spacer

EBI Dbfetch

ID   Y18110; SV 1; linear; genomic DNA; STD; HUM; 823 BP.
XX
AC   Y18110;
XX
DT   06-NOV-1998 (Rel. 57, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MICA gene, allele MUC-17
XX
KW   MICA gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Yao Z., Volgger A., Helmberg W., Keller E., Fan L.A., Chandanayingyong D.,
RA   Albert E.D.;
RT   "Definition of new alleles of MICA using sequencing based typing.";
RL   Unpublished.
XX
RN   [2]
RP   1-823
RA   Yao Z.;
RT   ;
RL   Submitted (15-SEP-1998) to the INSDC.
RL   Z. Yao, Immunogenetics laboratory, LMU-Munich, Paul-Heysestr. 33, 80336
RL   Munich, FRG
XX
DR   MD5; 69a5b41b8bea84aeca728c8b1ef335ac.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; Y18110.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..823
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p"
FT                   /mol_type="genomic DNA"
FT                   /note="allele MUC-17"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>823
FT                   /codon_start=1
FT                   /gene="MICA"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*012:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="CAA77029.1"
FT                   /translation="EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTLYHAMHAD
FT                   CLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVS
FT                   LSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS"
FT   exon            <1..256
FT                   /gene="MICA"
FT                   /number=2
FT   exon            257..544
FT                   /gene="MICA"
FT                   /number=3
FT   exon            545..>823
FT                   /gene="MICA"
FT                   /number=4
XX
SQ   Sequence 823 BP; 215 A; 219 C; 233 G; 156 T; 0 other;
     gagccccaca gtcttcgtta taacctcacg gtgctgtcct gggatggatc tgtgcagtca        60
     gggtttctca ctgaggtaca tctggatggt cagcccttcc tgcgctgtga caggcagaaa       120
     tgcagggcaa agccccaggg acagtgggca gaagatgtcc tgggaaacaa gacatgggac       180
     agagagacca gagacttgac agggaacgga aaggacctca ggatgaccct ggctcatatc       240
     aaggaccaga aagaaggctt gcattccctc caggagatta gggtctgtga gatccatgaa       300
     gacaacagca ccaggagctc ccagcatttc tactacgatg gggagctctt cctctcccaa       360
     aacctggaga ctgaggaatg gacaatgccc cagtcctcca gagctcagac cttggccatg       420
     aacgtcagga atttcttgaa ggaagatgcc atgaagacca agacactcta tcacgctatg       480
     catgcagact gcctgcagga actacggcga tatctaaaat ccggcgtagt cctgaggaga       540
     acagtgcccc ccatggtgaa tgtcacccgc agcgaggcct cagagggcaa cattaccgtg       600
     acatgcaggg cttctggctt ctatccctgg aatatcacac tgagctggcg tcaggatggg       660
     gtatctttga gccacgacac ccagcagtgg ggggatgtcc tgcctgatgg gaatggaacc       720
     taccagacct gggtggccac caggatttgc caaggagagg agcagaggtt cacctgctac       780
     atggaacaca gcgggaatca cagcactcac cctgtgccct ctg                         823
//


spacer
spacer