ID JQ966556; SV 1; linear; genomic RNA; STD; VRL; 312 BP. XX AC JQ966556; XX DT 01-AUG-2012 (Rel. 113, Created) DT 01-AUG-2012 (Rel. 113, Last updated, Version 1) XX DE Alfalfa mosaic virus isolate HX-A7 coat protein gene, partial cds. XX KW . XX OS Alfalfa mosaic virus OC Viruses; Riboviria; Bromoviridae; Alfamovirus. XX RN [1] RP 1-312 RA Wen Z., Wang J., Hou J.; RT "Molecular diagnosis and detection of mix-infection of viruses on Phaseolus RT vulgaris in Gansu"; RL Unpublished. XX RN [2] RP 1-312 RA Wen Z., Wang J., Hou J.; RT ; RL Submitted (23-APR-2012) to the INSDC. RL Central Laboratory of Technical Center, Gansu Exit-Entry Inspection and RL Quarantine Bureau, 2168 Nanhe Road, Lanzhou, Gansu 730010, China XX DR MD5; 4bdb9e22c8de1bd1e057b3e723a01d5b. XX FH Key Location/Qualifiers FH FT source 1..312 FT /organism="Alfalfa mosaic virus" FT /host="Phaseolus vulgaris" FT /isolate="HX-A7" FT /mol_type="genomic RNA" FT /country="China" FT /collection_date="Aug-2011" FT /db_xref="taxon:12321" FT CDS 7..>312 FT /codon_start=1 FT /product="coat protein" FT /note="CP" FT /db_xref="GOA:I7DIT3" FT /db_xref="UniProtKB/TrEMBL:I7DIT3" FT /protein_id="AFO70082.1" FT /translation="MEASQKKAGGKAGKPTKRSQNYAALRKAQLPKPPALKVPVAKPTN FT TILPQTGCVWQSLGTPLSLSSFNGLGVRFLYSFLKDFAGPRILERGSDLQGWCFYNA" XX SQ Sequence 312 BP; 79 A; 79 C; 80 G; 74 T; 0 other; tccatcatgg aagcttcaca aaagaaagct ggtgggaaag ctggtaaacc tactaaacgt 60 tctcagaact atgctgcttt acgcaaagct caactgccga agcctccggc gttgaaagtc 120 ccggttgcaa aaccgacgaa tactatactg ccacagacgg gctgcgtgtg gcaaagcctc 180 gggacccctc tgagtctgag ctcttttaac gggctcggcg tgagattcct ctacagtttt 240 ctgaaggatt tcgcgggacc tcggatcctc gaaagaggat ctgatttaca gggatggtgt 300 ttctataacg cc 312 //