ID JQ809607; SV 1; linear; genomic RNA; STD; VRL; 335 BP. XX AC JQ809607; XX DT 18-JUN-2012 (Rel. 113, Created) DT 18-JUN-2012 (Rel. 113, Last updated, Version 1) XX DE Apple stem grooving virus isolate HEB-jy movement protein gene, partial DE cds. XX KW . XX OS Apple stem grooving virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Trivirinae; OC Capillovirus. XX RN [1] RP 1-335 RA Hu G.J., Hong N., Wang G.P.; RT "Apple stem grooving virus isolates from Chinese pears"; RL Unpublished. XX RN [2] RP 1-335 RA Hu G.J., Hong N., Wang G.P.; RT ; RL Submitted (21-MAR-2012) to the INSDC. RL College of Plant Science and Technology, Huazhong Agricultural University, RL Shizishan No. 1, Wuhan, Hubei 430070, China XX DR MD5; 44a91a4f35de564558d14778bdf79856. XX FH Key Location/Qualifiers FH FT source 1..335 FT /organism="Apple stem grooving virus" FT /host="pear" FT /isolate="HEB-jy" FT /mol_type="genomic RNA" FT /country="China" FT /collection_date="Mar-2010" FT /db_xref="taxon:28347" FT CDS <1..>335 FT /codon_start=1 FT /product="movement protein" FT /db_xref="GOA:I6QLT6" FT /db_xref="InterPro:IPR001815" FT /db_xref="InterPro:IPR028919" FT /db_xref="UniProtKB/TrEMBL:I6QLT6" FT /protein_id="AFM36869.1" FT /translation="PQYEQDTELFALDIGVAYRCVNSARFLETKTGDSGWASQAISGCE FT ALKFNEEIKMAILDHKSPLFLEEGAPNVHIEKRLFRGDKVRRSRSISAKRGPNSKLQEK FT RGFRSLSA" XX SQ Sequence 335 BP; 99 A; 66 C; 89 G; 81 T; 0 other; ccacagtatg aacaggacac tgagttgttt gctctggaca ttggagttgc ctacaggtgt 60 gtcaattcgg caagattttt ggagaccaag actggcgatt cagggtgggc ttcacaggca 120 attagtgggt gcgaggccct caaattcaat gaagaaatca agatggctat cctggatcat 180 aaatctccac tcttcttgga agaaggtgca ccaaatgtgc acattgaaaa aaggctattt 240 agaggtgaca aagttaggag gtcacgctct atttctgcta aaagggggcc aaactcaaag 300 ctgcaggaaa agagaggatt taggtccctc tcagc 335 //