ID X03535; SV 1; linear; mRNA; STD; FUN; 209 BP. XX AC X03535; M23760; XX DT 02-JUL-1986 (Rel. 09, Created) DT 26-JUL-1994 (Rel. 40, Last updated, Version 4) XX DE Yeast type 2 killer virus M2 RNA 5'-terminus (positive strand) XX KW killer virus; unidentified reading frame. XX OS Saccharomyces cerevisiae (baker's yeast) OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; OC Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX RN [1] RP 1-209 RX DOI; 10.1093/nar/13.12.4379. RX PUBMED; 3892487. RA Leibowitz M.J., Hannig E.M.; RT "Structure and expression of M2 genomic segment of a type 2 killer virus of RT yeast"; RL Nucleic Acids Res. 13:4379-4400(1985). XX DR MD5; 7f216725a113c2241847f041ff03b96f. XX CC M2 is a double stranded RNA virus of about 1420 bp. The sequence of CC the positive strand is given in 5' to 3' direction. CC For 3'-terminus see SCK2M2B. XX FH Key Location/Qualifiers FH FT source 1..209 FT /organism="Saccharomyces cerevisiae" FT /strain="killer virus M2" FT /mol_type="mRNA" FT /db_xref="taxon:4932" FT misc_feature 1..209 FT /note="M2 positive strand 5' terminus" FT CDS 7..>209 FT /note="open reading frame (aa 1-68) (209 is 2nd base in FT codon)" FT /db_xref="GOA:E9PA17" FT /db_xref="UniProtKB/TrEMBL:E9PA17" FT /protein_id="CAA27238.1" FT /translation="MKETTTSLMQDELTLGEPATQARMCVRLLRFFIGLTITAFIIAAC FT IIKSATGGSGYSNAVAVRGEADT" XX SQ Sequence 209 BP; 61 A; 45 C; 54 G; 49 T; 0 other; gaaaaaatga aagagactac caccagcctg atgcaagacg agctgacact aggtgagccg 60 gccacccaag caaggatgtg cgtacgtcta ttacgttttt tcataggtct gactataacc 120 gcatttatta tagcagcctg tattattaaa agtgcgacag gcggttcggg atattctaat 180 gcagttgccg ttcggggaga agcggacac 209 //