spacer

EBI Dbfetch

ID   Z22752; SV 1; linear; genomic DNA; STD; HUM; 1521 BP.
XX
AC   Z22752; S37570;
XX
DT   18-MAY-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   H.sapiens gene encoding HLA-Cw6, exons 1-3
XX
KW   HLA-Cw6.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   266-530
RX   DOI; 10.1111/j.1399-0039.1992.tb01923.x.
RX   PUBMED; 1598685.
RA   Steinle A., Noessner E., Schendel D.J.;
RT   "Isolation and characterization of a genomic HLA-Cw6 clone";
RL   Tissue Antigens 39(3):134-137(1992).
XX
RN   [2]
RP   1-1521
RA   Steinle A.;
RT   ;
RL   Submitted (14-MAY-1993) to the INSDC.
RL   Steinle A., University of Munich, Institute of Immunology, Goethestrasse
RL   31, W-8000 MUENCHEN 2, GERMANY
XX
DR   MD5; a005971f851feb36f898523ba154b782.
DR   Ensembl-Gn; ENSG00000228299; homo_sapiens.
DR   Ensembl-Tr; ENST00000420206; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1521
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="DJS"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A2 Cw6 B37 DR15 DQw6, A3 Cw4 B35 DR1 DQw5"
FT                   /clone="41/1"
FT                   /cell_type="Lymphoblastoid B-cell line"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   enhancer        314..341
FT                   /standard_name="Enhancer A"
FT   enhancer        351..365
FT                   /standard_name="Interferon Consensus Sequence"
FT   enhancer        426..436
FT                   /standard_name="Enhancer B"
FT   CAAT_signal     451..455
FT   TATA_signal     477..482
FT   CDS             join(528..600,731..1000,1246..1521,Z22753.1:1..276,
FT                   Z22753.1:398..517,Z22754.1:1..33,Z22754.1:141..188,
FT                   Z22754.1:353..357)
FT                   /standard_name="HLA-Cw*0602"
FT                   /product="HLA-Cw6"
FT                   /function="peptide presentation"
FT                   /db_xref="GOA:Q29963"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*06:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29963"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA80437.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   sig_peptide     528..599
FT   mRNA            join(528..600,731..1000,1246..1521,Z22753.1:1..276,
FT                   Z22753.1:398..517,Z22754.1:1..33,Z22754.1:141..188,
FT                   Z22754.1:353..770)
FT   exon            528..600
FT                   /number=1
FT   mat_peptide     join(600,731..1000,1246..1521,Z22753.1:1..276,
FT                   Z22753.1:398..517,Z22754.1:1..33,Z22754.1:141..188,
FT                   Z22754.1:353..354)
FT                   /standard_name="HLA-Cw*0602"
FT                   /product="HLA-Cw6"
FT                   /function="peptide presentation"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          601..730
FT                   /number=1
FT   exon            731..1000
FT                   /number=2
FT   intron          1001..1245
FT                   /number=2
FT   exon            1246..1521
FT                   /number=3
XX
SQ   Sequence 1521 BP; 277 A; 469 C; 533 G; 242 T; 0 other;
     gtacaagagt ccaaggggag aggtaagtgt cctttatttt gctggatgta gtttaatatt        60
     acctgaggta aggtaaggca aagagtggga ggcagggagt ccagttcagg gacggggatt       120
     ccaggagaag tgaaggggaa ggggctgggc gcagctgggg gtctctccct ggtttccaca       180
     gacagatcct tggccaggac tcaggcacac agtgtgacaa agatgcttgg tgtaggagaa       240
     gagggatcag gacgaagtcc caggtcccgg gcggggctct cagggtctca ggctccaagg       300
     gccgtgtctg cactggggag gcgccgcgtt gaggattctc cactcccctg agtttcactt       360
     cttctcccaa cctgcgtcgg gtccttcttc ctgaatactc atgacgcgtc cccaattccc       420
     actcccattg ggtgtcgggt tctagagaag ccaatcagcg tctccgcagt cccggttcta       480
     aagtccccag tcacccaccc ggactcggat tctccccaga cgccgagatg cgggtcatgg       540
     cgccccgaac cctcatcctg ctgctctcgg gagccctggc cctgaccgag acctgggcct       600
     gtgagtgcgg ggttgggagg gaaacggcct ctgcggagag gagcgagggg cccgcccggc       660
     gagggcgcag gacccgggga gccgcgcagg gaggtgggtc gggcgggtct cagcccctcc       720
     tcgcccccag gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc       780
     ggagagcccc gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac       840
     agcgacgccg cgagtccgag aggggagccc cgggcgccgt gggtggagca ggaggggccg       900
     gagtattggg accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac       960
     ctgcggaaac tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg      1020
     cgcaggtcac gacccctccc catcccccac ggacggcccg ggtcgccccg agtctcccgg      1080
     tctgagatcc accccgaggc tgcggaaccc gcccagaccc tcgaccggag agagccccag      1140
     tcacctttac ccggtttcat tttcagttta ggccaaaatc cccgcgggtt ggtcggggct      1200
     ggggcggggc tcgggggacg gggctgacca cgggggcggg gccagggtct cacaccctcc      1260
     agtggatgta tggctgcgac ctggggcccg acgggcgcct cctccgcggg tatgaccagt      1320
     ccgcctacga cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg      1380
     cggacacggc ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagt      1440
     ggagagccta cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga      1500
     aggagacgct gcagcgcgcg g                                                1521
//


spacer
spacer