spacer

EBI Dbfetch

ID   Z96924; SV 2; linear; genomic DNA; STD; HUM; 1167 BP.
XX
AC   Z96924;
XX
DT   13-SEP-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens gene encoding human leukocyte antigen-Cw*0210, exons 2, 3, 4.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RC   revised by [4]
RA   Tiercy J.;
RT   ;
RL   Submitted (16-JUN-1997) to the INSDC.
RL   Jean-Marie Tiercy, Transplantation Immunology Unit, lab 8022, Centre
RL   Medical Universitaire, 1, rue Michel-Servet, 1211 Geneva, 4, 1211, CH
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.1998.tb02949.x.
RX   PUBMED; 9459506.
RA   Grundschober C., Labonne M., Javaux F., Steiner Q.G., Gebuhrer L.,
RA   Tiercy J.M.;
RT   "Sequence of four new HLA-Cw alleles: a possible role of interallelic
RT   recombination";
RL   Tissue Antigens 51(1):72-79(1998).
XX
RN   [4]
RP   1-1167
RA   Gibson M.S.;
RT   ;
RL   Submitted (20-APR-2006) to the INSDC.
RL   Gibson M.S., Research, Anthony Nolan Research Institute, Fleet Road,
RL   Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [5]
RA   Gibson M.S., Cox S.;
RT   "Exon 4 sequence for HLA-Cw*020204";
RL   Unpublished.
XX
DR   MD5; 0afc329f3de0091bf5b5cddb1de041cf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1167
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /cell_line="MAN527"
FT                   /cell_type="leukocyte"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,516..791,892..>1167)
FT                   /gene="Cw"
FT                   /allele="*0210"
FT   CDS             join(<1..270,516..791,892..>1167)
FT                   /codon_start=3
FT                   /gene="Cw"
FT                   /allele="*0210"
FT                   /product="HLA"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q1G0L6"
FT                   /db_xref="IMGT/HLA:C*02:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1G0L6"
FT                   /protein_id="CAK22320.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..270
FT                   /gene="Cw"
FT                   /allele="*0210"
FT                   /number=2
FT   exon            1..276
FT                   /gene="Cw"
FT                   /allele="*0210"
FT                   /number=4
FT   intron          271..515
FT                   /gene="Cw"
FT                   /allele="*0210"
FT                   /number=2
FT   exon            516..791
FT                   /gene="Cw"
FT                   /allele="*0210"
FT                   /number=3
FT   gap             792..891
FT                   /estimated_length=unknown
XX
SQ   Sequence 1167 BP; 209 A; 341 C; 372 G; 145 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctccgg gtctgagatc       360
     caccccgagg ctgcggaatc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcggggc tggggcgggg       480
     ctcgggggac gggctgacca cgggggcggg gccagggtct cacaccctcc agaggatgta       540
     cggctgcgac ctggggcccg acgggcgcct cctccgcggg tatgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagt ggagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naacacccaa       900
     agacacacgt gacccaccat cccgtctctg accatgaggc caccctgagg tgctgggccc       960
     tgggcttcta ccctgcggag atcacactga cctggcagcg ggatggcgag gaccaaactc      1020
     aggacaccga gcttgtggag accaggccag caggagatgg aaccttccag aagtgggcag      1080
     ctgtggtggt gccttctgga gaagagcaga gatacacgtg ccatgtgcag cacgaggggc      1140
     tgccggagcc cctcaccctg agatggg                                          1167
//


spacer
spacer