spacer

EBI Dbfetch

ID   Z99006; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   Z99006;
XX
DT   09-DEC-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1*0818 gene
XX
KW   HLA-DRB1*0818 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Kervaire B., Tiercy J.M.;
RT   "Sequence of a new HLA-DR8 subtype";
RL   Unpublished.
XX
RN   [2]
RC   revised by [3]
RA   Tiercy J.M.;
RT   ;
RL   Submitted (09-SEP-1997) to the INSDC.
RL   Centre Medical Universitaire, Transplantation Immunology Unit, 1 rue Michel
RL   Servet, Geneva 1211, Switzerland.
XX
RN   [3]
RP   1-270
RA   Tiercy J.M.;
RT   ;
RL   Submitted (08-JUN-1998) to the INSDC.
RL   Centre Medical Universitaire, Transplantation Immunology Unit, 1 rue Michel
RL   Servet, Geneva 1211, Switzerland.
XX
DR   MD5; 8b6cb094b8a267f61c002c4dd5fbc34c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1*0818"
FT                   /product="human leukocyte antigen"
FT                   /db_xref="GOA:O78212"
FT                   /db_xref="IMGT/HLA:DRB1*08:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O78212"
FT                   /protein_id="CAB11742.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGPPSAEYWNSQKDILEDRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 59 A; 64 C; 97 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc cgcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer