spacer

EBI Dbfetch

ID   Z46808; SV 1; linear; mRNA; STD; HUM; 619 BP.
XX
AC   Z46808;
XX
DT   28-NOV-1994 (Rel. 41, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   H.sapiens HLA-B*5101 mRNA for HLA-B51.
XX
KW   HLA-B51.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   (sites)
RX   DOI; 10.1111/j.1399-0039.1994.tb02394.x.
RX   PUBMED; 7871529.
RA   Steinle A., Schendel D.J.;
RT   "HLA class I alleles of LCL 721 and 174 x CEM.T2 (T2)";
RL   Tissue Antigens 44(4):268-270(1994).
XX
RN   [2]
RP   1-619
RA   Steinle A.;
RT   ;
RL   Submitted (28-NOV-1994) to the INSDC.
RL   Steinle A., University of Munich, Institute of Immunology, Goethestrasse
RL   31, D-80336 Muenchen, Bavaria, GERMANY
XX
DR   MD5; 0df8d85fd5b724cc7eda57cbf975c7b1.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..619
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="LCL721"
FT                   /mol_type="mRNA"
FT                   /haplotype="A1 B8 Cw7, A2 B51 Cw1"
FT                   /cell_line="LCL721"
FT                   /cell_type="lymphoblastoid B-cell line"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT   CDS             1..>619
FT                   /standard_name="HLA-B*5101"
FT                   /product="HLA-B51"
FT                   /function="peptide presentation"
FT                   /note="exon 1-3"
FT                   /db_xref="GOA:P18464"
FT                   /db_xref="H-InvDB:HIT000327285.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*51:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1E27"
FT                   /db_xref="PDB:1E28"
FT                   /db_xref="PDB:4MJI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18464"
FT                   /protein_id="CAA86838.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRA"
FT   mat_peptide     73..>619
FT                   /product="HLA-B51"
FT                   /note="exon 2 and 3"
XX
SQ   Sequence 619 BP; 123 A; 199 C; 213 G; 84 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat tgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag       300
     aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccgggtctca cacttggcag       360
     acgatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagtac       420
     gcctacgacg gcaaagatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gacacctgga gaacgggaag       600
     gagacgctgc agcgcgcgg                                                    619
//


spacer
spacer