ID U12510; SV 1; linear; mRNA; STD; VRL; 876 BP. XX AC U12510; XX DT 22-AUG-1994 (Rel. 40, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 2) XX DE Alfalfa mosaic virus NZ2 RNA4 coat protein mRNA, complete cds. XX KW . XX OS Alfalfa mosaic virus OC Viruses; Riboviria; Bromoviridae; Alfamovirus. XX RN [1] RP 1-876 RA Bryan G.T., Gardner R.C., Forster R.L.S.; RT "Nucleotide Sequence of the coat protein gene of two New Zealand strains of RT Alfalfa Mosaic Virus"; RL Unpublished. XX RN [2] RP 1-876 RA Forster R.L.S.; RT ; RL Submitted (21-JUL-1994) to the INSDC. RL Richard L.S. Forster, HortResearch, Molecular Genetics, 120 Mt Albert Road, RL Auckland, New Zealand XX DR MD5; 1ed94895b8195df2d7af5979909a71dd. DR RFAM; RF00252; Alfamo_CPB. XX FH Key Location/Qualifiers FH FT source 1..876 FT /organism="Alfalfa mosaic virus" FT /host="Medicago sativa" FT /lab_host="Nicotiana clevelandii" FT /strain="NZ2" FT /mol_type="mRNA" FT /note="This sequence was determined from PCR products FT generated using oligos corresponding to bases 1-15 and FT 864-876. The NZ2 RNA4 sequence shown is missing 5 bases at FT the 3' end (gacgc) compared to strain 425" FT /db_xref="taxon:12321" FT CDS 37..702 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:Q65002" FT /db_xref="UniProtKB/TrEMBL:Q65002" FT /protein_id="AAA20651.1" FT /translation="MSSSQKKAGGKAGKSTKRSQNYAALRKAQLPKPPALKVPVAKPTN FT TILPQTGCVWQSHGTPLSLSFFNGLGVRFLYSFLKDFAGPRILEEDLIYRMVFSITPSH FT AGTFCLTDDVMTEDGRAVAHGNPMQEFPHGVFHANEKFGFELVFTAPTHAGMQNQNFKH FT SYAVALCLDFDAQPEGSKNPSSRFNEVWVERKAFPRAGPLRSLITVGLLDEADDLDRQ" XX SQ Sequence 876 BP; 215 A; 203 C; 212 G; 246 T; 0 other; gtttttattt ttaattttct ttcaaatact tccatcatga gttcttcaca aaagaaagct 60 ggtgggaaag ctggtaaatc tactaaacgt tctcagaact atgctgcttt acgcaaagct 120 caactgccga agcctccggc gttgaaagtc ccggttgcaa aaccgacgaa tactatactg 180 ccacagacgg gctgtgtgtg gcaaagccac gggacccctc tgagtctgag cttttttaat 240 gggctcggcg tgagattcct ctacagtttt ctgaaggatt tcgcgggacc tcggatcctc 300 gaagaggatc tgatttacag gatggtgttt tctataacac cgtcccatgc cggcaccttt 360 tgtctcactg atgacgtgat gactgaggat ggtagggccg ttgcgcatgg taatcccatg 420 caagaatttc ctcatggcgt gtttcacgct aatgagaagt tcgggtttga gttggtcttc 480 acagctccta cccatgcggg aatgcaaaat caaaatttca agcattccta tgccgtagcc 540 ctctgtttgg acttcgatgc gcagcctgag ggatctaaaa atccctcatc aagattcaac 600 gaagtttggg tcgagagaaa ggcgttcccg cgagcagggc ccctccgcag tttgattact 660 gtggggctgc tcgacgaagc tgacgatctt gatcgtcaat gatgtacccc attattttgg 720 gatgctaaag tcatttaatg ctgacctcca ctgggtggat taaggtcaag gtatgaagtc 780 ctattcgctc ctgataggaa cgacttcata ttgcttatat gtgtgctgat gcacacatat 840 aaatgctcat gcgaaactgc atgaatgccc ctaagg 876 //