Dbfetch

ID   Z71289; SV 1; linear; genomic DNA; STD; HUM; 224 BP.
XX
AC   Z71289;
XX
DT   30-MAY-1996 (Rel. 47, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   H.sapiens HLA-DRB1*1327 gene
XX
KW   HLA-DRB1; human leukocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-224
RA   Fischer G.F., Moser S., Gleissner B., Fae I.;
RT   "A novel DRB1 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-224
RA   Fischer G.F.;
RT   ;
RL   Submitted (29-MAY-1996) to the INSDC.
RL   Fischer G. F., University of Vienna, Department of blood Group Serology,
RL   waehringer Guertel 18-20, Vienna, Austria, A-1090
XX
DR   MD5; 06a4a0a36e7051b711ce01f7ac98c2cf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..224
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>224
FT                   /codon_start=2
FT                   /gene="HLA-DRB1*1327"
FT                   /db_xref="GOA:Q29804"
FT                   /db_xref="IMGT/HLA:DRB1*13:27"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29804"
FT                   /protein_id="CAA95873.1"
FT                   /translation="SECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPD
FT                   AEYWNSQKDILEDERAAVDTYCRHNYGVV"
XX
SQ   Sequence 224 BP; 49 A; 53 C; 84 G; 38 T; 0 other;
     gtctgagtgt catttcttca atgggacgga gcgggtgcgg tacctggaca gatacttcca        60
     taaccaggag gagaacgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga       120
     gctggggcgg cctgatgccg agtactggaa cagccagaag gacatcctgg aagacgagcg       180
     ggccgcggtg gacacctact gcagacacaa ctacggggtt gtgg                        224
//