ID   AJ270862; SV 1; linear; genomic DNA; STD; VRL; 713 BP.
XX
AC   AJ270862;
XX
DT   11-JUL-2000 (Rel. 64, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Cotton leaf curl virus DNA-A fragment, isolate P28-IR
XX
KW   AC1 gene; AC1 protein; AC4 gene; AC4 protein; AV1 gene; AV2 gene;
KW   AV2 protein; coat protein.
XX
OS   Cotton leaf curl virus
OC   Viruses; Geminiviridae; Begomovirus; unclassified Begomovirus.
XX
RN   [1]
RP   1-713
RA   Sanz A.I.;
RT   ;
RL   Submitted (25-OCT-1999) to the INSDC.
RL   Sanz A.I., Departamento de Biotecnologia, E.T.S Ingenieros Agronomos.
RL   Universidad Politecnica., Avd. de la Complutense. Madrid, E-28040, SPAIN.
XX
RN   [3]
RX   PUBMED; 10859391.
RA   Sanz A.I., Fraile A., Garcia-Arenal F., Zhou X., Robinson D.J., Khalid S.,
RA   Butt T., Harrison B.D.;
RT   "Multiple infection, recombination and genome relationships among
RT   begomovirus isolates found in cotton and other plants in Pakistan";
RL   J. Gen. Virol. 81(Pt 7):1839-1849(2000).
XX
DR   MD5; 1b1279b2c5aa95d379720841430e9e6e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..713
FT                   /organism="Cotton leaf curl virus"
FT                   /segment="A"
FT                   /isolate="P28-IR"
FT                   /mol_type="genomic DNA"
FT                   /country="Pakistan"
FT                   /db_xref="taxon:53010"
FT   CDS             complement(<1..258)
FT                   /gene="AC1"
FT                   /product="AC1 protein"
FT                   /function="Replication assotiated protein"
FT                   /db_xref="GOA:Q9IEU8"
FT                   /db_xref="InterPro:IPR001191"
FT                   /db_xref="InterPro:IPR001301"
FT                   /db_xref="InterPro:IPR022690"
FT                   /db_xref="UniProtKB/TrEMBL:Q9IEU8"
FT                   /protein_id="CAB97100.1"
FT                   /translation="MAPPRRFRIDAKNYFLTYPKCSLTKEEALSQLQTLETPTAKKFIK
FT                   ICRELHEDGSPHIHVLIQFEGKFQCKNNRFFDLVSPSRSAH"
FT   CDS             complement(<1..101)
FT                   /gene="AC4"
FT                   /product="AC4 protein"
FT                   /db_xref="InterPro:IPR002488"
FT                   /db_xref="UniProtKB/TrEMBL:Q9IEU7"
FT                   /protein_id="CAB97101.1"
FT                   /translation="MGLRISMFSSNSKGNSSARITDSSTWFPQVGQH"
FT   rep_origin      414
FT   CDS             533..>713
FT                   /gene="AV2"
FT                   /product="AV2 protein"
FT                   /db_xref="GOA:Q9IEU6"
FT                   /db_xref="InterPro:IPR002511"
FT                   /db_xref="UniProtKB/TrEMBL:Q9IEU6"
FT                   /protein_id="CAB97102.1"
FT                   /translation="MWDPLLHDFPESVHGLRCMLAVKYLQEIEKNYSPDTVGYDLVRDL
FT                   ILVLRAKNYGEATSR"
FT   CDS             693..>713
FT                   /gene="AV1"
FT                   /product="Coat Protein"
FT                   /function="coat protein"
FT                   /protein_id="CAB97103.1"
FT                   /translation="MAKRPAD"
XX
SQ   Sequence 713 BP; 196 A; 146 C; 164 G; 207 T; 0 other;
     atgtgctgac cgacttgggg aaaccaagtc gaagaatctg ttattcttgc actggaattt        60
     cccttcgaat tggatgagaa catggatatg cggagaccca tcttcgtgaa gctctctaca       120
     gatcttgatg aatttcttcg cagttggggt ttctagggtt tgcaattggg aaagtgcctc       180
     ttctttagtt agggagcact ttggatatgt gaggaaatag tttttggcat ctattctgaa       240
     acgacgtggc ggagccataa aacttgtcgt tttgattcgg cgtccctcaa cttcctctat       300
     gtaattggcg tctggcgtcc catatatagg taggacgcta aatggcagaa ttgtaatttt       360
     gaaaagaaaa ttactttaat tcaaaatcct catagcggcc attcgttaat attaccgaat       420
     ggccgcgcaa atttttaggt gggccctcaa ccaatgaaaa tcacgctaca tggcttattt       480
     agtgcgtggg gaccaataaa tagacttgct caccaagttt ggatccacaa acatgtggga       540
     tccattattg cacgattttc cagaaagcgt tcatggtcta aggtgcatgc tagctgtaaa       600
     atatctccaa gagatagaaa agaactattc cccagacaca gtcggctacg atcttgtccg       660
     agatctcatt cttgttctcc gggcaaagaa ctatggcgaa gcgaccagca gat              713
//