Dbfetch

ID   Z46810; SV 1; linear; mRNA; STD; HUM; 619 BP.
XX
AC   Z46810;
XX
DT   28-NOV-1994 (Rel. 41, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   H.sapiens HLA-Cw*0701 mRNA for HLA-Cw7.
XX
KW   HLA-Cw7.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   (sites)
RX   DOI; 10.1111/j.1399-0039.1994.tb02394.x.
RX   PUBMED; 7871529.
RA   Steinle A., Schendel D.J.;
RT   "HLA class I alleles of LCL 721 and 174 x CEM.T2 (T2)";
RL   Tissue Antigens 44(4):268-270(1994).
XX
RN   [2]
RP   1-619
RA   Steinle A.;
RT   ;
RL   Submitted (28-NOV-1994) to the INSDC.
RL   Steinle A., University of Munich, Institute of Immunology, Goethestrasse
RL   31, D-80336 Muenchen, Bavaria, GERMANY
XX
DR   MD5; 6a98140b0ee917ee7c6888d386bd1fa7.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..619
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="LCL721"
FT                   /mol_type="mRNA"
FT                   /haplotype="A1 B8 Cw7, A2 B51 Cw1"
FT                   /cell_line="LCL721"
FT                   /cell_type="lymphoblastoid B-cell line"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT   CDS             1..>619
FT                   /standard_name="HLA-Cw*0701"
FT                   /product="HLA-Cw7"
FT                   /function="peptide presentation"
FT                   /note="exon 1-3"
FT                   /db_xref="GOA:P10321"
FT                   /db_xref="H-InvDB:HIT000327287.9"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*07:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10321"
FT                   /protein_id="CAA86840.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRA"
FT   mat_peptide     73..>619
FT                   /product="HLA-Cw7"
FT                   /note="exon 2 and 3"
XX
SQ   Sequence 619 BP; 112 A; 203 C; 221 G; 83 T; 0 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttcgaca ccgccgtgtc ccggcccggc       120
     cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaac tacaagcgcc aggcacaggc tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg acgggtctca caccctccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg cccgtgcggc ggagcagctg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcag                                                    619
//