spacer

EBI Dbfetch

ID   Z34921; SV 1; linear; genomic DNA; STD; HUM; 1098 BP.
XX
AC   Z34921;
XX
DT   04-JUL-1994 (Rel. 40, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   H.sapiens DNA for HLA-A locus alpha 1 domain, exons 2 & 3
XX
KW   human leukocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270,271-496
RX   DOI; 10.1016/0198-8859(95)00046-7.
RX   PUBMED; 8522453.
RA   Krausa P., Carcassi C., Orru S., Bodmer J.G., Browning M.J., Contu L.;
RT   "Defining the allelic variants of HLA-A30 in the Sardinian population using
RT   amplification refractory mutation system--polymerase chain reaction";
RL   Hum. Immunol. 44(1):35-42(1995).
XX
RN   [2]
RP   1-496
RA   Krausa P.;
RT   ;
RL   Submitted (01-JUL-1994) to the INSDC.
RL   Peter Krausa, Cancer Immunology Laboratory, Institute of Molecular
RL   Medicine, John Radcliffe Hospital, Headington, Oxford, Oxfordshire, OX3
RL   9DU, UK
XX
RN   [3]
RP   1-1098
RA   Krausa P.;
RT   ;
RL   Submitted (10-FEB-1995) to the INSDC.
RL   Peter Krausa, Cancer Immunology Laboratory, Institute of Molecular
RL   Medicine, John Radcliffe Hospital, Headington, Oxford, Oxfordshire, OX3
RL   9DU, UK
XX
DR   MD5; 3b466dddbc4630cc32add743a043b963.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /isolate="'W7' from a Sardinian population study"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="Lymphocyte"
FT                   /tissue_type="HLA-A11 A30v B49"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /product="HLA-A locus alpha 2 domain"
FT                   /db_xref="GOA:P16188"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*30:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16188"
FT                   /protein_id="CAA84401.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQTDRENLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 1098 BP; 224 A; 328 C; 365 G; 181 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc       120
     agtggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagagg       240
     cctgagtatt gggaccagga gacacggaat gtgaaggccc actcacagac tgaccgagag       300
     aacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta tgaacagcac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccatgtggc ggagcagtgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagtt acactcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer