ID EU247940; SV 1; linear; genomic RNA; STD; VRL; 199 BP. XX AC EU247940; XX DT 21-FEB-2008 (Rel. 94, Created) DT 21-FEB-2008 (Rel. 94, Last updated, Version 1) XX DE Apple stem pitting virus clone 39.SH3 RNA-dependent RNA polymerase gene, DE partial cds. XX KW . XX OS Apple stem pitting virus OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Foveavirus. XX RN [1] RP 1-199 RA Goszczynski D.E.; RT "Investigation of an association between viruses of the genera Fovea-and RT Vitivirus and Shiraz (Syn. Syrah) decline in South Africa"; RL Unpublished. XX RN [2] RP 1-199 RA Goszczynski D.E.; RT ; RL Submitted (25-OCT-2007) to the INSDC. RL Virology, Plant Protection Research Institute, Pretoria 0001, South Africa XX DR MD5; 1a13fe120cacb664bc4929a0c46e286f. XX FH Key Location/Qualifiers FH FT source 1..199 FT /organism="Apple stem pitting virus" FT /host="grapevine cv. Shiraz" FT /mol_type="genomic RNA" FT /country="South Africa" FT /collected_by="Goszczynski" FT /clone="39.SH3" FT /db_xref="taxon:35350" FT CDS <1..>199 FT /codon_start=3 FT /product="RNA-dependent RNA polymerase" FT /db_xref="GOA:B0Z3Y9" FT /db_xref="InterPro:IPR001788" FT /db_xref="UniProtKB/TrEMBL:B0Z3Y9" FT /protein_id="ABY74779.1" FT /translation="GQTLACFQHSVLCRFAPYMRYIEAKVVEVLPKNLYIHSGKNIDDL FT AAWVTKNKFNGVCTDSDYEA" XX SQ Sequence 199 BP; 54 A; 41 C; 49 G; 55 T; 0 other; tggggcagac gctggcgtgt ttccaacatt cagtcttgtg taggtttgct ccttacatga 60 ggtacattga ggctaaggtt gtggaagtac tgccaaaaaa tctctacatt cactcaggca 120 agaacattga tgatctagca gcctgggtaa ccaagaataa atttaacggg gtttgcactg 180 actccgatta cgaagcctt 199 //