ID AY028808; SV 1; linear; genomic DNA; STD; VRL; 357 BP. XX AC AY028808; XX DT 10-APR-2001 (Rel. 67, Created) DT 10-APR-2001 (Rel. 67, Last updated, Version 1) XX DE Cotton leaf curl virus AV2 protein gene, complete cds. XX KW . XX OS Cotton leaf curl virus OC Viruses; Geminiviridae; Begomovirus; unclassified Begomovirus. XX RN [1] RP 1-357 RA Radhakrishnan G., Malathi V.G., Varma A.; RT "Nucleotide sequence of AV2 protein of Indian isolate of cotton leaf curl RT virus (CLCuV-G)"; RL Unpublished. XX RN [2] RP 1-357 RA Radhakrishnan G., Malathi V.G., Varma A.; RT ; RL Submitted (20-MAR-2001) to the INSDC. RL Advanced Centre for Plant Virology, Division of Plant Pathology, Indian RL Agricultural Research Institute, Pusa Road, New Delhi, Delhi 110012, India XX DR MD5; aaf0429a0b8375093a23b8660325a9a5. XX FH Key Location/Qualifiers FH FT source 1..357 FT /organism="Cotton leaf curl virus" FT /mol_type="genomic DNA" FT /db_xref="taxon:53010" FT CDS 1..357 FT /codon_start=1 FT /product="AV2 protein" FT /note="movement protein/pre-coat protein" FT /db_xref="GOA:Q98WJ0" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q98WJ0" FT /protein_id="AAK29175.1" FT /translation="MWDPLLNEFPDTVHGFRCMLSVKYLQLLSQDYSPDTLGYELIRDL FT ICILRSRSYVEASCRYRHFYARVESTPASELRQPIHQPCCCPHCPRHKTTGMDKQAYEQ FT EAQDVQDVQKSRCS" XX SQ Sequence 357 BP; 88 A; 88 C; 87 G; 94 T; 0 other; atgtgggatc cactattaaa cgaattccct gatacggttc acgggtttcg gtgtatgctt 60 tctgtgaaat atttgcaact tttgtcgcag gattattcac cggatacgct tgggtacgag 120 ttaatacggg atttaatttg tattttacgc tcccgtagtt atgtcgaagc gagctgccga 180 tatcgtcatt tctacgcccg cgtcgaaagt acgccggcgt ctgaacttcg gcagcccata 240 caccagccgt gctgctgccc ccattgtccg cgtcacaaaa caacaggcat ggacaaacag 300 gcctatgaac aggaagccca ggatgtacag gatgtacaga agtccagatg ttcctag 357 //