ID M10762; SV 1; linear; genomic RNA; STD; VRL; 313 BP. XX AC M10762; XX DT 16-JUL-1988 (Rel. 16, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 2) XX DE Killer virus of S.cerevisiae defective interfering particle S3, 5' terminus DE of positive strand. XX KW . XX OS Killer virus of S.cerevisiae OC Viruses; unclassified viruses. XX RN [1] RP 1-313 RX DOI; 10.1016/0042-6822(84)90004-7. RX PUBMED; 6382788. RA Thiele D.J., Hannig E.M., Leibowitz M.J.; RT "Genome structure and expression of a defective interfering mutant of the RT killer virus of yeast"; RL Virology 137(1):20-31(1984). XX DR MD5; 4a851696780d06435599564655f9b51c. XX FH Key Location/Qualifiers FH FT source 1..313 FT /organism="Killer virus of S.cerevisiae" FT /mol_type="genomic RNA" FT /db_xref="taxon:12477" FT CDS 15..284 FT /codon_start=1 FT /note="mutant M-p32 protein" FT /db_xref="UniProtKB/TrEMBL:Q82993" FT /protein_id="AAA46255.1" FT /translation="MTKPTQVLVRSVSILFFITLLHLVVALNDVAGPAETAPVSLLPRE FT APWYDKIWEVKDWLLQAATDNWGKSITHKHTHLELTGGTQHISP" XX SQ Sequence 313 BP; 94 A; 78 C; 74 G; 67 T; 0 other; tgaaaaataa agaaatgacg aagccaaccc aagtattagt tagatccgtc agtatattat 60 ttttcatcac attactacac ctagtcgtag cgctgaacga tgtggccggt cctgcagaaa 120 cagcaccagt gtcattacta cctcgtgaag cgccgtggta tgacaagatc tgggaagtaa 180 aagattggct attacaggct gccacagata actggggcaa gtcgatcacc cacaagcaca 240 ctcaccttga gctaactggt ggcacgcagc atatctcacc ctgagactaa ctggcggcag 300 gcgaccggtg agc 313 //