spacer

EBI Dbfetch

ID   Y18533; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   Y18533;
XX
DT   02-FEB-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-C gene, exon 2 and joined CDS, individual 19323
XX
KW   HLA-C gene; human leucocyte antigen C; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   van den Berg-Loonen E.;
RT   ;
RL   Submitted (24-NOV-1998) to the INSDC.
RL   E. Van Den Berg-Loonen, Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.1999.540208.x.
RX   PUBMED; 10488744.
RA   van der Vlies S.A., Voorter C.E., van den Berg-Loonen E.M.;
RT   "There is more to HLA-C than exons 2 and 3: sequencing exons 1, 4 and 5";
RL   Tissue Antigens 54(2):169-177(1999).
XX
DR   MD5; 7b83f92897dbddebea26621aa0462414.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
DR   IMGT/LIGM; Y18533.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="19323"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,Y18534.1:1..276,Y18535.1:1..276,
FT                   Y18536.1:1..>120)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen C"
FT                   /db_xref="GOA:P10321"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*07:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10321"
FT                   /protein_id="CAB71800.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTI
FT                   PIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSS"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /number=2
XX
SQ   Sequence 270 BP; 53 A; 84 C; 99 G; 34 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//


spacer
spacer