spacer

EBI Dbfetch

ID   Z75172; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   Z75172;
XX
DT   29-APR-1997 (Rel. 51, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   H.sapiens gene for human leukocyte antigen-Cw*1604
XX
KW   HLA-Cw gene; human leukocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-792
RA   Tiercy J.;
RT   ;
RL   Submitted (01-NOV-1996) to the INSDC.
RL   Jean-Marie TIERCY, Transplantation Immunology Unit, Centre Medical
RL   Universitaire, 1, rue Michel Servet, Geneva, 1211, SWITZERLAND
XX
RN   [3]
RP   1-792
RX   DOI; 10.1002/(SICI)1097-0061(199704)13:5<483::AID-YEA105>3.3.CO;2-L.
RX   PUBMED; 9153759.
RA   Jauniaux J.C., Poirey R.;
RT   "Sequencing analysis of a 36.8 kb fragment of yeast chromosome XV reveals
RT   26 open reading frames including SEC63, CDC31, SUG2, GCD1, RBL2, PNT1, PAC1
RT   and VPH1";
RL   Yeast 13(5):483-487(1997).
XX
RN   [4]
RX   DOI; 10.1111/j.1399-0039.1998.tb02949.x.
RX   PUBMED; 9459506.
RA   Grundschober C., Labonne M., Javaux F., Steiner Q.G., Gebuhrer L.,
RA   Tiercy J.M.;
RT   "Sequence of four new HLA-Cw alleles: a possible role of interallelic
RT   recombination";
RL   Tissue Antigens 51(1):72-79(1998).
XX
DR   MD5; 98a69d6718c347d48ee424cb7ada5e56.
DR   Ensembl-Gn; ENSG00000237022; homo_sapiens.
DR   Ensembl-Tr; ENST00000438171; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /sex="F"
FT                   /haplotype="A3,A24; B*1801,B*4402; Cw*1604,Cw*0701;
FT                   DRB1*1104,DRB1*1401; DRB3*02; DQB1*0301,DQB1*0503"
FT                   /cell_line="BOJ"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-Cw*1604"
FT                   /db_xref="GOA:Q29960"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*16:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29960"
FT                   /protein_id="CAA99487.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /number=2
FT   intron          271..516
FT                   /number=2
FT   exon            517..792
FT                   /number=3
XX
SQ   Sequence 792 BP; 138 A; 264 C; 286 G; 104 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctcccg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcggccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcggggc tggggcgggg       480
     ctcgcgggac ggggctgacc acgggggcgg ggccagggtc tcacaccctc cagtggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgc ggcggagcag tggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer