ID JN654469; SV 1; linear; genomic RNA; STD; VRL; 533 BP. XX AC JN654469; XX DT 29-JAN-2012 (Rel. 111, Created) DT 13-AUG-2012 (Rel. 113, Last updated, Version 2) XX DE Gremmeniella abietina mitochondrial RNA virus S6 isolate AHT04-5 DE RNA-dependent RNA polymerase gene, partial cds. XX KW . XX OS Gremmeniella abietina mitochondrial RNA virus S6 OC Viruses; Riboviria; Narnaviridae; Mitovirus; unclassified Mitovirus. XX RN [1] RP 1-533 RX PUBMED; 22862915. RA Botella L., Tuomivirta T.T., Vervuurt S., Diez J.J., Hantula J.; RT "Occurrence of two different species of mitoviruses in the European race of RT Gremmeniella abietina var. abietina, both hosted by the genetically unique RT Spanish population"; RL Fungal Biol 116(8):872-882(2012). XX RN [2] RP 1-533 RA Tuomivirta T.T., Vervuurt S., Hantula J.; RT ; RL Submitted (06-SEP-2011) to the INSDC. RL Forest Pathology, Finnish Forest Research Institute, Vantaa Research Unit, RL Jokiniemenkuja 1, Vantaa FI-01300, Finland XX DR MD5; 6664a8753019a6c829d73cb8be2162c9. XX FH Key Location/Qualifiers FH FT source 1..533 FT /organism="Gremmeniella abietina mitochondrial RNA virus FT S6" FT /host="Gremmeniella abietina type A" FT /isolate="AHT04-5" FT /mol_type="genomic RNA" FT /country="Finland" FT /collection_date="2004" FT /PCR_primers="fwd_name: Mito-SV5str, fwd_seq: FT gayccrgaatgtaarrtkag, rev_name: Mito-SV3str, rev_seq: FT catctyttagcaaattcrtawgtat" FT /db_xref="taxon:1136057" FT CDS <1..>533 FT /codon_start=2 FT /transl_table=4 FT /product="RNA-dependent RNA polymerase" FT /note="RdRp" FT /db_xref="GOA:H2DRW3" FT /db_xref="InterPro:IPR000477" FT /db_xref="InterPro:IPR008686" FT /db_xref="UniProtKB/TrEMBL:H2DRW3" FT /protein_id="AEY76126.1" FT /translation="IVAMLDYTTQLFLRPIHNDLFKLLKKLPQDRTFTQNPLNDWEDNE FT HSFWSIDLTAATDRFPISLQRRLLLYIYSDPEIANSWQNLLVHREYARHGLNPIKYSVG FT QPMGAYSSWPAFTLSHHLVVHWCAHLCNINKFKDYIILGDDIVIHNDIVAKKYIEIMGK FT LGVGLSDSKTHVSK" XX SQ Sequence 533 BP; 183 A; 89 C; 86 G; 175 T; 0 other; gatagtagct atgttagatt atacaacaca gctatttctc cgacctatac ataatgactt 60 gtttaagctt cttaaaaagc taccacaaga tagaactttt actcaaaatc cactaaatga 120 ttgagaagat aatgaacact cattttgatc aatcgacctt acggcagcaa ctgatagatt 180 tccaataagt ttacaacgtc ggttattact atatatatat agtgatcccg aaattgcaaa 240 ttcttggcag aatctattag tacatagaga atacgctcgt catggactta atccaataaa 300 atattctgtt ggacagccta tgggagccta ttcatcctga cctgctttca cattatctca 360 tcatcttgta gttcattgat gtgcacattt gtgtaacatt aataaattta aagattatat 420 aattcttggt gacgatatcg ttatacataa tgatattgtt gcaaagaaat atattgaaat 480 aatgggaaag ttaggcgtgg gtctatctga tagtaaaact catgtatcga aag 533 //