Dbfetch

ID   Y18144; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   Y18144;
XX
DT   02-FEB-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-C gene, exon 4, isolate 19215
XX
KW   HLA class I; HLA-C gene; human leucocyte antigen;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-276
RA   van den Berg-Loonen E.;
RT   ;
RL   Submitted (22-SEP-1998) to the INSDC.
RL   E. Van Den Berg-Loonen, Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.1999.540208.x.
RX   PUBMED; 10488744.
RA   van der Vlies S.A., Voorter C.E., van den Berg-Loonen E.M.;
RT   "There is more to HLA-C than exons 2 and 3: sequencing exons 1, 4 and 5";
RL   Tissue Antigens 54(2):169-177(1999).
XX
DR   MD5; ecc929db3509d8ca4d69a88ed468bc97.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="19215"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /product="HLA class I"
FT                   /db_xref="IMGT/HLA:C*02:10"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MYH8"
FT                   /protein_id="CAB71937.1"
FT                   /translation="HPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-C"
FT                   /number=5
XX
SQ   Sequence 276 BP; 64 A; 83 C; 88 G; 41 T; 0 other;
     aacacccaaa gacacacgtg acccaccatc ccgtctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacaccgag cttgtggaga ccaggccagc aggagatgga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacgtgc catgtgcagc       240
     acgaggggct gccggagccc ctcaccctga gatggg                                 276
//