ID FM992637; SV 1; linear; genomic RNA; STD; VRL; 334 BP. XX AC FM992637; XX DT 27-FEB-2009 (Rel. 100, Created) DT 27-FEB-2009 (Rel. 100, Last updated, Version 1) XX DE Apple chlorotic leaf spot virus partial CP gene for coat protein, isolate DE ACLSV-Kristalli, genomic RNA XX KW . XX OS Apple chlorotic leaf spot virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Trivirinae; Trichovirus. XX RN [1] RP 1-334 RA Maliogka V.I.; RT ; RL Submitted (27-JAN-2009) to the INSDC. RL Maliogka V.I., School of Agriculture, Aristotle University of Thessaloniki, RL P.O.B. 269, Thessaloniki, 54124, GREECE. XX RN [2] RA Mathioudakis M.M., Maliogka V.I., Katis N.I.; RT "Occurrence and distribution of Apple stem pitting and Apple chlorotic leaf RT spot viruses in apple and pear orchards in Greece"; RL Unpublished. XX DR MD5; b6e080d377245998563b30fb1ae01913. XX FH Key Location/Qualifiers FH FT source 1..334 FT /organism="Apple chlorotic leaf spot virus" FT /host="Pyrus communis cv. Kristalli" FT /isolate="ACLSV-Kristalli" FT /mol_type="genomic RNA" FT /country="Greece:Florina" FT /isolation_source="host leaves" FT /db_xref="taxon:12175" FT CDS <1..>334 FT /codon_start=2 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:C0MNS5" FT /db_xref="InterPro:IPR008879" FT /db_xref="UniProtKB/TrEMBL:C0MNS5" FT /protein_id="CAX32453.1" FT /translation="IFANIAIQGTSEQTEFLDLVVEVKSMEDQKVIGSYNLKEVVNMIK FT AFRTTSSDPNISSMTFRQVCEAFAPEARNGLVKLKYKGVFTNLFTTMPEVGSKYPELMF FT DFNKGLN" XX SQ Sequence 334 BP; 101 A; 69 C; 88 G; 76 T; 0 other; catcttcgcg aacatagcga tacaaggaac atcagagcaa acggaatttc tggatctggt 60 ggtggaagtg aagtcaatgg aggatcagaa agtgatcggg tcctacaatt tgaaggaagt 120 ggtcaacatg atcaaagctt tcaggactac ctcttcggac ccgaatatca gcagcatgac 180 attccgccaa gtgtgcgagg ccttcgcccc ggaggcgagg aacgggttgg tcaaactgaa 240 gtataaaggg gttttcacca acctctttac gaccatgcca gaggtgggaa gtaaataccc 300 agaattaatg tttgatttca ataagggtct taac 334 //