spacer

EBI Dbfetch

ID   AJ294938; SV 1; linear; genomic DNA; STD; HUM; 3036 BP.
XX
AC   AJ294938; Y18552;
XX
DT   09-OCT-2000 (Rel. 65, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B8null allele, isolate RS
XX
KW   HLA-B gene; HLA-B8null allele; human leucocyte antigen B;
KW   major histocompatibiliy complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1034/j.1399-0039.2000.550111.x.
RX   PUBMED; 10703611.
RA   Carter V., Dunn P.P.J., Cavanagh G., Day S., Ross J., Chapman C.;
RT   "An HLB-B null allele (B*0808N) caused by a nucleotide deletion in exon 3,
RT   found in the family of a bone marrow transplant recipient";
RL   Tissue Antigens 55(1):61-64(2000).
XX
RN   [2]
RP   1-3036
RA   Dunn P.P.J.;
RT   ;
RL   Submitted (05-OCT-2000) to the INSDC.
RL   P.P.J. Dunn, UK Transplant Support Service Authority, Fox Den Road, Stoke
RL   Gifford, Bristol, BS34 8RR, UK
XX
DR   MD5; e6aed0b7336481e346251db7ef1f5c38.
XX
CC   Y18552 created originally 18-DEC-1998
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3036
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="RS"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-A1,3;B8,7,Cw7"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,202..471,718..992,1565..1585)
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /note="B8null allele"
FT                   /db_xref="GOA:O95733"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O95733"
FT                   /protein_id="CAC12838.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTRRTPR
FT                   LRSPSASGRRPVWRSRTEPTWRARAWSGSADTWRTGRTRWSARTPQRHT"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B8null allele"
FT   intron          74..201
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B8null allele"
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B8null allele"
FT   intron          472..717
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B8null allele"
FT   exon            718..992
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B8null allele"
FT   variation       847..849
FT                   /gene="HLA-B"
FT                   /replace=""
FT                   /note="B8null allele"
FT   intron          993..1564
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B8null allele"
FT   exon            1565..1585
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B8null allele"
XX
SQ   Sequence 3036 BP; 562 A; 869 C; 971 G; 634 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgccggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttcgacacc gccatgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acgcagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggagtattgg gaccggaaca cacagatctt caagaccaac acacagactg       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg gacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggga cggggctgac cgcggggccg gggccagggt       720
     ctcacaccct ccagagcatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gtacgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct       840
     cctggacgcg gcggacaccg cggctcagat cacccagcgc aagtgggagg cggcccgtgt       900
     ggcggagcag gacagagcct acctggaggg cacgtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggacacgc tggagcgcgc gggtaccagg ggcagtgggg agccttcccc      1020
     atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg      1080
     ctagaatgtc gccctccctt gaatggagaa tggcatgagt tttcctgagt ttcctctgag      1140
     ggccccctct tctctctaga caattaaggg atgacgtctc tgaggaaatg gaggggaaga      1200
     cagtccctag aatactgatc aggggtcccc tttgacccct gcagcagcct tgggaaccgt      1260
     gacttttcct ctcaggcctt gttctctgcc tcacactcag tgtgtttggg gctctgattc      1320
     cagcacttct gagtcacttt acctccactc agatcaggag cagaagtccc tgttccccgc      1380
     tcagagactc gaactttcca atgaatagga gattatccca ggtgcctgca tccgctggtg      1440
     tctgggttct gtgccccttc cccaccccag gtgtcctgtc cattctcagg ctggtcacat      1500
     gggtggtcct agggtgtccc atgagagatg caaagcgcct gaattttctg actcttccca      1560
     tcagaccccc caaagacaca cgtgacccac caccccatct ctgaccatga ggccaccctg      1620
     aggtgctggg ccctgggctt ctaccctgcg gagatcacac tgacctggca gcgggatggc      1680
     gaggaccaaa ctcaggacac tgagcttgtg gagaccagac cagcaggaga tagaaccttc      1740
     cagaagtggg cagctgtggt ggtgccttct ggagaagagc agagatacac atgccatgta      1800
     cagcatgagg ggctgccgaa gcccctcacc ctgagatggg gtaaggaggg ggatgagggg      1860
     tcatatctct tctcagggaa agcaggagcc cttcagcagg gtcagggccc ctcatcttcc      1920
     cctcctttcc cagagccgtc ttcccagtcc accgtcccca tcgtgggcat tgttgctggc      1980
     ctggctgtcc tagcagttgt ggtcatcgga gctgtggtcg ctgctgtgat gtgtaggagg      2040
     aagagctcag gtagggaagg ggtgaggggt ggggtctggg ttttcttgtc ccactggggg      2100
     tttcaagccc caggtagaag tgttccctgc ctcattactg ggatgcagca tccacacagg      2160
     ggctaacgca gcctgggacc ctgtgtgcca gcacttactc ttttgtgcag cacatgtgac      2220
     aatgaaggac ggatgtatca ccttggtggt tgtggtgttg gggtcctgat tccagcattc      2280
     atgagtcagg ggaaggtccc tgctaaggac agaccttagg agggcagttg gtccaggacc      2340
     cacacttgct ttcctcgtgt ttcctgatcc tgccttgggt ctgtagtcat acttctggaa      2400
     attccttttg ggtccaagac gaggaggttc ctctaagatc tcatggccct gcttcctccc      2460
     agtcccctca cagggcattt tcttcccaca ggtggaaaag gagggagcta ctctcaggct      2520
     gcgtgtaagt gatgggggtg ggagtgtgga ggagctcacc caccccataa ttcctcctgt      2580
     cccacgtctc ctgcgggctc tgaccaggtc ctgtttttgt tctactccag gcagcgacag      2640
     tgcccagggc tctgatgtgt ctctcacagc ttgaaaaggt gagattcttg gggtctagag      2700
     tgggtggggt ggcgggtctg ggggtgggtg gggcagtggg gaaaggcctg ggtaatggag      2760
     attctttgat tgggatgttt cgcgtgtgtg gtgggctgtt tagagtgtca tcacttacca      2820
     tgactaacca gaatttgttc atgactgttg ttttctgtag cctgagacag ctgtcttgtg      2880
     agggactgag atgcaggatt tcttcacgcc tcccctttgt gacttcaaga gcctctggca      2940
     tctctttctg caaaggcacc tgaatgtgtc tgcgtccctg ttagcataat gtgaggaggt      3000
     ggagagacag cccacccttg tgtccactgt gaccct                                3036
//


spacer
spacer