spacer

EBI Dbfetch

ID   Z35099; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   Z35099;
XX
DT   01-OCT-1994 (Rel. 41, Created)
DT   14-JUN-2010 (Rel. 105, Last updated, Version 9)
XX
DE   H.sapiens HLA-DQB1 gene encoding beta chain HLA-DQ molecule.
XX
KW   HLA-DQ gene; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   (sites)
RA   Fajardy I., Perichon B., Bianchi F., Rousseaux J., Krishnamoorthy R.,
RA   Danze P.;
RT   "A new allele HLA-DQB1 reveals HLA-DQW2 heterogeneity";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Fajardy I.;
RT   ;
RL   Submitted (05-JUL-1994) to the INSDC.
RL   FAJARDY I., CENTRE HOSPITALIER HOPITAL B, LABORATOIRE DE BIOCHIMIE, BD DU
RL   PROFESSEUR J LECLERCQ, LILLE, FRANCE, 59000
XX
DR   MD5; cc3c2f31f592606262373bcd955a2d5f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /cell_type="leucocytes"
FT                   /tissue_type="Blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..270
FT                   /partial
FT                   /codon_start=1
FT                   /standard_name="DQB1"
FT                   /product="beta chain HLA-DQ molecule"
FT                   /db_xref="GOA:Q29917"
FT                   /db_xref="IMGT/HLA:DQB1*02:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29917"
FT                   /protein_id="CAA84482.1"
FT                   /translation="RDSPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDEV
FT                   GFRAVTLLGLRDAEYWNSQKDILERKRAAVDRVCRHNYQLELRTT"
FT   variation       169..171
FT                   /gene="HLA-DQB1"
FT                   /standard_name="*201"
FT                   /replace="gac"
FT                   /frequency=".2"
XX
SQ   Sequence 270 BP; 63 A; 66 C; 95 G; 46 T; 0 other;
     agagactctc ccgaggattt cgtgtaccag tttaagggga tgtgctactt caccaacggg        60
     acagagcgcg tgcgtcttgt gagcagaagc atctataacc gagaagagat cgtgcgcttc       120
     gacagcgacg aggtggggtt ccgggcggtg acgctgctgg ggctgcgtga cgccgagtac       180
     tggaacagcc agaaggacat cctggagagg aaacgggcgg cggtggacag ggtgtgcaga       240
     cacaactacc agttggagct ccgcacgacc                                        270
//


spacer
spacer