ID GQ865676; SV 1; linear; genomic RNA; STD; VRL; 382 BP. XX AC GQ865676; XX DT 21-APR-2010 (Rel. 104, Created) DT 21-APR-2010 (Rel. 104, Last updated, Version 1) XX DE American plum line pattern virus isolate APLM-LPC RNA-dependent RNA DE polymerase gene, partial cds. XX KW . XX OS American plum line pattern virus OC Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; OC Bromoviridae; Ilarvirus. XX RN [1] RP 1-382 RX DOI; 10.1016/j.jviromet.2010.01.011. RX PUBMED; 20117141. RA Untiveros M., Perez-Egusquiza Z., Clover G.; RT "PCR assays for the detection of members of the genus Ilarvirus and family RT Bromoviridae"; RL J. Virol. Methods 165(1):97-104(2010). XX RN [2] RP 1-382 RA Untiveros M.; RT ; RL Submitted (16-AUG-2009) to the INSDC. RL Ministry of Agriculture and Forestry, Plant Health and Environment RL Laboratory, 231 Morrin Road, St. Johns, Auckland, New Zealand XX DR MD5; acf48d43cba7eafc650a43e8dee7d261. XX FH Key Location/Qualifiers FH FT source 1..382 FT /organism="American plum line pattern virus" FT /isolate="APLM-LPC" FT /mol_type="genomic RNA" FT /country="France:Sediag" FT /note="PCR_primers=fwd_name: Ilar2F5, rev_name: Ilar2R9" FT /db_xref="taxon:134632" FT CDS <1..>382 FT /codon_start=2 FT /product="RNA-dependent RNA polymerase" FT /db_xref="GOA:D5I3K1" FT /db_xref="InterPro:IPR001788" FT /db_xref="InterPro:IPR007094" FT /db_xref="UniProtKB/TrEMBL:D5I3K1" FT /protein_id="ADE58487.1" FT /translation="SKFDKSQGRLHHEIQRKLFRRLHSNPDYDNFIETWFSAHMRSKIY FT DRDAGVGFSTDYQRRTGDACTYLGNTLVTLCTLSYIYDLTSPNVGLVVASGDDSLIGTI FT KHLLPRDKEQFCSTLFNFETKFP" XX SQ Sequence 382 BP; 105 A; 69 C; 87 G; 121 T; 0 other; ttcaaaattt gataaatctc agggacgact tcatcatgag attcagagga agctttttag 60 gaggctgcat tcgaaccccg attacgataa ttttatcgaa acgtggtttt ccgctcatat 120 gaggagtaag atctacgaca gggatgctgg agtaggtttt tccaccgatt atcaacgaag 180 aaccggtgat gcgtgcactt acttgggaaa cactttggta actttgtgca cattgtcata 240 tatttatgat ttaacaagtc ctaatgtggg cttagtcgtt gcatcgggag atgacagttt 300 gatcggtacg attaaacatc ttttgcctcg cgataaggaa cagttttgtt cgactttgtt 360 caattttgag acaaagttcc ca 382 //