ID EU665492; SV 1; linear; genomic RNA; STD; VRL; 366 BP. XX AC EU665492; XX DT 18-MAY-2008 (Rel. 95, Created) DT 18-MAY-2008 (Rel. 95, Last updated, Version 1) XX DE Apple stem pitting virus isolate YL07 coat protein (CP) gene, partial cds. XX KW . XX OS Apple stem pitting virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Foveavirus. XX RN [1] RP 1-366 RA Wu Y., Yue H., Wang W.; RT "A new chinese isolate of Apple stem pitting virus from apples"; RL Unpublished. XX RN [2] RP 1-366 RA Wu Y., Yue H., Wang W.; RT ; RL Submitted (21-APR-2008) to the INSDC. RL College of Plant Protection, Northwest A&F University, Taicheng Road, RL YangLing, Shaanxi 712100, China XX DR MD5; cb3c379d0cdae9c78906e694ca94e778. XX FH Key Location/Qualifiers FH FT source 1..366 FT /organism="Apple stem pitting virus" FT /isolate="YL07" FT /mol_type="genomic RNA" FT /country="China" FT /db_xref="taxon:35350" FT gene <1..302 FT /gene="CP" FT CDS <1..302 FT /codon_start=3 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:B2ZHF1" FT /db_xref="InterPro:IPR000052" FT /db_xref="UniProtKB/TrEMBL:B2ZHF1" FT /protein_id="ACD43643.1" FT /translation="VWNLMLQTQSPPANWVGKEFKFETRYAAFDFFFGVESTASLEPAD FT GLIRLPTQAERVANATSKEIQMYRIRSMEGTQAVNFGEVTGGKIGPKPVLSIRK" XX SQ Sequence 366 BP; 103 A; 77 C; 84 G; 102 T; 0 other; atgtctggaa cctcatgctg caaactcaaa gtccccctgc aaactgggtt ggtaaggagt 60 tcaagttcga aactaggtac gctgcttttg acttcttctt tggtgttgaa agcactgcgt 120 cccttgagcc cgctgatggt ctaattagac taccgactca ggcagagaga gtggcaaatg 180 ccacgagcaa agaaatacag atgtaccgca tccgctctat ggagggtact caggctgtta 240 atttcggtga agtcactgga ggaaaaattg gacccaagcc agtgttgtca attaggaagt 300 aatcatttaa agctttctct aaattccaat tacagtattt atgcttttta gtaaagttga 360 tcccaa 366 //