ID GU939596; SV 1; linear; genomic RNA; STD; VRL; 217 BP. XX AC GU939596; XX DT 16-MAR-2010 (Rel. 104, Created) DT 16-MAR-2010 (Rel. 104, Last updated, Version 1) XX DE Apple mosaic virus isolate Egirdir coat protein gene, partial cds. XX KW . XX OS Apple mosaic virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RP 1-217 RA Ertunc F., Canik D., Topkaya S.; RT "Comparison of coat protein gene sequences of Turkish Apple Mosaic RT Ilarvirus apple and hazelnut isolates"; RL Unpublished. XX RN [2] RP 1-217 RA Ertunc F., Canik D., Topkaya S.; RT ; RL Submitted (24-FEB-2010) to the INSDC. RL Plant Protection, Ankara University Faculty of Agriculture, Ankara, Diskapi RL 06110, Turkey XX DR MD5; c3676a7481908521b300aa88f0fd420d. XX FH Key Location/Qualifiers FH FT source 1..217 FT /organism="Apple mosaic virus" FT /segment="RNA3" FT /host="apple" FT /isolate="Egirdir" FT /mol_type="genomic RNA" FT /country="Turkey" FT /collection_date="2008" FT /PCR_primers="fwd_seq: atccgagtgaacagtctatcctctaa, rev_seq: FT gtaactcactcgttatcacgtacaa" FT /db_xref="taxon:12319" FT CDS <1..>217 FT /codon_start=3 FT /product="coat protein" FT /db_xref="GOA:D4PEA4" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:D4PEA4" FT /protein_id="ADD66799.1" FT /translation="EDYDESNPKGPNPMDRKGFKKDQPRGWQWEAPPNTTFDDFVRKFR FT LVLEFKTNFAAGAKVFMRDLYVITSE" XX SQ Sequence 217 BP; 62 A; 35 C; 67 G; 53 T; 0 other; tggaggatta cgatgagagt aatccgaaag gtccgaatcc gatggaccga aagggtttca 60 aaaaggacca accgagaggt tggcagtggg aagcccctcc aaacacaact tttgatgact 120 tcgtgaggaa gtttaggttg gtgttggagt ttaagacgaa tttcgccgct ggtgcgaaag 180 tctttatgag ggatttgtac gtgataacga gtgagta 217 //