ID Z23071; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC Z23071;
XX
DT 22-JUN-1993 (Rel. 36, Created)
DT 17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE H.sapiens mRNA for HLA-A*0210
XX
KW HLA-A*0210; major histocompatibility complex class I.
XX
OS Homo sapiens (human)
OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC Homo.
XX
RN [1]
RP 1-1098
RX DOI; 10.1007/BF00395859.
RX PUBMED; 2783680.
RA Epstein H., Kennedy L., Holmes N.;
RT "An Oriental HLA-A2 subtype is closely related to a subset of Caucasoid
RT HLA-A2 alleles";
RL Immunogenetics 29(2):112-116(1989).
XX
RN [2]
RP 1-1098
RA Holmes N.;
RT ;
RL Submitted (18-JUN-1993) to the INSDC.
RL Holmes N., Cambridge University, Pathology, Tennis Court Rd, Cambridge, UK,
RL CB2 1QP
XX
DR MD5; 02aae896cb5c8991e6f8af9bc4838de6.
DR Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR Ensembl-Tr; ENST00000457879; homo_sapiens.
DR Ensembl-Tr; ENST00000547271; homo_sapiens.
XX
FH Key Location/Qualifiers
FH
FT source 1..1098
FT /organism="Homo sapiens"
FT /chromosome="6"
FT /mol_type="mRNA"
FT /cell_line="XLI"
FT /cell_type="B lymphoblastoid (EBV transformed)"
FT /db_xref="taxon:9606"
FT CDS 1..1098
FT /product="HLA-A*0210"
FT /function="major histocompatibility complex class 1
FT glycoprotein"
FT /note="even though the sequence is from genomic DNA intron
FT sequences were not provided"
FT /db_xref="GOA:P01892"
FT /db_xref="H-InvDB:HIT000326689.14"
FT /db_xref="HGNC:HGNC:4931"
FT /db_xref="IMGT/HLA:A*02:10"
FT /db_xref="InterPro:IPR001039"
FT /db_xref="InterPro:IPR003006"
FT /db_xref="InterPro:IPR003597"
FT /db_xref="InterPro:IPR007110"
FT /db_xref="InterPro:IPR010579"
FT /db_xref="InterPro:IPR011161"
FT /db_xref="InterPro:IPR011162"
FT /db_xref="InterPro:IPR013783"
FT /db_xref="InterPro:IPR036179"
FT /db_xref="InterPro:IPR037055"
FT /db_xref="PDB:1AKJ"
FT /db_xref="PDB:1AO7"
FT /db_xref="PDB:1AQD"
FT /db_xref="PDB:1B0G"
FT /db_xref="PDB:1B0R"
FT /db_xref="PDB:1BD2"
FT /db_xref="PDB:1DUY"
FT /db_xref="PDB:1DUZ"
FT /db_xref="PDB:1EEY"
FT /db_xref="PDB:1EEZ"
FT /db_xref="PDB:1HHG"
FT /db_xref="PDB:1HHH"
FT /db_xref="PDB:1HHI"
FT /db_xref="PDB:1HHJ"
FT /db_xref="PDB:1HHK"
FT /db_xref="PDB:1HLA"
FT /db_xref="PDB:1I1F"
FT /db_xref="PDB:1I1Y"
FT /db_xref="PDB:1I4F"
FT /db_xref="PDB:1I7R"
FT /db_xref="PDB:1I7T"
FT /db_xref="PDB:1I7U"
FT /db_xref="PDB:1IM3"
FT /db_xref="PDB:1JF1"
FT /db_xref="PDB:1JHT"
FT /db_xref="PDB:1LP9"
FT /db_xref="PDB:1OGA"
FT /db_xref="PDB:1P7Q"
FT /db_xref="PDB:1QEW"
FT /db_xref="PDB:1QR1"
FT /db_xref="PDB:1QRN"
FT /db_xref="PDB:1QSE"
FT /db_xref="PDB:1QSF"
FT /db_xref="PDB:1S8D"
FT /db_xref="PDB:1S9W"
FT /db_xref="PDB:1S9X"
FT /db_xref="PDB:1S9Y"
FT /db_xref="PDB:1T1W"
FT /db_xref="PDB:1T1X"
FT /db_xref="PDB:1T1Y"
FT /db_xref="PDB:1T1Z"
FT /db_xref="PDB:1T20"
FT /db_xref="PDB:1T21"
FT /db_xref="PDB:1T22"
FT /db_xref="PDB:1TVB"
FT /db_xref="PDB:1TVH"
FT /db_xref="PDB:1UR7"
FT /db_xref="PDB:2AV1"
FT /db_xref="PDB:2AV7"
FT /db_xref="PDB:2BNQ"
FT /db_xref="PDB:2BNR"
FT /db_xref="PDB:2C7U"
FT /db_xref="PDB:2CLR"
FT /db_xref="PDB:2F53"
FT /db_xref="PDB:2F54"
FT /db_xref="PDB:2GIT"
FT /db_xref="PDB:2GJ6"
FT /db_xref="PDB:2GT9"
FT /db_xref="PDB:2GTW"
FT /db_xref="PDB:2GTZ"
FT /db_xref="PDB:2GUO"
FT /db_xref="PDB:2J8U"
FT /db_xref="PDB:2JCC"
FT /db_xref="PDB:2P5E"
FT /db_xref="PDB:2P5W"
FT /db_xref="PDB:2PYE"
FT /db_xref="PDB:2UWE"
FT /db_xref="PDB:2V2W"
FT /db_xref="PDB:2V2X"
FT /db_xref="PDB:2VLJ"
FT /db_xref="PDB:2VLK"
FT /db_xref="PDB:2VLL"
FT /db_xref="PDB:2VLR"
FT /db_xref="PDB:2X4N"
FT /db_xref="PDB:2X4O"
FT /db_xref="PDB:2X4P"
FT /db_xref="PDB:2X4Q"
FT /db_xref="PDB:2X4R"
FT /db_xref="PDB:2X4S"
FT /db_xref="PDB:2X4T"
FT /db_xref="PDB:2X4U"
FT /db_xref="PDB:2X70"
FT /db_xref="PDB:3BGM"
FT /db_xref="PDB:3BH8"
FT /db_xref="PDB:3BH9"
FT /db_xref="PDB:3BHB"
FT /db_xref="PDB:3D25"
FT /db_xref="PDB:3D39"
FT /db_xref="PDB:3D3V"
FT /db_xref="PDB:3FQN"
FT /db_xref="PDB:3FQR"
FT /db_xref="PDB:3FQT"
FT /db_xref="PDB:3FQU"
FT /db_xref="PDB:3FQW"
FT /db_xref="PDB:3FQX"
FT /db_xref="PDB:3FT2"
FT /db_xref="PDB:3FT3"
FT /db_xref="PDB:3FT4"
FT /db_xref="PDB:3GIV"
FT /db_xref="PDB:3GJF"
FT /db_xref="PDB:3GSN"
FT /db_xref="PDB:3GSO"
FT /db_xref="PDB:3GSQ"
FT /db_xref="PDB:3GSR"
FT /db_xref="PDB:3GSU"
FT /db_xref="PDB:3GSV"
FT /db_xref="PDB:3GSW"
FT /db_xref="PDB:3GSX"
FT /db_xref="PDB:3H7B"
FT /db_xref="PDB:3H9H"
FT /db_xref="PDB:3H9S"
FT /db_xref="PDB:3HAE"
FT /db_xref="PDB:3HLA"
FT /db_xref="PDB:3HPJ"
FT /db_xref="PDB:3I6G"
FT /db_xref="PDB:3I6K"
FT /db_xref="PDB:3IXA"
FT /db_xref="PDB:3KLA"
FT /db_xref="PDB:3MGO"
FT /db_xref="PDB:3MGT"
FT /db_xref="PDB:3MR9"
FT /db_xref="PDB:3MRB"
FT /db_xref="PDB:3MRC"
FT /db_xref="PDB:3MRD"
FT /db_xref="PDB:3MRE"
FT /db_xref="PDB:3MRF"
FT /db_xref="PDB:3MRG"
FT /db_xref="PDB:3MRH"
FT /db_xref="PDB:3MRI"
FT /db_xref="PDB:3MRJ"
FT /db_xref="PDB:3MRK"
FT /db_xref="PDB:3MRL"
FT /db_xref="PDB:3MRM"
FT /db_xref="PDB:3MRN"
FT /db_xref="PDB:3MRO"
FT /db_xref="PDB:3MRP"
FT /db_xref="PDB:3MRQ"
FT /db_xref="PDB:3MRR"
FT /db_xref="PDB:3MYJ"
FT /db_xref="PDB:3O3A"
FT /db_xref="PDB:3O3B"
FT /db_xref="PDB:3O3D"
FT /db_xref="PDB:3O3E"
FT /db_xref="PDB:3O4L"
FT /db_xref="PDB:3PWJ"
FT /db_xref="PDB:3PWL"
FT /db_xref="PDB:3PWN"
FT /db_xref="PDB:3PWP"
FT /db_xref="PDB:3QDG"
FT /db_xref="PDB:3QDJ"
FT /db_xref="PDB:3QDM"
FT /db_xref="PDB:3QEQ"
FT /db_xref="PDB:3QFD"
FT /db_xref="PDB:3QFJ"
FT /db_xref="PDB:3REW"
FT /db_xref="PDB:3TO2"
FT /db_xref="PDB:3UTQ"
FT /db_xref="PDB:3UTS"
FT /db_xref="PDB:3UTT"
FT /db_xref="PDB:3V5D"
FT /db_xref="PDB:3V5H"
FT /db_xref="PDB:3V5K"
FT /db_xref="PDB:4E5X"
FT /db_xref="PDB:4EMZ"
FT /db_xref="PDB:4EN2"
FT /db_xref="PDB:4EUP"
FT /db_xref="PDB:4FTV"
FT /db_xref="PDB:4GKN"
FT /db_xref="PDB:4GKS"
FT /db_xref="PDB:4I4W"
FT /db_xref="PDB:4JFD"
FT /db_xref="PDB:4JFE"
FT /db_xref="PDB:4JFF"
FT /db_xref="PDB:4JFO"
FT /db_xref="PDB:4JFP"
FT /db_xref="PDB:4JFQ"
FT /db_xref="PDB:4K7F"
FT /db_xref="PDB:4L29"
FT /db_xref="PDB:4L3C"
FT /db_xref="PDB:4L3E"
FT /db_xref="PDB:4MNQ"
FT /db_xref="PDB:4NNX"
FT /db_xref="PDB:4NNY"
FT /db_xref="PDB:4NO0"
FT /db_xref="PDB:4NO2"
FT /db_xref="PDB:4NO3"
FT /db_xref="PDB:4NO5"
FT /db_xref="PDB:4OV5"
FT /db_xref="PDB:4QOK"
FT /db_xref="PDB:4U6X"
FT /db_xref="PDB:4U6Y"
FT /db_xref="PDB:4UQ3"
FT /db_xref="PDB:4WJ5"
FT /db_xref="PDB:4WUU"
FT /db_xref="PDB:5C07"
FT /db_xref="PDB:5C08"
FT /db_xref="PDB:5C09"
FT /db_xref="PDB:5C0A"
FT /db_xref="PDB:5C0B"
FT /db_xref="PDB:5C0C"
FT /db_xref="PDB:5C0D"
FT /db_xref="PDB:5C0E"
FT /db_xref="PDB:5C0F"
FT /db_xref="PDB:5C0G"
FT /db_xref="PDB:5C0I"
FT /db_xref="PDB:5C0J"
FT /db_xref="PDB:5D2L"
FT /db_xref="PDB:5D2N"
FT /db_xref="PDB:5D9S"
FT /db_xref="PDB:5DDH"
FT /db_xref="PDB:5E00"
FT /db_xref="PDB:5E6I"
FT /db_xref="PDB:5E9D"
FT /db_xref="PDB:5ENW"
FT /db_xref="PDB:5EOT"
FT /db_xref="PDB:5EU3"
FT /db_xref="PDB:5EU4"
FT /db_xref="PDB:5EU5"
FT /db_xref="PDB:5EU6"
FT /db_xref="PDB:5EUO"
FT /db_xref="PDB:5F7D"
FT /db_xref="PDB:5F9J"
FT /db_xref="PDB:5FA3"
FT /db_xref="PDB:5FA4"
FT /db_xref="PDB:5FDW"
FT /db_xref="PDB:5HHM"
FT /db_xref="PDB:5HHN"
FT /db_xref="PDB:5HHO"
FT /db_xref="PDB:5HHP"
FT /db_xref="PDB:5HHQ"
FT /db_xref="PDB:5HYJ"
FT /db_xref="PDB:5IRO"
FT /db_xref="PDB:5ISZ"
FT /db_xref="PDB:5JHD"
FT /db_xref="PDB:5JZI"
FT /db_xref="PDB:5MEN"
FT /db_xref="PDB:5MEO"
FT /db_xref="PDB:5MEP"
FT /db_xref="PDB:5MEQ"
FT /db_xref="PDB:5MER"
FT /db_xref="PDB:5N1Y"
FT /db_xref="PDB:5N6B"
FT /db_xref="PDB:5NME"
FT /db_xref="PDB:5NMF"
FT /db_xref="PDB:5NMG"
FT /db_xref="PDB:5NMH"
FT /db_xref="PDB:5NMK"
FT /db_xref="PDB:5SWQ"
FT /db_xref="PDB:5TEZ"
FT /db_xref="PDB:5W1W"
FT /db_xref="PDB:5WSH"
FT /db_xref="UniProtKB/Swiss-Prot:P01892"
FT /experiment="experimental evidence, no additional details
FT recorded"
FT /protein_id="CAA80612.1"
FT /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT LRGYYNQSEAGSHTVQRMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT GGSYSQAASSDSAQGSDVSLTACKV"
XX
SQ Sequence 1098 BP; 219 A; 324 C; 369 G; 186 T; 0 other;
atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc 60
cagacctggg cgggctctca ctccatgagg tatttctaca cctccgtgtc ccggcccggc 120
cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc 180
gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggt 240
ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac tcaccgagtg 300
gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccgtccag 360
aggatgtttg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccaccagtac 420
gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg 480
gacatggcag ctcagaccac caagcacaag tgggaggcgg cccatgtggc ggagcagttg 540
agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag 600
gagacgctgc agcgcacgga cgcccccaaa acgcatatga ctcaccacgc tgtctctgac 660
catgaagcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc 720
tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca 780
ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaca ggagcagaga 840
tacacctgcc atgtgcagca tgagggtttg cccaagcccc tcaccctgag atgggagccg 900
tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct 960
gtgatcactg gagctgtggt cgctgctgtg atgtggagga ggaagagctc agatagaaaa 1020
ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc 1080
acagcttgta aagtgtga 1098
//