ID AJ577187; SV 1; linear; genomic RNA; STD; VRL; 298 BP. XX AC AJ577187; XX DT 16-JUL-2003 (Rel. 76, Created) DT 07-JAN-2004 (Rel. 78, Last updated, Version 3) XX DE Cryphonectria hypovirus 1 partial ORFA DNA for p40, genomic RNA, isolate DE F-25 XX KW ORFA; p40; polyprotein p69. XX OS Cryphonectria hypovirus 1 OC Viruses; Riboviria; Hypoviridae; Hypovirus. XX RN [1] RP 1-298 RA Rigling D.; RT ; RL Submitted (10-JUL-2003) to the INSDC. RL Rigling D., Research Department Forests, WSL Swiss Federal Research RL Institute, Zuercherstrasse 111, Birmensdorf, 8903, SWITZERLAND. XX RN [2] RX DOI; 10.1016/S0168-1702(03)00220-X. RX PUBMED; 14550586. RA Gobbin D., Hoegger P.J., Heiniger U., Rigling D.; RT "Sequence variation and evolution of Cryphonectria hypovirus 1 (CHV-1) in RT Europe"; RL Virus Res. 97(1):39-46(2003). XX DR MD5; 432a7a264ce044a66860838d4b361b61. XX FH Key Location/Qualifiers FH FT source 1..298 FT /organism="Cryphonectria hypovirus 1" FT /isolate="F-25" FT /mol_type="genomic RNA" FT /country="Switzerland:Faido, Ticino" FT /haplotype="SgA" FT /note="isolated in 1998" FT /db_xref="taxon:40281" FT CDS <1..>298 FT /codon_start=1 FT /product="p40" FT /note="ORFA" FT /note="polyprotein p69" FT /db_xref="UniProtKB/TrEMBL:Q7T8Y0" FT /protein_id="CAE11835.1" FT /translation="VNDYFRRHKAELLKFDARLRSHMAKKPVSVRTRSSDAKIQCIGWR FT DRHLLPQRLAGLTKQKRSLIWSRFATSNIRRKASACTMTPSVDPMVHTWGDSAA" XX SQ Sequence 298 BP; 59 A; 93 C; 80 G; 66 T; 0 other; gtgaacgatt atttccgtcg tcacaaggcc gaactcctca agttcgatgc gcgccttcgg 60 tcgcacatgg ccaagaaacc tgtgtcggta aggactcgtt cttccgacgc aaagattcaa 120 tgcatcgggt ggcgtgatcg tcacttgctg ccgcaacgcc ttgctggctt gaccaagcaa 180 aagcgttccc ttatctggtc gcggttcgcg accagcaaca ttcggcgcaa ggcctcggcc 240 tgcaccatga ccccgagtgt ggatcctatg gtccacacct ggggagattc cgctgccc 298 //