spacer

EBI Dbfetch

ID   Z70315; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   Z70315;
XX
DT   27-AUG-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 21)
XX
DE   H.sapiens gene for leukocyte antigen-B7 variant (B*0707)
XX
KW   HLA-B gene; human leukocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RX   DOI; 10.1111/j.1399-0039.1997.tb02787.x.
RX   PUBMED; 9174145.
RA   Grundschober C., Rufer N., Adami N., Breur-Vriesendorp B., Jeannet M.,
RA   Roosnek E., Tiercy J.;
RT   "Sequence of a new HLA-B7 variant, B*0707, that differs from the common
RT   B*0702 allele by one single residue in the peptide binding groove";
RL   Tissue Antigens 49(5):508-511(1997).
XX
RN   [2]
RP   1-792
RA   Tiercy J.;
RT   ;
RL   Submitted (29-MAR-1996) to the INSDC.
RL   Jean-Marie Tiercy, Transplantation Immunology Unit, Centre Medical
RL   Universitaire, 1, rue Michel-Servet, 1211 Geneva, 4, 1211, CH
XX
DR   MD5; 0ce0458be41c65d7b347b99b257090bb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /haplotype="HLA-A1,A2; B7,B35; DRB1*1101,DRB1*1103;
FT                   DRB3*02"
FT                   /cell_line="DAPO"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,517..>586)
FT                   /codon_start=3
FT                   /gene="HLA-B*0707"
FT                   /db_xref="GOA:Q92671"
FT                   /db_xref="IMGT/HLA:B*07:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q92671"
FT                   /protein_id="CAA94390.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGH"
FT   exon            1..270
FT                   /number=2
FT   intron          271..516
FT                   /number=2
FT   exon            517..792
FT                   /number=3
XX
SQ   Sequence 792 BP; 141 A; 262 C; 288 G; 101 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacaccctc cagaggatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcatgaccag tacgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cgagtgcgtg gagtggctcc gcagatacct ggagaacggg aaggacaagc       780
     tggagcgcgc tg                                                           792
//


spacer
spacer