spacer

EBI Dbfetch

ID   Y18139; SV 1; linear; genomic DNA; STD; HUM; 120 BP.
XX
AC   Y18139;
XX
DT   02-FEB-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-C gene, exon 5, isolate 4136
XX
KW   HLA class I; HLA-C gene; human leucocyte antigen;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-120
RA   van den Berg-Loonen E.;
RT   ;
RL   Submitted (22-SEP-1998) to the INSDC.
RL   E. Van Den Berg-Loonen, Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.1999.540208.x.
RX   PUBMED; 10488744.
RA   van der Vlies S.A., Voorter C.E., van den Berg-Loonen E.M.;
RT   "There is more to HLA-C than exons 2 and 3: sequencing exons 1, 4 and 5";
RL   Tissue Antigens 54(2):169-177(1999).
XX
DR   MD5; 26c4219248233ff5bc405b95adffecd5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..120
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="4136"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>120
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /product="HLA class I"
FT                   /db_xref="GOA:Q29960"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*16:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29960"
FT                   /protein_id="CAB71932.1"
FT                   /translation="PSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSS"
FT   exon            1..120
FT                   /gene="HLA-C"
FT                   /number=5
XX
SQ   Sequence 120 BP; 17 A; 34 C; 37 G; 32 T; 0 other;
     agccatcttc ccagcccacc atccccatcg tgggcatcgt tgctggcctg gctgtcctgg        60
     ctgtcctagc tgtcctagga gctgtggtgg ctgttgttat gtgtaggagg aagagctcag       120
//


spacer
spacer