtttcggct gtacatggta atcctgatat     79260
     tggtgtatca atggtcacga aagccacgct cactgcactg aaaatggcca gcagtgatac     79320
     cagtccaatg attgctgacg agttgatcaa aaacaggaag aacctggatt ttgtggggca     79380
     ggttgtaaat gaggtttcta aactaaatct ggtgctggat accattgata cagcgataaa     79440
     taaactgggc gagctagttg ttgatgattt gctgcagtat cgaaacgtaa accgcgtata     79500
     tattgtcggt ggcggggctg cactcattgc tgatgctgtt cgtaaggcat ggaaccacct     79560
     tggcgaaaag gtggttctta tggatgaacc tcagacagcg ctggtccagg ctattgcacg     79620
     cttcaaagcg gaggagtaat cgatgtacga cggcgaagaa aggaaaaaac tttcactcta     79680
     ccttcacccg gaggactctg ccgattgtct tgcactggct gaaatcgaaa ctgttccccg     79740
     gaaaaaacgg ggggagttat atcggcaggc tttgataacc ggcctgataa tgcatcagct     79800
     tgatgagcga attcccgccg tgttaaccgc gctattcacc agagaactga atgcggatga     79860
     ggtcattagt cagattgcca ggataacagg ctggaaaccc tcctccggtg atttaaaaga     79920
     ggtactgaag gcgttgggag ggcttcagag tacagtttca ccagaacact ctcaggatga     79980
     cggtgaacag gcccgtctga aagcggccag ggtgaagatg caaaacctaa tctaaaaaag     80040
     tctcgctccg tgaaacctgc aaaatttctc ggggtgtgcg gcttaatttt tagatttccg     80100
     cgtttcccgt catttgagtc aatggagtgc tggttgacag ctccctgctc tgaaggacgg     80160
     ggattcccac atatgcagcc agatttccgg gtagtgtggt ttcagacgtt gttcgatttc     80220
     attctgtagc gcctgaagtg tgcctgattt gaggtttttt gtgctctggc ggtcgaaaag     80280
     aatttcaatg cggatcatgt tctcatctcc cttttatttt gctgtatgca tatacagtat     80340
     tctaataact gaatccacac acagtcaaat gtcattattg tgactaaaaa acgctcaatt     80400
     ctctgagagt gtggctgtat gcctgctgtg gatggctgtg tccagcttat ccacagcatt     80460
     ttgtgcacgg ttctgtggac aaaatacctg gttacccagg ccgtgccggc acgttaaccg     80520
     ggctgcatcc gatgcaagtg tgtcgctgtc gccggcctcc tcacccggtc acgtttcgtc     80580
     gttcctcctc cacgcgctgc ggcttcgggg ccgcacctgc attcgtatgc ggtcgcccgg     80640
     ttacaggtgc ggcacggcct gatggaggcc gcatgtgaga ggagaattcc catgccaaac     80700
     tggtgctcaa atcgtatgca tttttctggt gaaccggcac agattgctga gattaaacga     80760
     ctggccagcg gttcagtcac accgttttat cgccgcgcca caaatgaagg tattcagctg     80820
     tttctggccg gaagtgccgg acttctgcag accactgaag atgtgcagtt tgaaccgtgc     80880
     cccggactga cggctgccgg acgtggtgtt gtatcgccgg agaatgcggg gcatggcctt     80940
     gtgggttttc agctctgtgg cctcagcgtc gtgtgcgggc tgtgccgtgc ctccatctta     81000
     gccgggctgg cagggatgca agggtacgct tcgccgctgc ggtcacccgg tccctccttc     81060
     ccgtctgccg tgattttccg gtcgttcgtc cgctcaggtt tcgcggcctc accctgcaac     81120
     tcccgtcagc cgtgtgcgtc aggctgcggc ttcccttgcg cccctgcatc cccgccttat     81180
     cgcccggctt ttatggaggc acggcaccgc ccggtgtcgc agaacatgtg actattggtg     81240
     atggtgttga tgaggaacat gtcgatgcct actgttgccc ctttaattaa gctccagcac     81300
     caggaagatt gaggcatgtg actgatatgg tcccaccaga ctcataattt ccccaagcat     81360
     aattactcac ataccaaacg ttgttttggt cggaatatac ctgttgaaaa ccaccaaagg     81420
     gtgagccatt caggtaagtc catgagcaat atgcatggac cccgagcctt aaattacgag     81480
     tgtttttagc tatgttgtag gtctgcgttg tgaattgaat tttaggagcg ccccaggtac     81540
     cggattggca cgtaggccag tgccaatccg gtacctggaa atcatcatca gcgtcgatat     81600
     ggacgaatat aaaaacattt acgttatatc ccaaaaacac acaggtctta gggaggttta     81660
     aactgtgtat taacacctat cgtattgacg ggcgtgaaat ggcagaaaca gaagtcgttc     81720
     ctattgacat gcctgactct aacggcgaga tgacttggca agccaaaaac tacacacagt     81780
     attcgtccta ctttatgaag attacttgct tgaaatagct tattggcaaa tggcatatac     81840
     agttattgaa ccattctgat cttcggttgt atcgcacgca gccgaccatg agttattggc     81900
     tgatgggaat gacctggtaa gccatatgta accagttcgt gaggtgcata ttccgccgcc     81960
     acctgtaaca cgttttccag ttggacaagt agctgttgct ccaggaaagc gccaacctgt     82020
     ggcctgtgct gtagcaattt gaagctcacc agatcctacc tttctccagg taccggattg     82080
     gcacgtaggc cagtgccaat ccggtacgtg ggggacaata ggtggaaaac tcaaagttac     82140
     tcagctttcc accacaggtt atctggggca attcgacttc tgtgccattg ccagaatggg     82200
     caacgcagag gatgcccact actgccaggt agttgagagc ccagcaggtt cacgcaaatg     82260
     gtacaaatac gagcataaga caggttgtat tgcgtcgtgt gtaacgctca attaagtttg     82320
     atatccaaat actgaaaata ccccggcacc acatgatgta ttttctgttg gataggatgt     82380
     tatctgatag gaagtacctg caggtacagc aaagctgata aaggctgttt ttccatatgc     82440
     agggttattg ctggcattca cgctaattag cgtcccacca acatatccct gcagtcggga     82500
     tgtatttgca catgcacctc cggcagatcc tccattacct ccagatgcat aaataaacaa     82560
     tgtactgccc cctgaattcc gccctgagaa tgaacctcta tgtgaaccta agtttgtgta     82620
     agaaccattg agcgaaccag aagtcttcca cgtaccggat tggcacgtag gccagcagcg     82680
     ccagcaattt aatctcagtt ctgacacgcg acgacataac tacattttcc ggttaaatca     82740
     gctctaaatg tccctttatg gaaattgtat tcatcataaa aaccacattt aacaattcga     82800
     tttgcatcat aagttgcaac tgatcctgca aagtaattcg gcttccaacc ttgagggttt     82860
     tctgcattgc tcacactcca tgagcactga ctggcagaaa atcctgttgg cagcggtatt     82920
     tgctgaccat ttgctatacg accagttatc accgtactac cagaattgct tttacgccaa     82980
     gtaccggatt ggcacgaaag tattgcccct gtattatcgc ggcctacaag gccgttacct     83040
     gaccgctgaa agtgccattt acaccattca cattgccgct gaaattacct gtctgggcat     83100
     ttactgcccc aacgttattc aggttatttg atcccatatc aatggccgtg tgcattttgt     83160
     ttaagtcagg gcgaccattg acctggaatc tgtaaagacg atcagtgtcc tcagctgcac     83220
     cactaagttc atctgtcgat aacaatacgg caatatgccc gttaccgctt ttggcaccat     83280
     aattacttaa agctactgac caggaacgta atgcacctgt ggctgttttg ccgtcctgga     83340
     tatatccacc aagaccagtg gtaatatcct tagccatctg gataagtgct ttcactggat     83400
     aaggtgtgcc accactggat acaaccattg cctgtagtaa ttccgggttt tgggcgtttc     83460
     gaaccacata tgcctgtaac cgctgcccct cgctgtttgt ctcagtaaac ccgctggaca     83520
     aaaagccggt atttttcagc atggttgtcg tgataacggc aggagttgtt gtggtactac     83580
     tgccctggag agtcgtgtag tttttcccta tataagagcg ggccgcactg gtccagttgc     83640
     tgacaagacg tgcttcagtt tgccatcctt ttgtttgaat atagtcctgc catatgcccg     83700
     ctccccaggc aatcaggagc ataacaatca gtaaagccgc gccagtttcc agcgatgccc     83760
     agcctcggtc atattttttc atcagattac ccatagtggt tgataaagat tatccagcag     83820
     caaaaggaca tggccaaaac atagccatgg acccagaggg ccttctttat gcccttttat     83880
     gcaccatgtt gaatgccata agacaaatcc tcctgtgccc agcaacacac accatatggc     83940
     gttatataac cctgaccatg cggtaatacc tgcaataagc cacaggtctc cagtgccaat     84000
     attaagacga tggcggttaa ctaatttatg aaggcagaat aagacaattg cagcagtggc     84060
     aaattctgtt gtacggaacc accatatatc agtcgtgatt tgtgatagca ttcctgcaat     84120
     taaaaaacgt cgggtgaatg ttcctggtaa taaacctgtc agtgcatccg ttaccgccat     84180
     ttgcagtatg aacgaaagaa taaggacagc atgaatacgg tagagcagtg gtgatgatga     84240
     taaaataatt aacgccacag ctatactgta tagccatatt cctgacagaa cagcagggtg     84300
     tgtcttatac cagagatgtc ccgtatcaga taaaaaataa cgaactctga atagcagagt     84360
     tcgtccaata atggaaaatg tgaacatcaa tggcagtata taaacagggg atagacttat     84420
     gcctacgatt gtctgcattg cctgcctccc tgtccgggaa gacatatccc tttcatgtca     84480
     cgataaattc tccatatttt attggcatat tgctctcttg tttcatgtct gtccttacgg     84540
     aatccggcat tgtatgaccc aaggcaattc cagctgacgc cacatatctg aaaatgtctt     84600
     gccagtatcc agcttcctat atggatatta aggcatggtt tggtaattaa atcctcagac     84660
     ttttttatta cgcccatatt tatcagcttt ggaatatggg ttgagtttat ttgcatcaac     84720
     ccataatccg tgctactggc tttacctgtt tttttgtcct tatttatatt aattgcgccc     84780
     ggcctcaacg aagattcccc ggcagaaata gccttcaata ataatggttc aatttgatag     84840
     cgcgcgccgg cagcggcaaa gcaattgtcc cacttgttgg tccagatctg tttgggagct     84900
     acgtatgaag ctcgggcggg tggaataaga gaaaaaagca ggattaatga aataagtctg     84960
     aggggtactg taccccctga cattaaaact ccttaaccat tgatggtgaa gataagtttg     85020
     tttgtaccag tgctgccatt atctgccttg cattgcgtac tggcttcttc agtagtgact     85080
     tttccatcac tgtgagcagt actgttcagg gtaatgccgt tagttaaacc agttttactg     85140
     attcgtgtgg caatctggat acaggcatcc tgtgggactt tatcataggt aacggtaaaa     85200
     ccgttgttga accctgatgt tgaagccggg gcaacagtta cagcaccgcc ccatgcgtta     85260
     tagagcgttg ctgtaccaga tgttttgtcg ccctgtacgg tcatcccaga gggaatgaca     85320
     cccatctgaa tgagggcacc tgtcattttg gcactgctgg taaatgtata tccatcgcta     85380
     ccttttagca ggctctgggc acttgtgata attgtttgta tatttgcggt ttcagttgcc     85440
     acattggctc ttgtacgcaa cgcatacaaa ctacccagaa caacgactat aacaaaaaga     85500
     acaacgagcg ctattgttcc ctgctccaaa attgcccatc ctttatcatg aggctcattc     85560
     ttcttattat ttccagttaa agtggtatta atattttcta ctaacataaa tatcctcgtt     85620
     ttgtttaaaa gttacccatg ctgttgtcac taatagactg aatatccata atggcaaaaa     85680
     ccagtaacat gagagacatg acaagaaata tcagcataat taaacgaatc acgtttgccc     85740
     gtttctttac acgttgaagt gtttgactaa gccatcgttg accataattg ctgattagct     85800
     ctgttgcgcc atctccctgt aataaagaca ggaagttggc tgcttccctg gatgggaact     85860
     gataaccgca ctgacgcaaa gccagtccaa gatgatcccc ctggcggacg cggtaaataa     85920
     tgctgtcaag acgtgtgctt aaccatggtg atgcaaactc ctgaagaatg tttagcgagt     85980
     tgagcgtcgt cattttggct ttcagaagtg cagccatatt caggagaaat gttgctccct     86040
     gtatatcctg ataaatactc catggcatta tcttgtcggc aaaagtacga acactgtcag     86100
     ggcttttcca gtttggcaga gaccatgata ttaaacctgt gatcactgca aaaagaacgg     86160
     cacatatagc gccgtaatta tcgacaaaaa cagataatcc ataaagaaaa ccaagagcac     86220
     cactccatga atcgggggag cttattttgc tcagttcagg tattagctct gtattcagaa     86280
     catataatgt ccccgtcatc atgattaaca atcccaccgg ataaatagcc atttgccata     86340
     tagcctgatg gatttgttct tttgcatctg taagagtggt ggcgaattgc agtgcatcca     86400
     caattgaacc acttcttatc ccggcgctga ttactgcggc ctcttcctga ggaacccata     86460
     aactaagagt atattccaga gagttttcgc cactgttttc acgaagagac tcaatgcagt     86520
     ctgtggccag ttcagcaaag ggatgccatt ttcgtccaaa gtctgtccag gcatcccgca     86580
     tctgttccag tgcggtcttt aatggctgtt tattttccag cagaaaacgc agggcttcgt     86640
     aaaactgcac cctgtagggg gcgctgaacg tttttctgac aatgaaacgc ctcagccgtt     86700
     gactgaaatt catttcacgc atgttgttct cctgttagac atcatcgatg ctgaggcgct     86760
     cgtcttcgtc cagagggatg attctgtcgg cttcaagagg gtctaccaga ccttcattga     86820
     tacggcgaag aagatgctct acacgactga tgcctttcat gttttccagc cagtatttac     86880
     gtgctgcaac tttgccgcgt gttttcagaa tctgaaataa gcggttatca ggttctatca     86940
     cctcagcaat tacagtcctg ccggtgaggc ctttacctat ttcaccgcgc tttctgccgt     87000
     taatgattac gtcgtgatta cattcagagc atccgtgatg atttcggaac cagatattat     87060
     ctgtactgca gagtgaatct ttattgcagt gccgctcaag gtaatcacgc tcgtcgtcgc     87120
     taagttcagg tgctcgcttt tcccatggaa tacggcagga gggacacaga gttggtacaa     87180
     ggcgctggct gatcatccca atcagtaatt gcgcatcgca aataagatcg gcattcatac     87240
     ccatcgtaat cattcgctcc ggtataccca gagctgagtt tgtatgtaat gtcgtcagaa     87300
     ctatgtgccc ggtctgtgcc gcgtaggtgg ttgacatcat cgagataaga tcgcgcattt     87360
     ccccttccat gatggcatca gggtcaagtc gcattgccga tgaaatagcc cgactccatg     87420
     ccagtttgac ggcatcttcg tcggatttgt cgcagataat cggagtctgt gttgctccca     87480
     gtatctgtcc ttccagcgga tcttcgattg ttagcaggtg tcgcccctga ttatcgtcaa     87540
     gatatacacg gcaggcgctg cgtaacgttg tcgatttacc ggaaccggtt ggacctgaca     87600
     ggactatttt tccttccggg cggcgcagca ttatgttcag caaccggatt tgttccggga     87660
     taaagcccag ttgtttaaac gtgggaactt tatctccgtc atcgggtatc aggcgcataa     87720
     ctgcaatcag accgtctccc gtaggtctgt gactgtagcg tgcaccaaat attcctattt     87780
     ttcgcattaa ttgtggggac aggcgcgcat cctgctccct ttgagggaag aaactggttt     87840
     cagtgacatc agccattgac agaatggctg ttgcgcaaag tgaatagccc agtgctggtt     87900
     gatcttcatc tacagtctgc agttcaccga atattctcat gcgaactttg aaaatagact     87960
     ctgaaattaa gaaatgaata tctgaagcac caagttttct ggcagtttca aaataagata     88020
     gaactttctt ctcactttca ctgacatcag caaggtcttt cagatgaata attcgttctt     88080
     tcgggcctct gtttttctca tcctgacctg cctcctgtaa ctccgacaac gagactactt     88140
     ttgggttgat atccggatat aattttagca gctcctggag attactttgt acgtcaggcc     88200
     ttgtccgctg gtttgtttct ataagaattt catgggtgtc tcccctggat ataaaaagga     88260
     gagcatcctt cagattatat ttatccatat cacgttactc agaaagtaag ggtggtgcca     88320
     tcacttaacg tgacgccaga caatgagatc gacttcactg tgacggatgt gcctggaagc     88380
     tggctgccag tggtgacgct tgtctgacgt ccatcagcca tgcgaagaac ggcattaaga     88440
     cgtttatctt tgccgtttat ttccataata acgggcaatt cctttctgtt tttagatgtc     88500
     ggctgctctg aaactgatgg caaagaggca gtcacaccag agaaacctga aacagtttca     88560
     gatgatgaag taacatctga ttcttcgagt tgtttctgta gctgtgcgcc ctgaactttt     88620
     gcctgtaaaa gaatattccg gttttgttgt gcttcaagtt ctcctattgt gacaagaggt     88680
     tgtgttgttg caaatgaaaa accggagaag aaaaatatgg atggaataat gagtaattta     88740
     cctggacgca taaatatgac cttctgagga ataactgaaa gtaccgccgt ttaattcaaa     88800
     atggatattg ctcagacgaa cgccggtatc ctgaaataaa gggaacaact catcaggatt     88860
     tacaggcgtt gataaactga actgatattc tttccatttc tgaacagggg ctggttcacc     88920
     atcgttacct ggtaatggtt ccggtatggc tatttcatta atggccggcg ttaactgttt     88980
     tttctgaaac cacgtgaaca cccgcatcag ttgttctgag ggggtaggga ctgcctcatc     89040
     cctgcggggc agggaaggca gtggccgggt tacagaagcc aggcgtgcac catctttaag     89100
     gttaaagtca ggaataacat taaagatttc tttgcttctt gccagaaagc cttcaatagt     89160
     tcctcctggc tgtcgttcgt aaatcagtgt gaatgtctcg ggagtacatg ttccaccggt     89220
     aagtttccag ccttctagcg cgaccggtga tggttttcga aggtccgcgc aggctttcag     89280
     aaaatcactg attacaggtt gtgatgccca tggatgcggg agttctggcg gtggatcggg     89340
     ctttttaaac tgcaatcttg cccgtgcagc tatctcctcg ggcgtcggta cgacatccgg     89400
     ctctggctga gtcatccaga atacagtgcc tgcgctggct gctactaaaa aaagtacggc     89460
     aggcagtgtg aatttgctgc gattgccgac agtaagtttg caacggcgga gatctgctga     89520
     tgataaccgg gtaataatac tttcccagtt atcaggatgt tccagaggag atacgacctg     89580
     ccatttttcg gggggctctt cgttcatcgt cagaaaaaga ctgacctttt gagcaacatc     89640
     agcatcattt cctgacagat cagccataac ggcaggctgg ccattaatgg aggcaaggaa     89700
     taaaagctcc ttatcgctgt accggaagac gccgtatcca tttctcaccc atgagcagaa     89760
     agccagagca agggaaaaat aatgattgcg ctccggcctg gccagtattc ctgtgccggt     89820
     aatgcggctg atcttcccac gggaacttct gctgcctaca gtcactttca gagaggtaag     89880
     ccgtctggat tttacatggg gcttgtgttt ctgatgagaa gggactcgct gtttttttac     89940
     gacaggactc catttaagac aggctgccca cacgcgatga tttactttag gatctgcgag     90000
     aagtacaacc gggttgatat cttcatcagc cattgttgcc tcctgacggg aaagtcgggg     90060
     taatgatgat tacaagcgtg ctgcgttcat ttttcccggt ttgtgaacca ccaaataatg     90120
     gatttgctgg cgtaaacgta ccggctttac ttgtcgtcgt attgttctga tcgaaaccag     90180
     taacgacaag tgattgccct tctttcagat tgaccttctg gctcagtgaa cgcagtttgg     90240
     tatacggcat ttcgatgtaa ctgtttccgt cttttgacgt aaagctacgg attgttgggg     90300
     gatctgacag attaaaattc atctgcaact ggagattgcc cgttttctga attaaaggca     90360
     gcagggtcat attgaatccg gtggtgatca tgcccggcgt taatgttgtt gttgctccta     90420
     catccgtagt cgttgttgtt gctgactggg cgacgtaaac cgtctgatct gccatctgga     90480
     taggtaccgg cgtcaggttt gtgacagtgc tttcttgtga agtcacaaca ctgacatcgc     90540
     cctgttcact cagcgcttta atcagaagac tggaaccgct gaatttggcg gcattccctg     90600
     ttgccgaatc cagaattgat acgcctgcag atgtagcgcc tgtaaaatct ccgcttgcat     90660
     tgttcaacgt tgctccggcg gaatgtagcg atttataaac aaggttccag tccagaccga     90720
     actgttcgtt tctggtattg ctgacgctca gaacctgtac gttcagggct acctggcggt     90780
     tcataatact gttttgttcg tccacatatc gtgcgacggc ttcctggaca gctggagtat     90840
     cagtgacagt cagcgttgag ctcgatgcag ataaccagta acggcctttt tctggtgtca     90900
     gcattgcttc aatagttttc cggatgtctt catacagatc gtattcctga ccaacggttg     90960
     tgctctgaga ggacgttgca tcaccggatg ctgagttatc ctggcctcct gttgccccca     91020
     ttgtgcttgt tgagccagag ctgacactgg aactgctgct ggttttggtg ttcagcatat     91080
     gaagtggata cgttctggtt tcagtcagat agaatacaat ccgaccatta tccatgcgcc     91140
     agtacagacc actccggctg gccatcagat ccagaagacc attgatatct ccctgccaca     91200
     tgaggttatt cagcgttaat ggctgagtgg aggtagtcat tgttgtgctg cccaggctgc     91260
     ttaacggtag acgcccattt tcatctggtg ctggtagtgt tcctgtcatc tggcgggtag     91320
     cgcctccttc aagagttgaa ttggctgcgt caggcgtgat gatcacaggg atgccgcata     91380
     cggcagtaat acgttgcccc agttcctgca gagtgatctc tccttttctt gcctgcgtga     91440
     tgtagcaggc cggagctgtt tgttttttct ctcttgatac ctgagcgacc ggaacagggt     91500
     ttatccattg attatcgagc caggtaagag cctgcgattt acgggccgaa agggctgata     91560
     ccttttcccg tgcatgtgct gagtcttcct gtgctttttt ctgcattttg ttgatttcgc     91620
     tgaaagtaca tccggagatg gaaagagcga cggcgatcat gcaggggagc accgccagct     91680
     tcattgaacg ctggtgtgat tttttcatga atatatccag attagttaac gtagacgaca     91740
     gaaccagcag taatgcctgc cgggggtgtc agaccggttg cagttcctga tagccaggtg     91800
     agttgcccgt tttggaagat ccctattagt gcagaaccac gactttttga acgcaaagtt     91860
     tcaacaagac ctggttgttc aggcatccat acccacagac gcccctgttg taactgatgt     91920
     ttaattcggg agtccggagt gacagggaga gccagtttat ctgaggaaat tactccgtcc     91980
     tgctggcctg atacgtatct gatatcattg attctgttag caatcatcag tatctgactt     92040
     gcccatacag acgcacttgc atattgctgg gcgtttgtgg tttcagacat cttctgattc     92100
     tggtagctac cagtgataat cagaatggtc aggccgacgg ccatgaccag ccatcccatt     92160
     agcgaccatc ccttgtatca gaaactgtaa tgatgcactg catgcgagaa gcctgtgcgt     92220
     ataaaggttt ttgcgcagtc cgatataact caaatacctg ctccatggct gattcaaatg     92280
     atccccggaa cattaaaggc gcatccagac ggtaatcggt tacagaaagt ggccatatga     92340
     ccatccagtg cgttgatgcc atgctttcgc attttgtttc ttctgcccac ttgataatgt     92400
     tctctcttaa tgtggtgcct gccggcgcac gccactcttt accctgagat accggtttaa     92460
     caggcgttcc ggtcatgagc gggatagact tgactgtgga gccggttgga gtcggggtgg     92520
     cggcgggggt tgacgaagat acgctgtttc ctctgaatgg atttcgtggt ttgttctggc     92580
     tatttgctgt tgttggagat tcaggggaag tggatgtggt taccatggct gctggcgaga     92640
     tagtggttgc cgtgtcctgt gccggtgcag cagctgatgt tgtgacggtc aacgttttat     92700
     tatcccagtc cagatggccc cataggtgtt gttcttccag caaccgattc agagaacggg     92760
     tccactgatc attggcagac catgaaacca gtttggtatt cagcttgggc gtggctgcat     92820
     tctcttgtct gaatttccat ccttccggta gtaatgtttt tatccactga ctgacggtcc     92880
     ggttacgggc cgtcggcgat agtgttacag gggcgctacc aggcttgcct gtaatgatta     92940
     accgggagaa attctgactt attgttggtg aaggtaacgg tcgggattcg ctgactggat     93000
     gtgctgtttt tactgtctct ggcacgctga ctctcggggg gggagttatt ttaggtggag     93060
     aaagacgttg ttgcgtaagt gccagaacgc cagcactctc actgatttgt ccgtcaacaa     93120
     aaaccagagc aggcgtatct gatggtgcca cgttattgct gccggaaatt ccggcacagc     93180
     cggacaataa tgacggcagt ataagtgtca gatagttttt tttcataacg gagactccgt     93240
     gttcgtatat acgtgtttgt taattggtgt gaggcggctg gagaggacga atgacgactg     93300
     tcattccgtc cgaatgcaaa tgcgggagag accactgaaa taagagatat acaaaaggaa     93360
     ttgataatct ttcatacaga cttgttttcc gtgggcatgt aataacagag aaattcaaac     93420
     cataagattc cagtctcttt ataagtttat ttattcttgc aggagtaaag agatgtgaat     93480
     gcataacaat ggtttcatca ttattaattg cttttgatat cagagaaagt aacacatccc     93540
     agtgtttcct cattgactcc gggcaacgtg tatcggcata ggggctaaga tgtatgcttg     93600
     attctttact gccatttttt ttcgcaaaga atgtgaagtt gtatttagat acagacctta     93660
     cgataagaag cacgcatctg aaaagtagtg gggaaaagca gataataacc actatacaga     93720
     aatataatat ataagatagt gatatgtggt cagtgtatag ataacggaag tattgccacg     93780
     gggtagtgat gtacaggcaa aacgtacacc aaagtaacca tagatataat ggtacgttat     93840
     tatttttcat gttagttgat gccggcgact aagataacag agtaaggggg attaactgtt     93900
     taattctttg gaacgaaaaa atgcagttcc tgaacatcac acaccattat ttccacaggc     93960
     ttaccatttt tatccagtaa atttgaattg gtttcaaaag atttgcagtt gtttttactt     94020
     ttaaatgaat caaggtacag ggtgttaatg tcagattcgt catctgttgt ttctcttgaa     94080
     ataatactgt tttctatcac cacattttca tgtatctcat ttggcatttt gtactgttgc     94140
     aaatattgtt ggcggcggat gcgtgcctgt tcactgcttt ctatgaacac caccgtgatg     94200
     attgccccgt acatgataat caggaaaacc cagaaatctt ttggtatctt ccaaaaaagt     94260
     gcggacagtt tgttatctga tgaaattaaa atcggaaaaa ggattgcaaa gacaatcaaa     94320
     atcgcgatgg ttaatttaaa taaaaacgac atggtcccct cctgttttga cgaggtcttt     94380
     tgtttttgtt gtttttacga cagccagtcc tgcaggtgct gatggcggga gcggctaccc     94440
     ttgcgccagc ggcagtggct accgggtgca cgttccaggc ggaacagaaa tcggttgttg     94500
     catagtacca ccacaaggca gttatccggc gtgcagaagc gtcgggcaag ctcatcggga     94560
     tctgtctgtg ttttcgttga aaacagcttg cgtttgcagt gcgtgtcgac gaccagtacc     94620
     tgtagtcgtc cgggatgttg ctgtggcatc aaagactcct ttcggaacgg gaaaagaagc     94680
     agctgtaccg tcgtaactgc acgtaccggt tgcgaaaaaa cggcacaagc gagtagtgac     94740
     agaaagaatc ccgggaacgg cagaaagggt ggtacaggct gcgaagacgg gtcacggggt     94800
     gtgtcgggaa ttaacgcacg tgaggcgtaa tgagagcgaa gctctttttg ccagggtcat     94860
     ctacgttgat tttcatgtat gttttcctgt cggaaatcgt ggtgctctta taactgttat     94920
     tccctgtttc cagaatcgtt tttcagggtc agaatgacaa taccacagcg gggatttatg     94980
     tgaggcactt tccactgaga taagattctg ctgacgatga ggatgcggaa catgacgcta     95040
     ttcatggcgg attcccttcg ttccgctgtt acatccagcc cttttcggcg cagagagcaa     95100
     atcagctttt gtgtcctggc ttcagtcaga agatgggatt tcatgtagat acgtttcttc     95160
     tggcgtaata aggggggcag cttttcgagt aattgcttga agtgtttttt tatcgccttc     95220
     tttgaggaag tatctgcgag tgcgctcagg aaaacacata ctgtgtgatt gtcagacatg     95280
     tctttggttt taaaactatt tttcctaaat attattctaa gcagaatgaa aaacggacgg     95340
     actaacagcg ggagagctat catccccaat atctctacta gcgtccatat gttcatctgg     95400
     tacaagccat ccttgcagag caaaatcgct ataatgcacc agacgctata tatagctaat     95460
     ggaatacgat attggagttt catgtattgc tcttcctcag tgtaatgtga tagtcgtctg     95520
     ctcctgtgtt gcaccccaga catcttctgg caggctgggc agcccgataa ataaggtgtg     95580
     aaagagggtt tctctgcgtt cgatcccgaa ttgatgttcg tatcctctca ccacctgaaa     95640
     tccttcgtcg gagaatatta actctgccgc ttccagaagc tgcatagttt tgcggtgtag     95700
     tggagtgatc agctgcaacg taactggtgc cctcatatcg cctgtcggta gaaaacactc     95760
     ttcggtgcga cttagttgta gcagatgacg tttcccggaa caggcccgtt caatggattc     95820
     attgaacacc ctctcaggcc atgggcagac atatgtgcgc cagcctgctt tctgtaattt     95880
     acccagtgca gcccgaaaac gaaacaacgg acattccccg acagtggcag agctgagaaa     95940
     gagcgtattc agcgttccga tgatgggaat attgcgatct ttttcggtca atgcttttaa     96000
     cgccatgatt tcgccaggga gactacggaa ctcaggatgt ctgctggcac cagaaagcca     96060
     ttcaagcagg taatgccgta atccggtttc actggttata ttgtggtttt cctgtgccgt     96120
     tttcagggca ttcagtgcac accagagcaa ctggcgcacg ggatgttctg tcgtggtcat     96180
     gcgaatgtcc tactgtgaga tgaaaagaag accggtatcc gttctctccg ccacacgtga     96240
     tggcacgggc cggcctttga taaaacgaat caatactctg gggtgaagcc ttttatttct     96300
     ttcgccatta agaaatacac ggttccatca aaagacaggg ggagtccatg gtggggatgg     96360
     cttcgtgcag gcttcactcc ggaatattct cttgaattga aaaaaagccc ggcccgaagg     96420
     ccgggaaata ctggctatgg gatgtttaca aggcgctcca taaagccgtg atgttcggca     96480
     tttgatacca gttccaggag cagggatatc ctcgactcag gctggagagt attttccatt     96540
     ctgaggagat actgatattg tgcttttgtc agccatatgc tggaagccgc attcagctct     96600
     tccctggctc ccggatttag cacagggtcc gggtaaatct tcattaatcc atcaacaata     96660
     tctttattga cgggttttat ttcaccgcca aacttcacga aatcaatgaa ggcgctatgt     96720
     cgacgtaatg ctgatactgg gtgaatgtca aaattagcca gaataaaaaa gtaccctgga     96780
     aaaatagcga atattctttc acggtaacag cacctggagt ctgcccgtct tatctttctt     96840
     gttattaatg gagtccatgg tacgacgttt tgctcattca gccatgagaa taaagattct     96900
     ctgtttttgc cggctgtatt atattgcgca agataccagt tccggttatt caggtgttct     96960
     atattcacga agttcaacgc tccgcgcaaa accgatccat gatggacgat tttgcgatgt     97020
     caggcgaata tgctaaatca tatgtctgaa gcagtgtcca gcccatatct ggataaactg     97080
     cagttctgac aggcatataa ccagcagact ctagtacgtt ctgtatcggt gatttggcga     97140
     actcacagat aaagaacggc taagcactaa tatcagcaat acagtggcac agtattgtga     97200
     tacgcgaaat aaaacatcag cacgtcagtt cagagtaagg tcgccatata tcgggcatga     97260
     gccagataca aataactggg acaccgtctg aagtgatttg ctttattaaa gtaacttgtg     97320
     cttggtgttt atgtttatca atttgggatc gcctgtaaag tgcaaaatgc aatttccatg     97380
     aaagtgtccc ctttaatggg gacacctgtt cacatttttt cgttttcttt agctgtattg     97440
     ctaatcatga aaacgaaagt tcgcatcagc acagcagagc gaagtgcatc atatccttcc     97500
     agatttaaat tcttcaggct tcgcttcagg taggttcgta ccgtttcggg agaaagccga     97560
     cagttctgag caatggcgtc gtaaggaaca cccattgcgt aaaaaacgca gactttaagc     97620
     tggtttgttg atagctcggg aaacatgcct tccaacagag tgatggccgg gagtttctgt     97680
     atcagttgag gtgacatagc aaaggtctcc gatgacaact aaaaacgcta tcaccgagtt     97740
     cctacgctca ttggtgatag cccagacggg ggtaggaata ccggcgtcat cggaaaccgg     97800
     ccaggctaat gcctgccccg cctgagctac catagatgac gacaagaaat acaagttcct     97860
     gtctttatgg tatggcaaaa aacgacgcca aatgaagaaa ttaacttctg cgccgacgat     97920
     gactacgcgg gttcctacgc ccgatcacag ttttgcctgt gaccagtaaa gggtacttag     97980
     tataacgcac cgagtcaact aaccgcataa aaaacataca aaaaagcgtc aaaacttaac     98040
     gctccgcgcc gaagcgatcc aggcatgatg cttctgcttt gtggcgttcg aacatgctgg     98100
     tccatatgca cgaaacggtg tctgaccctc gtccagacaa tccgcagttc tgacgaacat     98160
     atgaacaaat atgctcttgt agaggctgtt gttacacaat tggcggattg tgtaacaaat     98220
     ggttttatca tctaagaatt attctattta cgatcgaatt atctacaaag tgatttttta     98280
     aaggtttttt agatcgttta attgcattaa aacagaatat tattctgtta ggtggatcgg     98340
     ttgtaagata aatgatcgtg agtaggacaa aagtcgatct tttaatccaa aagaag         98396
//


spacer
spacer