ID EF408174; SV 1; linear; genomic RNA; STD; VRL; 789 BP. XX AC EF408174; XX DT 31-OCT-2008 (Rel. 97, Created) DT 29-DEC-2008 (Rel. 98, Last updated, Version 2) XX DE Barley yellow dwarf virus-PAV isolate PAV SIw RNA-dependent RNA polymerase DE P2 fusion protein and coat protein P3 genes, partial cds; and movement DE protein P4 gene, complete cds. XX KW . XX OS Barley yellow dwarf virus PAV OC Viruses; Riboviria; Luteoviridae; Luteovirus. XX RN [1] RP 1-789 RA Delmiglio C., Pearson M.N.; RT "Sequence variation of barley yellow dwarf viruses from New Zealand RT grasses"; RL Unpublished. XX RN [2] RP 1-789 RA Delmiglio C., Pearson M.N.; RT ; RL Submitted (29-JAN-2007) to the INSDC. RL School of Biological Sciences, The University of Auckland, 3A Symonds St., RL Private Bag 92019, Auckland 1142, New Zealand XX DR MD5; 96ccaddb487f09ec95716ee7225968d2. DR GrainGenes; EF408174; EF408174. XX FH Key Location/Qualifiers FH FT source 1..789 FT /organism="Barley yellow dwarf virus PAV" FT /host="Triticum aestivum" FT /isolate="PAV SIw" FT /mol_type="genomic RNA" FT /country="New Zealand:Canterbury" FT /note="serogroup: PAV" FT /db_xref="taxon:2169986" FT CDS <1..80 FT /codon_start=3 FT /product="RNA-dependent RNA polymerase P2 fusion protein" FT /db_xref="GOA:B6RCG0" FT /db_xref="UniProtKB/TrEMBL:B6RCG0" FT /protein_id="ABR26513.1" FT /translation="SVKVTTPHLQSILLSIPENHSQNEY" FT CDS 194..>789 FT /codon_start=1 FT /product="coat protein P3" FT /note="ORF3; translated from subgenomic RNA1" FT /db_xref="GOA:B6RCG1" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:B6RCG1" FT /protein_id="ABR26514.1" FT /translation="MNSVGRRGPRRANQNGPRRRRRRTVRPVVMVQPNRAGPRRRNGRR FT KGRGGANPVFRPTGGTEVFVFSVDNLKANSSGAIKFGPSLSQCPALSDGILKSYHRYKI FT TSIRVEFKSHASATTAGAIFIELDTACKQSALGSYINSFTISKTASKTFRSEAINGKEF FT QESTIDQFWMLYKANGTTTDTAGQFIITMSVSLMTA" FT CDS 237..698 FT /codon_start=1 FT /product="movement protein P4" FT /note="ORF4; translated via leaky scanning of subgenomic FT RNA1" FT /db_xref="InterPro:IPR001964" FT /db_xref="UniProtKB/TrEMBL:B6RCG2" FT /protein_id="ABR26515.1" FT /translation="MAQEGGAVEQFGQWLWSNPIEQDPDDEMVDAREEEGQILYLDQQA FT GLRYSYSQLTTLKPTPPGQSNSAPVYRNAQRFQTEYSSPTIVTRSQVSELSLSHTRPPL FT RQALSLLNSTPRASNQPWVATLIPSPSARPPPKPSGQRQLMGRNSRNQR" XX SQ Sequence 789 BP; 236 A; 196 C; 183 G; 174 T; 0 other; agagtgtgaa ggtgacgact ccacatctgc aatcaatact gctttccata ccggaaaacc 60 actcacaaaa cgaatattaa ctaccagatc ttagctgggt ttgggatagg gtttatagtt 120 agtataccct gtacattagc tctcgcgtac tttatttaca ataaagtttc agacaccact 180 agagaggtgg tgaatgaatt cagtaggccg tagaggacct agacgcgcaa atcaaaatgg 240 cccaagaagg aggcgccgta gaacagttcg gccagtggtt atggtccaac ccaatcgagc 300 aggacccaga cgacgaaatg gtcgacgcaa gggaagagga ggggcaaatc ctgtatttag 360 accaacaggc gggactgagg tattcgtatt ctcagttgac aaccttaaag ccaactcctc 420 cggggcaatc aaattcggcc ccagtctatc gcaatgccca gcgctttcag acggaatact 480 caagtcctac catcgttaca agatcacaag tatccgagtt gagtttaagt cacacgcgtc 540 cgccactacg gcaggcgcta tctttattga actcgacacc gcgtgcaagc aatcagccct 600 gggtagctac attaattcct tcaccatcag caagaccgcc tccaaaacct tccggtcaga 660 ggcaattaat gggaaggaat tccaggaatc aacgatagac caattttgga tgctctacaa 720 ggccaatgga accaccactg acacggcagg acaatttatc attacgatga gtgtcagttt 780 gatgacggc 789 //