ID FR832877; SV 1; linear; genomic RNA; STD; VRL; 639 BP. XX AC FR832877; XX DT 10-MAR-2011 (Rel. 108, Created) DT 10-MAR-2011 (Rel. 108, Last updated, Version 1) XX DE Apple stem grooving virus partial MP gene for polyprotein, MP region, DE genomic RNA XX KW . XX OS Apple stem grooving virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Trivirinae; OC Capillovirus. XX RN [1] RP 1-639 RA Negi A.; RT ; RL Submitted (05-MAR-2011) to the INSDC. RL Negi A., Institute of Himalayan Bioresource, Technology(CSIR), Virology RL lab, Floricul, PO Box 6, Palampur, Himachal Pradesh 176061, INDIA. XX RN [2] RA Negi A., Bhardwaj P., Kaundal R., Hallan V., Zaidi A.A.; RT "Chacterization of movement protein of Apple stem grooving virus"; RL Unpublished. XX DR MD5; 78fe0128b15f4292f3ea75200622b670. XX FH Key Location/Qualifiers FH FT source 1..639 FT /organism="Apple stem grooving virus" FT /host="Malus x domestica cv. Star Crimson" FT /mol_type="genomic RNA" FT /country="India:Palampur, HP" FT /isolation_source="host leaf" FT /collected_by="Anuradha negi" FT /identified_by="Anuradha Negi" FT /db_xref="taxon:28347" FT CDS <1..>639 FT /gene="MP" FT /product="polyprotein, MP region" FT /db_xref="GOA:F0X3A4" FT /db_xref="InterPro:IPR001815" FT /db_xref="InterPro:IPR028919" FT /db_xref="UniProtKB/TrEMBL:F0X3A4" FT /protein_id="CCA30186.1" FT /translation="LDDTEIDSTRKKSTKYKYLHYGVILVGIKAMLPNFRGMEGRVIVY FT DGACLDPERGHICSYLFKFESDCCYFGLRPEHCLSTTDANLAKRFRFRVDFDCPQYEQD FT TELFALDIGVAYRCVNSARFLETKTGDSGWASQAISGCEALKFNEEIKMAILDHKSPLF FT LEEGAPNVHIEKRMFRGDKVRRSRYIFAKRGPNSRIQEKRGFRSLSARIE" XX SQ Sequence 639 BP; 198 A; 118 C; 162 G; 161 T; 0 other; cttgatgaca cagagatcga ctccactaga aagaagagca ccaaatacaa gtatctgcac 60 tatggagtca ttctggtcgg gattaaggct atgctaccga actttagggg aatggaaggg 120 agggtcattg tgtatgacgg tgcatgcttg gatccagaaa gaggtcacat ttgttcctac 180 ttattcaaat ttgagtccga ctgttgttac tttggactta gaccggaaca ttgcctatcc 240 acaaccgatg caaatttggc taaaaggttc agatttagag tggattttga ttgtccacaa 300 tacgagcagg acacagagct gtttgctctc gacattgggg ttgcatacag gtgtgtcaat 360 tcagccagat tcttggaaac taagactggt gattcaggat gggcttcaca ggcaatcagc 420 ggctgtgagg cacttaaatt caatgaggaa atcaagatgg caatcctgga tcacaaatca 480 ccgctgtttc tggaagaagg tgcaccaaac gtgcatattg aaaagagaat gtttagaggt 540 gacaaagtca gaaggtcacg ctatattttt gcaaaaaggg ggccaaactc aaggatacaa 600 gaaaagagag gatttaggtc cctctcagct agaatagaa 639 //