spacer

EBI Dbfetch

ID   Z22651; SV 1; linear; mRNA; STD; HUM; 1270 BP.
XX
AC   Z22651;
XX
DT   04-MAY-1993 (Rel. 35, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   H.sapiens HLA-B35 mRNA
XX
KW   HLA-B35.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1016/0198-8859(93)90553-D.
RX   PUBMED; 8138421.
RA   Steinle A., Reinhardt C., Noessner E., Uchanska-Ziegler B., Ziegler A.,
RA   Schendel D.J.;
RT   "Microheterogeneity in HLA-B35 alleles influences peptide-dependent
RT   allorecognition by cytotoxic T cells but not binding of a
RT   peptide-restricted monoclonal antibody";
RL   Hum. Immunol. 38(4):261-269(1993).
XX
RN   [2]
RP   1-1270
RA   Steinle A.;
RT   ;
RL   Submitted (27-APR-1993) to the INSDC.
RL   Steinle A., University of Munich, Institute of Immunology, Goethestrasse
RL   31, W-8000 MUENCHEN 2, GERMANY
XX
DR   MD5; bc728157efd90eecb8bf3aaf1a0c3bdb.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="TL"
FT                   /mol_type="mRNA"
FT                   /haplotype="A24 Cw4 B35 DR3 DQw2, A2 Cw6 B13 DR7 DQw2"
FT                   /clone="TL4"
FT                   /cell_type="lymphoblastoid B-cell line"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /standard_name="HLA-B35"
FT                   /product="HLA-B35 variant"
FT                   /function="peptide presentation"
FT                   /db_xref="GOA:P30685"
FT                   /db_xref="H-InvDB:HIT000326640.14"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*35:08:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1A1N"
FT                   /db_xref="PDB:1A9B"
FT                   /db_xref="PDB:1A9E"
FT                   /db_xref="PDB:1CG9"
FT                   /db_xref="PDB:1XH3"
FT                   /db_xref="PDB:1ZHK"
FT                   /db_xref="PDB:1ZHL"
FT                   /db_xref="PDB:1ZSD"
FT                   /db_xref="PDB:2AK4"
FT                   /db_xref="PDB:2AXF"
FT                   /db_xref="PDB:2AXG"
FT                   /db_xref="PDB:2CIK"
FT                   /db_xref="PDB:2FYY"
FT                   /db_xref="PDB:2FZ3"
FT                   /db_xref="PDB:2H6P"
FT                   /db_xref="PDB:2NW3"
FT                   /db_xref="PDB:2NX5"
FT                   /db_xref="PDB:3BW9"
FT                   /db_xref="PDB:3BWA"
FT                   /db_xref="PDB:3KWW"
FT                   /db_xref="PDB:3KXF"
FT                   /db_xref="PDB:3LKN"
FT                   /db_xref="PDB:3LKO"
FT                   /db_xref="PDB:3LKP"
FT                   /db_xref="PDB:3LKQ"
FT                   /db_xref="PDB:3LKR"
FT                   /db_xref="PDB:3LKS"
FT                   /db_xref="PDB:3MV7"
FT                   /db_xref="PDB:3MV8"
FT                   /db_xref="PDB:3MV9"
FT                   /db_xref="PDB:3VFS"
FT                   /db_xref="PDB:3VFT"
FT                   /db_xref="PDB:3VFU"
FT                   /db_xref="PDB:3VFV"
FT                   /db_xref="PDB:3VFW"
FT                   /db_xref="PDB:4PR5"
FT                   /db_xref="PDB:4PRN"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30685"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA80366.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQRRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   sig_peptide     1..72
FT   mat_peptide     73..1086
FT                   /standard_name="HLA-B35"
FT                   /product="HLA-B35 variant"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   3'UTR           1090..>1270
XX
SQ   Sequence 1270 BP; 258 A; 388 C; 405 G; 219 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggca tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagcgg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgaa aagcctgaga cagctgtctt gtgagggact gagatgcagg atttcttcac      1140
     tcctcccctt tgtgacttca agagcctctg gcatctcttt ctgcaaaggc acctgaatgt      1200
     gtctgcgtcc ctgttagcct aatgtgagga ggtggagaga cagcccaccc ccgtgtccac      1260
     tgtgacccct                                                             1270
//


spacer
spacer