Dbfetch

ID   Z93949; SV 1; linear; genomic DNA; STD; HUM; 3135 BP.
XX
AC   Z93949;
XX
DT   11-APR-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   H.sapiens HLA-A gene (isolate LCL 721 (IHW9249))
XX
KW   HLA-A gene; human leukocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-3135
RA   Laforet M.;
RT   ;
RL   Submitted (10-APR-1997) to the INSDC.
RL   Michel Laforet, Laboratoire d'Histocompatibilite, Etablissement de
RL   Transfusion Sanguine, 10 rue Spielmann, Strasbourg, 67065, France
XX
RN   [3]
RP   1-3135
RX   DOI; 10.1111/j.1399-0039.1997.tb02885.x.
RX   PUBMED; 9349617.
RA   Laforet M., Froelich N., Parissiadis A., Pfeiffer B., Schell A., Faller B.,
RA   Woehl-Jaegle M.L., Cazenave J.P., Tongio M.M.;
RT   "A nucleotide insertion in exon 4 is responsible for the absence of
RT   expression of an HLA-A*01 allele";
RL   Tissue Antigens 50(4):347-350(1997).
XX
DR   MD5; 1f5dd97a5c0729a2ac561cd6a89aa3ac.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
DR   EuropePMC; PMC2686596; 18838392.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3135
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="LCL 721 (IHW9249)"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="B-LCL"
FT                   /db_xref="taxon:9606"
FT   regulatory      1..216
FT                   /regulatory_class="promoter"
FT   CDS             join(217..289,420..689,931..1206,1786..2061,2164..2280,
FT                   2723..2755,2898..2945,3115..3119)
FT                   /gene="HLA-A"
FT                   /product="human leukocyte antigen"
FT                   /db_xref="GOA:P30443"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:1W72"
FT                   /db_xref="PDB:3BO8"
FT                   /db_xref="PDB:4NQV"
FT                   /db_xref="PDB:4NQX"
FT                   /db_xref="PDB:5BRZ"
FT                   /db_xref="PDB:5BS0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30443"
FT                   /protein_id="CAB07989.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   sig_peptide     217..288
FT   exon            217..289
FT                   /number=1
FT   intron          290..419
FT                   /number=1
FT   exon            420..689
FT                   /number=2
FT   intron          690..930
FT                   /number=2
FT   exon            931..1206
FT                   /number=3
FT   intron          1207..1785
FT                   /number=3
FT   exon            1786..2061
FT                   /number=4
FT   intron          2062..2163
FT                   /number=4
FT   exon            2164..2280
FT                   /number=5
FT   intron          2281..2722
FT                   /number=5
FT   exon            2723..2755
FT                   /number=6
FT   intron          2756..2897
FT                   /number=6
FT   exon            2898..2945
FT                   /number=7
FT   intron          2946..3114
FT                   /number=7
FT   exon            3115..3119
FT                   /number=8
XX
SQ   Sequence 3135 BP; 598 A; 908 C; 968 G; 661 T; 0 other;
     gggagtccca gccttgggga ttccccaact ccgcagtttc ttttctccct ctcccaacct        60
     acgtagggtc cttcatcctg gatactcacg acgcggaccc agttctcact cccattgggt       120
     gtcgggtttc cagagaagcc aatcagtgtc gtcgcggtcg ctgttctaaa gtccgcacgc       180
     acccaccggg actcagattc tccccagacg ccgaggatgg ccgtcatggc gccccgaacc       240
     ctcctcctgc tactctcggg ggccctggcc ctgacccaga cctgggcggg tgagtgcggg       300
     gtcgggaggg aaaccgcctc tgcggggaga agcaaggggc cctcctggcg ggggcgcagg       360
     accgggggag ccgcgccggg aggagggtcg ggcaggtctc agccactgct cgcccccagg       420
     ctcccactcc atgaggtatt tcttcacatc cgtgtcccgg cccggccgcg gggagccccg       480
     cttcatcgcc gtgggctacg tggacgacac gcagttcgtg cggttcgaca gcgacgccgc       540
     gagccagaag atggagccgc gggcgccgtg gatagagcag gaggggccgg agtattggga       600
     ccaggagaca cggaatatga aggcccactc acagactgac cgagcgaacc tggggaccct       660
     gcgcggctac tacaaccaga gcgaggacgg tgagtgaccc cggcccgggg cgcaggtcac       720
     gacccctcat cccccacgga cgggccaggt cgcccacagt ctccgggtcc gagatccacc       780
     ccgaagccgc gggactccga gacccttgtc ccgggagagg cccaggcgcc tttacccggt       840
     ttcattttca gtttaggcca aaaatccccc cgggttggtc ggggcggggc ggggctcggg       900
     ggactgggct gaccgcgggg tcggggccag gttctcacac catccagata atgtatggct       960
     gcgacgtggg gccggacggg cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca      1020
     aggattacat cgccctgaac gaggacctgc gctcttggac cgcggcggac atggcagctc      1080
     agatcaccaa gcgcaagtgg gaggcggtcc atgcggcgga gcagcggaga gtctacctgg      1140
     agggccggtg cgtggacggg ctccgcagat acctggagaa cgggaaggag acgctgcagc      1200
     gcacgggtac caggggccac ggggcgcctc cctgatcgcc tatagatctc ccgggctggc      1260
     ctcccacaag gaggggagac aattgggacc aacactagaa tatcaccctc cctctggtcc      1320
     tgagggagag gaatcctcct gggtttccag atcctgtacc agagagtgac tctgaggttc      1380
     cgccctgctc tctgacacaa ttaagggata aaatctctga aggagtgacg ggaagacgat      1440
     ccctcgaata ctgatgagtg gttccctttg acaccggcag cagccttggg cccgtgactt      1500
     ttcctctcag gccttgttct ctgcttcaca ctcaatgtgt gtgggggtct gagtccagca      1560
     cttctgagtc tctcagcctc cactcaggtc aggaccagaa gtcgctgttc ccttctcagg      1620
     gaatagaaga ttatcccagg tgcctgtgtc caggctggtg tctgggttct gtgctctctt      1680
     ccccatcccg ggtgtcctgt ccattctcaa gatggccaca tgcgtgctgg tggagtgtcc      1740
     catgacagat gcaaaatgcc tgaattttct gactcttccc gtcagacccc cccaagacac      1800
     atatgaccca ccaccccatc tctgaccatg aggccaccct gaggtgctgg gccctgggct      1860
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg ggaggaccag acccaggaca      1920
     cggagctcgt ggagaccagg cctgcagggg atggaacctt ccagaagtgg gcggctgtgg      1980
     tggtgccttc tggagaggag cagagataca cctgccatgt gcagcatgag ggtctgccca      2040
     agcccctcac cctgagatgg ggtaaggagg gagatggggg tgtcatgtct cttagggaaa      2100
     gcaggagcct ctctggagac ctttagcagg gtcagggccc ctcaccttcc cctcttttcc      2160
     cagagctgtc ttcccagccc accatcccca tcgtgggcat cattgctggc ctggttctcc      2220
     ttggagctgt gatcactgga gctgtggtcg ctgccgtgat gtggaggagg aagagctcag      2280
     gtggagaagg ggtgaagggt ggggtctgag atttcttgtc tcactgaggg ttccaagccc      2340
     cagctagaaa tgtgccctgt ctcattactg ggaagcacct tccacaatca tgggccgacc      2400
     cagcctgggc cctgtgtgcc agcacttact cttttgtaaa gcacctgtta aaatgaagga      2460
     cagatttatc accttgatta cggcggtgat gggacctgat cccagcagtc acaagtcaca      2520
     ggggaaggtc cctgaggaca gacctcagga gggctattgg tccaggaccc acacctgctt      2580
     tcttcatgtt tcctgatccc gccctgggtc tgcagtcaca catttctgga aacttctctg      2640
     gggtccaaga ctaggaggtt cctctaggac cttaaggccc tggctccttt ctggtatctc      2700
     acaggacatt ttcttcccac agatagaaaa ggagggagtt acactcaggc tgcaagtaag      2760
     tatgaaggag gctgatgcct gaggtccttg ggatattgtg tttgggagcc catgggggag      2820
     ctcacccacc ccacaattcc tcctctagcc acatcttctg tgggatctga ccaggttctg      2880
     tttttgttct accccaggca gtgacagtgc ccagggctct gatgtgtctc tcacagcttg      2940
     taaaggtgag agcttggagg gcctgatgtg tgttgggtgt tgggtggaac agtggacaca      3000
     gctgtgctat ggggtttctt tgcgttggat gtattgagca tgcgatgggc tgtttaaggt      3060
     gtgacccctc actgtgatgg atatgaattt gttcatgaat atttttttct atagtgtgag      3120
     acagctgcct tgtgt                                                       3135
//