spacer

EBI Dbfetch

ID   AF004327; SV 1; linear; mRNA; STD; HUM; 2269 BP.
XX
AC   AF004327;
XX
DT   16-JUL-1997 (Rel. 52, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens angiopoietin-2 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2269
RX   DOI; 10.1126/science.277.5322.55.
RX   PUBMED; 9204896.
RA   Maisonpierre P.C., Suri C., Jones P.F., Bartunkova S., Wiegand S.J.,
RA   Radziejewski C., Compton D., Aldrich T.H., Papdopoulos N., Daly T.J.,
RA   Davis S., Sato T.N., Yancopoulos G.D.;
RT   "Angiopoietin-2, a natural antagonist for Tie2 that disrupts in vivo
RT   angiogenesis";
RL   Science 277(5322):55-60(1997).
XX
RN   [2]
RP   1-2269
RA   Maisonpierre P.C., Suri C., Jones P.F., Bartunkova S., Wiegand S.J.,
RA   Radziejewski C., Compton D., Aldrich T.H., Papdopoulos N., Daly T.J.,
RA   Davis S., Sato T.N., Yancopoulos G.D.;
RT   ;
RL   Submitted (16-MAY-1997) to the INSDC.
RL   Discovery, Regeneron Pharmaceuticals, 777 Old Saw Mill River Rd.,
RL   Tarrytown, NY 10591, USA
XX
DR   MD5; 3aa8ebf875f5ee7a8492c5d27253320f.
DR   Ensembl-Gn; ENSG00000091879; homo_sapiens.
DR   Ensembl-Tr; ENST00000325203; homo_sapiens.
DR   Ensembl-Tr; ENST00000338312; homo_sapiens.
DR   Ensembl-Tr; ENST00000415216; homo_sapiens.
DR   EuropePMC; PMC1950072; 11778652.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2269
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal"
FT                   /clone_lib="human fetal lung cDNA library (Clontech)"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:9606"
FT   CDS             350..1840
FT                   /codon_start=1
FT                   /product="angiopoietin-2"
FT                   /note="Ligand for Tie2/Tek receptor tyrosine kinase;
FT                   Method: conceptual translation with partial peptide
FT                   sequencing"
FT                   /db_xref="GOA:O15123"
FT                   /db_xref="H-InvDB:HIT000061744.14"
FT                   /db_xref="HGNC:HGNC:485"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="InterPro:IPR020837"
FT                   /db_xref="PDB:1Z3S"
FT                   /db_xref="PDB:1Z3U"
FT                   /db_xref="PDB:2GY7"
FT                   /db_xref="PDB:4JZC"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15123"
FT                   /protein_id="AAB63190.1"
FT                   /translation="MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTF
FT                   LLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDN
FT                   MKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEH
FT                   SLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSK
FT                   QNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISF
FT                   RDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWK
FT                   EYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNY
FT                   RIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGM
FT                   YYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF"
XX
SQ   Sequence 2269 BP; 742 A; 495 C; 518 G; 514 T; 0 other;
     tgggttggtg tttatctcct cccagccttg agggagggaa caacactgta ggatctgggg        60
     agagaggaac aaaggaccgt gaaagctgct ctgtaaaagc tgacacagcc ctcccaagtg       120
     agcaggactg ttcttcccac tgcaatctga cagtttactg catgcctgga gagaacacag       180
     cagtaaaaac caggtttgct actggaaaaa gaggaaagag aagactttca ttgacggacc       240
     cagccatggc agcgtagcag ccctgcgttt cagacggcag cagctcggga ctctggacgt       300
     gtgtttgccc tcaagtttgc taagctgctg gtttattact gaagaaagaa tgtggcagat       360
     tgttttcttt actctgagct gtgatcttgt cttggccgca gcctataaca actttcggaa       420
     gagcatggac agcataggaa agaagcaata tcaggtccag catgggtcct gcagctacac       480
     tttcctcctg ccagagatgg acaactgccg ctcttcctcc agcccctacg tgtccaatgc       540
     tgtgcagagg gacgcgccgc tcgaatacga tgactcggtg cagaggctgc aagtgctgga       600
     gaacatcatg gaaaacaaca ctcagtggct aatgaagctt gagaattata tccaggacaa       660
     catgaagaaa gaaatggtag agatacagca gaatgcagta cagaaccaga cggctgtgat       720
     gatagaaata gggacaaacc tgttgaacca aacagctgag caaacgcgga agttaactga       780
     tgtggaagcc caagtattaa atcagaccac gagacttgaa cttcagctct tggaacactc       840
     cctctcgaca aacaaattgg aaaaacagat tttggaccag accagtgaaa taaacaaatt       900
     gcaagataag aacagtttcc tagaaaagaa ggtgctagct atggaagaca agcacatcat       960
     ccaactacag tcaataaaag aagagaaaga tcagctacag gtgttagtat ccaagcaaaa      1020
     ttccatcatt gaagaactag aaaaaaaaat agtgactgcc acggtgaata attcagttct      1080
     tcaaaagcag caacatgatc tcatggagac agttaataac ttactgacta tgatgtccac      1140
     atcaaactca gctaaggacc ccactgttgc taaagaagaa caaatcagct tcagagactg      1200
     tgctgaagta ttcaaatcag gacacaccac aaatggcatc tacacgttaa cattccctaa      1260
     ttctacagaa gagatcaagg cctactgtga catggaagct ggaggaggcg ggtggacaat      1320
     tattcagcga cgtgaggatg gcagcgttga ttttcagagg acttggaaag aatataaagt      1380
     gggatttggt aacccttcag gagaatattg gctgggaaat gagtttgttt cgcaactgac      1440
     taatcagcaa cgctatgtgc ttaaaataca ccttaaagac tgggaaggga atgaggctta      1500
     ctcattgtat gaacatttct atctctcaag tgaagaactc aattatagga ttcaccttaa      1560
     aggacttaca gggacagccg gcaaaataag cagcatcagc caaccaggaa atgattttag      1620
     cacaaaggat ggagacaacg acaaatgtat ttgcaaatgt tcacaaatgc taacaggagg      1680
     ctggtggttt gatgcatgtg gtccttccaa cttgaacgga atgtactatc cacagaggca      1740
     gaacacaaat aagttcaacg gcattaaatg gtactactgg aaaggctcag gctattcgct      1800
     caaggccaca accatgatga tccgaccagc agatttctaa acatcccagt ccacctgagg      1860
     aactgtctcg aactattttc aaagacttaa gcccagtgca ctgaaagtca cggctgcgca      1920
     ctgtgtcctc ttccaccaca gagggcgtgt gctcggtgct gacgggaccc acatgctcca      1980
     gattagagcc tgtaaacttt atcacttaaa cttgcatcac ttaacggacc aaagcaagac      2040
     cctaaacatc cataattgtg attagacaga acacctatgc aaagatgaac ccgaggctga      2100
     gaatcagact gacagtttac agacgctgct gtcacaacca agaatgttat gtgcaagttt      2160
     atcagtaaat aactggaaaa cagaacactt atgttataca atacagatca tcttggaact      2220
     gcattcttct gagcactgtt tatacactgt gtaaataccc atatgtcct                  2269
//


spacer
spacer