Dbfetch
ID Z23071; SV 1; linear; mRNA; STD; HUM; 1098 BP. XX AC Z23071; XX DT 22-JUN-1993 (Rel. 36, Created) DT 17-JUN-2008 (Rel. 96, Last updated, Version 2) XX DE H.sapiens mRNA for HLA-A*0210 XX KW HLA-A*0210; major histocompatibility complex class I. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-1098 RX DOI; 10.1007/BF00395859. RX PUBMED; 2783680. RA Epstein H., Kennedy L., Holmes N.; RT "An Oriental HLA-A2 subtype is closely related to a subset of Caucasoid RT HLA-A2 alleles"; RL Immunogenetics 29(2):112-116(1989). XX RN [2] RP 1-1098 RA Holmes N.; RT ; RL Submitted (18-JUN-1993) to the INSDC. RL Holmes N., Cambridge University, Pathology, Tennis Court Rd, Cambridge, UK, RL CB2 1QP XX DR MD5; 02aae896cb5c8991e6f8af9bc4838de6. DR Ensembl-Gn; ENSG00000235657; homo_sapiens. DR Ensembl-Tr; ENST00000457879; homo_sapiens. DR Ensembl-Tr; ENST00000547271; homo_sapiens. XX FH Key Location/Qualifiers FH FT source 1..1098 FT /organism="Homo sapiens" FT /chromosome="6" FT /mol_type="mRNA" FT /cell_line="XLI" FT /cell_type="B lymphoblastoid (EBV transformed)" FT /db_xref="taxon:9606" FT CDS 1..1098 FT /product="HLA-A*0210" FT /function="major histocompatibility complex class 1 FT glycoprotein" FT /note="even though the sequence is from genomic DNA intron FT sequences were not provided" FT /db_xref="GOA:P01892" FT /db_xref="H-InvDB:HIT000326689.14" FT /db_xref="HGNC:HGNC:4931" FT /db_xref="IMGT/HLA:A*02:10" FT /db_xref="InterPro:IPR001039" FT /db_xref="InterPro:IPR003006" FT /db_xref="InterPro:IPR003597" FT /db_xref="InterPro:IPR007110" FT /db_xref="InterPro:IPR010579" FT /db_xref="InterPro:IPR011161" FT /db_xref="InterPro:IPR011162" FT /db_xref="InterPro:IPR013783" FT /db_xref="InterPro:IPR036179" FT /db_xref="InterPro:IPR037055" FT /db_xref="PDB:1AKJ" FT /db_xref="PDB:1AO7" FT /db_xref="PDB:1AQD" FT /db_xref="PDB:1B0G" FT /db_xref="PDB:1B0R" FT /db_xref="PDB:1BD2" FT /db_xref="PDB:1DUY" FT /db_xref="PDB:1DUZ" FT /db_xref="PDB:1EEY" FT /db_xref="PDB:1EEZ" FT /db_xref="PDB:1HHG" FT /db_xref="PDB:1HHH" FT /db_xref="PDB:1HHI" FT /db_xref="PDB:1HHJ" FT /db_xref="PDB:1HHK" FT /db_xref="PDB:1HLA" FT /db_xref="PDB:1I1F" FT /db_xref="PDB:1I1Y" FT /db_xref="PDB:1I4F" FT /db_xref="PDB:1I7R" FT /db_xref="PDB:1I7T" FT /db_xref="PDB:1I7U" FT /db_xref="PDB:1IM3" FT /db_xref="PDB:1JF1" FT /db_xref="PDB:1JHT" FT /db_xref="PDB:1LP9" FT /db_xref="PDB:1OGA" FT /db_xref="PDB:1P7Q" FT /db_xref="PDB:1QEW" FT /db_xref="PDB:1QR1" FT /db_xref="PDB:1QRN" FT /db_xref="PDB:1QSE" FT /db_xref="PDB:1QSF" FT /db_xref="PDB:1S8D" FT /db_xref="PDB:1S9W" FT /db_xref="PDB:1S9X" FT /db_xref="PDB:1S9Y" FT /db_xref="PDB:1T1W" FT /db_xref="PDB:1T1X" FT /db_xref="PDB:1T1Y" FT /db_xref="PDB:1T1Z" FT /db_xref="PDB:1T20" FT /db_xref="PDB:1T21" FT /db_xref="PDB:1T22" FT /db_xref="PDB:1TVB" FT /db_xref="PDB:1TVH" FT /db_xref="PDB:1UR7" FT /db_xref="PDB:2AV1" FT /db_xref="PDB:2AV7" FT /db_xref="PDB:2BNQ" FT /db_xref="PDB:2BNR" FT /db_xref="PDB:2C7U" FT /db_xref="PDB:2CLR" FT /db_xref="PDB:2F53" FT /db_xref="PDB:2F54" FT /db_xref="PDB:2GIT" FT /db_xref="PDB:2GJ6" FT /db_xref="PDB:2GT9" FT /db_xref="PDB:2GTW" FT /db_xref="PDB:2GTZ" FT /db_xref="PDB:2GUO" FT /db_xref="PDB:2J8U" FT /db_xref="PDB:2JCC" FT /db_xref="PDB:2P5E" FT /db_xref="PDB:2P5W" FT /db_xref="PDB:2PYE" FT /db_xref="PDB:2UWE" FT /db_xref="PDB:2V2W" FT /db_xref="PDB:2V2X" FT /db_xref="PDB:2VLJ" FT /db_xref="PDB:2VLK" FT /db_xref="PDB:2VLL" FT /db_xref="PDB:2VLR" FT /db_xref="PDB:2X4N" FT /db_xref="PDB:2X4O" FT /db_xref="PDB:2X4P" FT /db_xref="PDB:2X4Q" FT /db_xref="PDB:2X4R" FT /db_xref="PDB:2X4S" FT /db_xref="PDB:2X4T" FT /db_xref="PDB:2X4U" FT /db_xref="PDB:2X70" FT /db_xref="PDB:3BGM" FT /db_xref="PDB:3BH8" FT /db_xref="PDB:3BH9" FT /db_xref="PDB:3BHB" FT /db_xref="PDB:3D25" FT /db_xref="PDB:3D39" FT /db_xref="PDB:3D3V" FT /db_xref="PDB:3FQN" FT /db_xref="PDB:3FQR" FT /db_xref="PDB:3FQT" FT /db_xref="PDB:3FQU" FT /db_xref="PDB:3FQW" FT /db_xref="PDB:3FQX" FT /db_xref="PDB:3FT2" FT /db_xref="PDB:3FT3" FT /db_xref="PDB:3FT4" FT /db_xref="PDB:3GIV" FT /db_xref="PDB:3GJF" FT /db_xref="PDB:3GSN" FT /db_xref="PDB:3GSO" FT /db_xref="PDB:3GSQ" FT /db_xref="PDB:3GSR" FT /db_xref="PDB:3GSU" FT /db_xref="PDB:3GSV" FT /db_xref="PDB:3GSW" FT /db_xref="PDB:3GSX" FT /db_xref="PDB:3H7B" FT /db_xref="PDB:3H9H" FT /db_xref="PDB:3H9S" FT /db_xref="PDB:3HAE" FT /db_xref="PDB:3HLA" FT /db_xref="PDB:3HPJ" FT /db_xref="PDB:3I6G" FT /db_xref="PDB:3I6K" FT /db_xref="PDB:3IXA" FT /db_xref="PDB:3KLA" FT /db_xref="PDB:3MGO" FT /db_xref="PDB:3MGT" FT /db_xref="PDB:3MR9" FT /db_xref="PDB:3MRB" FT /db_xref="PDB:3MRC" FT /db_xref="PDB:3MRD" FT /db_xref="PDB:3MRE" FT /db_xref="PDB:3MRF" FT /db_xref="PDB:3MRG" FT /db_xref="PDB:3MRH" FT /db_xref="PDB:3MRI" FT /db_xref="PDB:3MRJ" FT /db_xref="PDB:3MRK" FT /db_xref="PDB:3MRL" FT /db_xref="PDB:3MRM" FT /db_xref="PDB:3MRN" FT /db_xref="PDB:3MRO" FT /db_xref="PDB:3MRP" FT /db_xref="PDB:3MRQ" FT /db_xref="PDB:3MRR" FT /db_xref="PDB:3MYJ" FT /db_xref="PDB:3O3A" FT /db_xref="PDB:3O3B" FT /db_xref="PDB:3O3D" FT /db_xref="PDB:3O3E" FT /db_xref="PDB:3O4L" FT /db_xref="PDB:3PWJ" FT /db_xref="PDB:3PWL" FT /db_xref="PDB:3PWN" FT /db_xref="PDB:3PWP" FT /db_xref="PDB:3QDG" FT /db_xref="PDB:3QDJ" FT /db_xref="PDB:3QDM" FT /db_xref="PDB:3QEQ" FT /db_xref="PDB:3QFD" FT /db_xref="PDB:3QFJ" FT /db_xref="PDB:3REW" FT /db_xref="PDB:3TO2" FT /db_xref="PDB:3UTQ" FT /db_xref="PDB:3UTS" FT /db_xref="PDB:3UTT" FT /db_xref="PDB:3V5D" FT /db_xref="PDB:3V5H" FT /db_xref="PDB:3V5K" FT /db_xref="PDB:4E5X" FT /db_xref="PDB:4EMZ" FT /db_xref="PDB:4EN2" FT /db_xref="PDB:4EUP" FT /db_xref="PDB:4FTV" FT /db_xref="PDB:4GKN" FT /db_xref="PDB:4GKS" FT /db_xref="PDB:4I4W" FT /db_xref="PDB:4JFD" FT /db_xref="PDB:4JFE" FT /db_xref="PDB:4JFF" FT /db_xref="PDB:4JFO" FT /db_xref="PDB:4JFP" FT /db_xref="PDB:4JFQ" FT /db_xref="PDB:4K7F" FT /db_xref="PDB:4L29" FT /db_xref="PDB:4L3C" FT /db_xref="PDB:4L3E" FT /db_xref="PDB:4MNQ" FT /db_xref="PDB:4NNX" FT /db_xref="PDB:4NNY" FT /db_xref="PDB:4NO0" FT /db_xref="PDB:4NO2" FT /db_xref="PDB:4NO3" FT /db_xref="PDB:4NO5" FT /db_xref="PDB:4OV5" FT /db_xref="PDB:4QOK" FT /db_xref="PDB:4U6X" FT /db_xref="PDB:4U6Y" FT /db_xref="PDB:4UQ3" FT /db_xref="PDB:4WJ5" FT /db_xref="PDB:4WUU" FT /db_xref="PDB:5C07" FT /db_xref="PDB:5C08" FT /db_xref="PDB:5C09" FT /db_xref="PDB:5C0A" FT /db_xref="PDB:5C0B" FT /db_xref="PDB:5C0C" FT /db_xref="PDB:5C0D" FT /db_xref="PDB:5C0E" FT /db_xref="PDB:5C0F" FT /db_xref="PDB:5C0G" FT /db_xref="PDB:5C0I" FT /db_xref="PDB:5C0J" FT /db_xref="PDB:5D2L" FT /db_xref="PDB:5D2N" FT /db_xref="PDB:5D9S" FT /db_xref="PDB:5DDH" FT /db_xref="PDB:5E00" FT /db_xref="PDB:5E6I" FT /db_xref="PDB:5E9D" FT /db_xref="PDB:5ENW" FT /db_xref="PDB:5EOT" FT /db_xref="PDB:5EU3" FT /db_xref="PDB:5EU4" FT /db_xref="PDB:5EU5" FT /db_xref="PDB:5EU6" FT /db_xref="PDB:5EUO" FT /db_xref="PDB:5F7D" FT /db_xref="PDB:5F9J" FT /db_xref="PDB:5FA3" FT /db_xref="PDB:5FA4" FT /db_xref="PDB:5FDW" FT /db_xref="PDB:5HHM" FT /db_xref="PDB:5HHN" FT /db_xref="PDB:5HHO" FT /db_xref="PDB:5HHP" FT /db_xref="PDB:5HHQ" FT /db_xref="PDB:5HYJ" FT /db_xref="PDB:5IRO" FT /db_xref="PDB:5ISZ" FT /db_xref="PDB:5JHD" FT /db_xref="PDB:5JZI" FT /db_xref="PDB:5MEN" FT /db_xref="PDB:5MEO" FT /db_xref="PDB:5MEP" FT /db_xref="PDB:5MEQ" FT /db_xref="PDB:5MER" FT /db_xref="PDB:5N1Y" FT /db_xref="PDB:5N6B" FT /db_xref="PDB:5NHT" FT /db_xref="PDB:5NME" FT /db_xref="PDB:5NMF" FT /db_xref="PDB:5NMG" FT /db_xref="PDB:5NMH" FT /db_xref="PDB:5NMK" FT /db_xref="PDB:5NQK" FT /db_xref="PDB:5SWQ" FT /db_xref="PDB:5TEZ" FT /db_xref="PDB:5W1W" FT /db_xref="PDB:5WSH" FT /db_xref="UniProtKB/Swiss-Prot:P01892" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAA80612.1" FT /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR FT FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT FT LRGYYNQSEAGSHTVQRMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA FT AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE FT ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY FT TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK FT GGSYSQAASSDSAQGSDVSLTACKV" XX SQ Sequence 1098 BP; 219 A; 324 C; 369 G; 186 T; 0 other; atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc 60 cagacctggg cgggctctca ctccatgagg tatttctaca cctccgtgtc ccggcccggc 120 cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc 180 gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggt 240 ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac tcaccgagtg 300 gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccgtccag 360 aggatgtttg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccaccagtac 420 gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg 480 gacatggcag ctcagaccac caagcacaag tgggaggcgg cccatgtggc ggagcagttg 540 agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag 600 gagacgctgc agcgcacgga cgcccccaaa acgcatatga ctcaccacgc tgtctctgac 660 catgaagcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc 720 tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca 780 ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaca ggagcagaga 840 tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag atgggagccg 900 tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct 960 gtgatcactg gagctgtggt cgctgctgtg atgtggagga ggaagagctc agatagaaaa 1020 ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc 1080 acagcttgta aagtgtga 1098 //