ID GQ865668; SV 1; linear; genomic RNA; STD; VRL; 384 BP. XX AC GQ865668; XX DT 21-APR-2010 (Rel. 104, Created) DT 18-MAR-2014 (Rel. 120, Last updated, Version 2) XX DE Apple mosaic virus isolate PV-0742 RNA-dependent RNA polymerase gene, DE partial cds. XX KW . XX OS Apple mosaic virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RP 1-384 RX DOI; 10.1016/j.jviromet.2010.01.011. RX PUBMED; 20117141. RA Untiveros M., Perez-Egusquiza Z., Clover G.; RT "PCR assays for the detection of members of the genus Ilarvirus and family RT Bromoviridae"; RL J. Virol. Methods 165(1):97-104(2010). XX RN [2] RP 1-384 RA Untiveros M.; RT ; RL Submitted (15-AUG-2009) to the INSDC. RL Ministry of Agriculture and Forestry, Plant Health and Environment RL Laboratory, 231 Morrin Road, St. Johns, Auckland, New Zealand XX DR MD5; 9a7c74ac33ce9628aae91b8463a67cc3. XX FH Key Location/Qualifiers FH FT source 1..384 FT /organism="Apple mosaic virus" FT /isolate="PV-0742" FT /mol_type="genomic RNA" FT /country="Germany" FT /note="PCR_primers=fwd_name: Ilar2F5, rev_name: Ilar2R9" FT /db_xref="taxon:12319" FT /culture_collection="DSM:PV-0742" FT CDS <1..>384 FT /codon_start=2 FT /product="RNA-dependent RNA polymerase" FT /db_xref="GOA:D5I3J5" FT /db_xref="InterPro:IPR001788" FT /db_xref="InterPro:IPR007094" FT /db_xref="UniProtKB/TrEMBL:D5I3J5" FT /protein_id="ADE58482.1" FT /translation="STFDKSQQRLHHLIQYHIFKALGAPAEFIEMWFGSHEISHIRDGP FT CGIGFSVNYQRRTGDACTYLGNTIITLSALAYMYDLLDPNITFVIASGDDSLIGSRVPL FT DRDDEFKFTTLFNFEAKFPHNQP" XX SQ Sequence 384 BP; 108 A; 79 C; 81 G; 116 T; 0 other; ttcaacattt gataagtctc agcagaggtt gcatcacttg attcaatatc acatttttaa 60 agctcttgga gcgcctgctg aattcattga aatgtggttt ggttcacacg agatctcgca 120 cattagagac ggaccctgcg gtattgggtt tagtgtgaat tatcagcgtc gaactggaga 180 cgcttgcaca tacctgggaa atacgatcat tacattatcc gctttggctt atatgtatga 240 tcttttagat ccgaacatta ctttcgtcat cgcttcagga gacgacagtt taataggatc 300 gagagtacca ttggacaggg acgatgagtt taaattcaca actttgttca actttgaggc 360 taagttccca cacaaccaac caaa 384 //