ID JF755993; SV 1; linear; genomic DNA; STD; VRL; 240 BP. XX AC JF755993; XX DT 22-MAY-2011 (Rel. 108, Created) DT 18-AUG-2011 (Rel. 109, Last updated, Version 2) XX DE Banana bunchy top virus isolate Im1-Mal replicase protein gene, partial DE cds. XX KW . XX OS Banana bunchy top virus OC Viruses; Nanoviridae; Babuvirus. XX RN [1] RP 1-240 RX DOI; 10.1016/j.virusres.2011.04.021. RX PUBMED; 21549775. RA Kumar P.L., Hanna R., Alabi O.J., Soko M.M., Oben T.T., Vangu G.H., RA Naidu R.A.; RT "Banana bunchy top virus in sub-Saharan Africa: Investigations on virus RT distribution and diversity"; RL Virus Res. 159(2):171-182(2011). XX RN [2] RP 1-240 RA Kumar P.L., Hanna R., Alabi O.J., Soko M.M., Oben T.T., Germaine H.P., RA Naidu R.A.; RT ; RL Submitted (29-MAR-2011) to the INSDC. RL Virology & Molecular Diagnostics, IITA, Oyo Road, Ibadan, Oyo PMB5320, RL Nigeria XX DR MD5; 0f748689742ce0b7e95822854b6e1e02. XX FH Key Location/Qualifiers FH FT source 1..240 FT /organism="Banana bunchy top virus" FT /segment="DNA-R" FT /host="Musa sp. (banana)" FT /isolate="Im1-Mal" FT /mol_type="genomic DNA" FT /country="Malawi" FT /collection_date="2008" FT /db_xref="taxon:12585" FT CDS <1..>240 FT /codon_start=2 FT /product="replicase protein" FT /note="core region" FT /db_xref="UniProtKB/TrEMBL:F6M8P9" FT /protein_id="AEF13027.1" FT /translation="RETHKRPLEYLYDCPNTFDRSKDTLYRVQAEMNKTKAMNSWRTSF FT SAWTSEVENIMAQPCHRRIIWVYGPNGGEGLTTYA" XX SQ Sequence 240 BP; 81 A; 37 C; 66 G; 56 T; 0 other; gcgtgaaacg cacaaaaggc ctttggagta tttatatgat tgtcctaata ccttcgatag 60 aagtaaggat acattataca gagtacaagc agagatgaat aaaacgaagg cgatgaatag 120 ctggaggacg tctttcagtg catggacatc agaggtggag aatatcatgg cgcagccatg 180 tcatcggaga ataatttggg tctatggacc aaatggagga gaaggtttga caacgtatgc 240 //