ID FN645938; SV 1; linear; genomic DNA; STD; VRL; 349 BP. XX AC FN645938; XX DT 08-FEB-2010 (Rel. 103, Created) DT 23-FEB-2012 (Rel. 111, Last updated, Version 2) XX DE Cotton leaf curl Burewala virus partial AV1 gene for coat protein, clone DE 9S1-PCR A1 XX KW . XX OS Cotton leaf curl Burewala virus OC Viruses; Geminiviridae; Begomovirus; unclassified Begomovirus. XX RN [1] RP 1-349 RA Thompson J.R.; RT ; RL Submitted (07-DEC-2009) to the INSDC. RL Thompson J.R., International Centre for Genetic Engineering and RL Biotechnology (ICGEB), Via Piovega 23, Ca'Tron di Roncade, 31056 (TV), RL ITALY. XX RN [2] RA Zaffalon V., Mukherjee S.K., Reddy V.S., Thompson J.R., Tepfer M.; RT "A survey of geminiviruses and associated satellite DNAs in the RT cotton-growing areas of northwestern India"; RL Arch. Virol. 0:0(2011). XX DR MD5; 413772da005996870907641f6d8f546a. XX FH Key Location/Qualifiers FH FT source 1..349 FT /organism="Cotton leaf curl Burewala virus" FT /segment="A" FT /host="Gossypium hirsutum" FT /mol_type="genomic DNA" FT /country="India:Rajasthan" FT /collection_date="Sep-2007" FT /clone="9S1-PCR A1" FT /db_xref="taxon:620894" FT CDS <1..>349 FT /codon_start=3 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:D3HIS5" FT /db_xref="InterPro:IPR000263" FT /db_xref="InterPro:IPR000650" FT /db_xref="UniProtKB/TrEMBL:D3HIS5" FT /protein_id="CBJ17737.1" FT /translation="GKRFCVKSVYVLGKIWMDENIKTKNHTNSVMFFLVRDRRPVDKPQ FT DFGEVFNMFDNEPSTATVKNVHRDRYQVLRKWHATVTGGQYASKEQALVKKFIRVNNYV FT VYNQQEAGKYE" XX SQ Sequence 349 BP; 111 A; 51 C; 84 G; 103 T; 0 other; ttggtaagag attttgtgtt aagtctgttt atgtgttggg taagatctgg atggatgaaa 60 atattaagac caagaatcac acgaattctg tgatgttttt cttggtcaga gatcgtagac 120 ctgttgataa acctcaagat tttggagagg tatttaatat gtttgacaat gaacccagta 180 cggcgactgt gaagaatgtt catcgggata ggtaccaagt tctgcgcaaa tggcatgcaa 240 ctgtcaccgg tggacaatat gcttcaaagg aacaagctct cgtcaagaaa tttattagag 300 ttaacaatta tgttgtgtac aaccaacagg aagctggcaa atatgagaa 349 //