spacer

EBI Dbfetch

ID   Z23071; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   Z23071;
XX
DT   22-JUN-1993 (Rel. 36, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   H.sapiens mRNA for HLA-A*0210
XX
KW   HLA-A*0210; major histocompatibility complex class I.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1007/BF00395859.
RX   PUBMED; 2783680.
RA   Epstein H., Kennedy L., Holmes N.;
RT   "An Oriental HLA-A2 subtype is closely related to a subset of Caucasoid
RT   HLA-A2 alleles";
RL   Immunogenetics 29(2):112-116(1989).
XX
RN   [2]
RP   1-1098
RA   Holmes N.;
RT   ;
RL   Submitted (18-JUN-1993) to the INSDC.
RL   Holmes N., Cambridge University, Pathology, Tennis Court Rd, Cambridge, UK,
RL   CB2 1QP
XX
DR   MD5; 02aae896cb5c8991e6f8af9bc4838de6.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /cell_line="XLI"
FT                   /cell_type="B lymphoblastoid (EBV transformed)"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /product="HLA-A*0210"
FT                   /function="major histocompatibility complex class 1
FT                   glycoprotein"
FT                   /note="even though the sequence is from genomic DNA intron
FT                   sequences were not provided"
FT                   /db_xref="GOA:P01892"
FT                   /db_xref="H-InvDB:HIT000326689.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*02:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1AKJ"
FT                   /db_xref="PDB:1AO7"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1B0G"
FT                   /db_xref="PDB:1B0R"
FT                   /db_xref="PDB:1BD2"
FT                   /db_xref="PDB:1DUY"
FT                   /db_xref="PDB:1DUZ"
FT                   /db_xref="PDB:1EEY"
FT                   /db_xref="PDB:1EEZ"
FT                   /db_xref="PDB:1HHG"
FT                   /db_xref="PDB:1HHH"
FT                   /db_xref="PDB:1HHI"
FT                   /db_xref="PDB:1HHJ"
FT                   /db_xref="PDB:1HHK"
FT                   /db_xref="PDB:1HLA"
FT                   /db_xref="PDB:1I1F"
FT                   /db_xref="PDB:1I1Y"
FT                   /db_xref="PDB:1I4F"
FT                   /db_xref="PDB:1I7R"
FT                   /db_xref="PDB:1I7T"
FT                   /db_xref="PDB:1I7U"
FT                   /db_xref="PDB:1IM3"
FT                   /db_xref="PDB:1JF1"
FT                   /db_xref="PDB:1JHT"
FT                   /db_xref="PDB:1LP9"
FT                   /db_xref="PDB:1OGA"
FT                   /db_xref="PDB:1P7Q"
FT                   /db_xref="PDB:1QEW"
FT                   /db_xref="PDB:1QR1"
FT                   /db_xref="PDB:1QRN"
FT                   /db_xref="PDB:1QSE"
FT                   /db_xref="PDB:1QSF"
FT                   /db_xref="PDB:1S8D"
FT                   /db_xref="PDB:1S9W"
FT                   /db_xref="PDB:1S9X"
FT                   /db_xref="PDB:1S9Y"
FT                   /db_xref="PDB:1T1W"
FT                   /db_xref="PDB:1T1X"
FT                   /db_xref="PDB:1T1Y"
FT                   /db_xref="PDB:1T1Z"
FT                   /db_xref="PDB:1T20"
FT                   /db_xref="PDB:1T21"
FT                   /db_xref="PDB:1T22"
FT                   /db_xref="PDB:1TVB"
FT                   /db_xref="PDB:1TVH"
FT                   /db_xref="PDB:1UR7"
FT                   /db_xref="PDB:2AV1"
FT                   /db_xref="PDB:2AV7"
FT                   /db_xref="PDB:2BNQ"
FT                   /db_xref="PDB:2BNR"
FT                   /db_xref="PDB:2C7U"
FT                   /db_xref="PDB:2CLR"
FT                   /db_xref="PDB:2F53"
FT                   /db_xref="PDB:2F54"
FT                   /db_xref="PDB:2GIT"
FT                   /db_xref="PDB:2GJ6"
FT                   /db_xref="PDB:2GT9"
FT                   /db_xref="PDB:2GTW"
FT                   /db_xref="PDB:2GTZ"
FT                   /db_xref="PDB:2GUO"
FT                   /db_xref="PDB:2J8U"
FT                   /db_xref="PDB:2JCC"
FT                   /db_xref="PDB:2P5E"
FT                   /db_xref="PDB:2P5W"
FT                   /db_xref="PDB:2PYE"
FT                   /db_xref="PDB:2UWE"
FT                   /db_xref="PDB:2V2W"
FT                   /db_xref="PDB:2V2X"
FT                   /db_xref="PDB:2VLJ"
FT                   /db_xref="PDB:2VLK"
FT                   /db_xref="PDB:2VLL"
FT                   /db_xref="PDB:2VLR"
FT                   /db_xref="PDB:2X4N"
FT                   /db_xref="PDB:2X4O"
FT                   /db_xref="PDB:2X4P"
FT                   /db_xref="PDB:2X4Q"
FT                   /db_xref="PDB:2X4R"
FT                   /db_xref="PDB:2X4S"
FT                   /db_xref="PDB:2X4T"
FT                   /db_xref="PDB:2X4U"
FT                   /db_xref="PDB:2X70"
FT                   /db_xref="PDB:3BGM"
FT                   /db_xref="PDB:3BH8"
FT                   /db_xref="PDB:3BH9"
FT                   /db_xref="PDB:3BHB"
FT                   /db_xref="PDB:3D25"
FT                   /db_xref="PDB:3D39"
FT                   /db_xref="PDB:3D3V"
FT                   /db_xref="PDB:3FQN"
FT                   /db_xref="PDB:3FQR"
FT                   /db_xref="PDB:3FQT"
FT                   /db_xref="PDB:3FQU"
FT                   /db_xref="PDB:3FQW"
FT                   /db_xref="PDB:3FQX"
FT                   /db_xref="PDB:3FT2"
FT                   /db_xref="PDB:3FT3"
FT                   /db_xref="PDB:3FT4"
FT                   /db_xref="PDB:3GIV"
FT                   /db_xref="PDB:3GJF"
FT                   /db_xref="PDB:3GSN"
FT                   /db_xref="PDB:3GSO"
FT                   /db_xref="PDB:3GSQ"
FT                   /db_xref="PDB:3GSR"
FT                   /db_xref="PDB:3GSU"
FT                   /db_xref="PDB:3GSV"
FT                   /db_xref="PDB:3GSW"
FT                   /db_xref="PDB:3GSX"
FT                   /db_xref="PDB:3H7B"
FT                   /db_xref="PDB:3H9H"
FT                   /db_xref="PDB:3H9S"
FT                   /db_xref="PDB:3HAE"
FT                   /db_xref="PDB:3HLA"
FT                   /db_xref="PDB:3HPJ"
FT                   /db_xref="PDB:3I6G"
FT                   /db_xref="PDB:3I6K"
FT                   /db_xref="PDB:3IXA"
FT                   /db_xref="PDB:3KLA"
FT                   /db_xref="PDB:3MGO"
FT                   /db_xref="PDB:3MGT"
FT                   /db_xref="PDB:3MR9"
FT                   /db_xref="PDB:3MRB"
FT                   /db_xref="PDB:3MRC"
FT                   /db_xref="PDB:3MRD"
FT                   /db_xref="PDB:3MRE"
FT                   /db_xref="PDB:3MRF"
FT                   /db_xref="PDB:3MRG"
FT                   /db_xref="PDB:3MRH"
FT                   /db_xref="PDB:3MRI"
FT                   /db_xref="PDB:3MRJ"
FT                   /db_xref="PDB:3MRK"
FT                   /db_xref="PDB:3MRL"
FT                   /db_xref="PDB:3MRM"
FT                   /db_xref="PDB:3MRN"
FT                   /db_xref="PDB:3MRO"
FT                   /db_xref="PDB:3MRP"
FT                   /db_xref="PDB:3MRQ"
FT                   /db_xref="PDB:3MRR"
FT                   /db_xref="PDB:3MYJ"
FT                   /db_xref="PDB:3O3A"
FT                   /db_xref="PDB:3O3B"
FT                   /db_xref="PDB:3O3D"
FT                   /db_xref="PDB:3O3E"
FT                   /db_xref="PDB:3O4L"
FT                   /db_xref="PDB:3PWJ"
FT                   /db_xref="PDB:3PWL"
FT                   /db_xref="PDB:3PWN"
FT                   /db_xref="PDB:3PWP"
FT                   /db_xref="PDB:3QDG"
FT                   /db_xref="PDB:3QDJ"
FT                   /db_xref="PDB:3QDM"
FT                   /db_xref="PDB:3QEQ"
FT                   /db_xref="PDB:3QFD"
FT                   /db_xref="PDB:3QFJ"
FT                   /db_xref="PDB:3REW"
FT                   /db_xref="PDB:3TO2"
FT                   /db_xref="PDB:3UTQ"
FT                   /db_xref="PDB:3UTS"
FT                   /db_xref="PDB:3UTT"
FT                   /db_xref="PDB:3V5D"
FT                   /db_xref="PDB:3V5H"
FT                   /db_xref="PDB:3V5K"
FT                   /db_xref="PDB:4E5X"
FT                   /db_xref="PDB:4EMZ"
FT                   /db_xref="PDB:4EN2"
FT                   /db_xref="PDB:4EUP"
FT                   /db_xref="PDB:4EUQ"
FT                   /db_xref="PDB:4FTV"
FT                   /db_xref="PDB:4GKN"
FT                   /db_xref="PDB:4GKS"
FT                   /db_xref="PDB:4I4W"
FT                   /db_xref="PDB:4JFD"
FT                   /db_xref="PDB:4JFE"
FT                   /db_xref="PDB:4JFF"
FT                   /db_xref="PDB:4JFO"
FT                   /db_xref="PDB:4JFP"
FT                   /db_xref="PDB:4JFQ"
FT                   /db_xref="PDB:4K7F"
FT                   /db_xref="PDB:4L29"
FT                   /db_xref="PDB:4L3C"
FT                   /db_xref="PDB:4L3E"
FT                   /db_xref="PDB:4MNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01892"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA80612.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 1098 BP; 219 A; 324 C; 369 G; 186 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc        60
     cagacctggg cgggctctca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggt       240
     ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac tcaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccgtccag       360
     aggatgtttg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagaccac caagcacaag tgggaggcgg cccatgtggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cgcccccaaa acgcatatga ctcaccacgc tgtctctgac       660
     catgaagcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct       960
     gtgatcactg gagctgtggt cgctgctgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer