spacer

EBI Dbfetch

ID   Y17695; SV 1; linear; genomic DNA; STD; HUM; 247 BP.
XX
AC   Y17695;
XX
DT   03-JUL-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-DRB1*13PL gene, exon 2 and partial CDS
XX
KW   beta chain; HLA-DRB1*13PL gene; human leucocyte antigen;
KW   major histocompatability complex class II.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-247
RA   Guttridge M.;
RT   ;
RL   Submitted (29-JUN-1998) to the INSDC.
RL   M. Guttridge, Welsh Blood Service, Ely Valley Road, Talbot Green,
RL   Pontyclun, CF72 9WB, UK
XX
DR   MD5; b7632aea6ae99c1efef814d0a0676f9d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..247
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="UBM 10843566"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>247
FT                   /codon_start=2
FT                   /gene="DRB1*13PL"
FT                   /product="HLA-B, beta chain"
FT                   /db_xref="GOA:O77965"
FT                   /db_xref="IMGT/HLA:DRB1*13:20"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O77965"
FT                   /protein_id="CAA76817.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVT
FT                   ELGRPDAEYWNSQKDLLEDERAAVDTYCRHNYGVVES"
FT   exon            <1..>247
FT                   /gene="DRB1*13PL"
XX
SQ   Sequence 247 BP; 52 A; 59 C; 89 G; 47 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttccata accaggagga gaacgtgcgc ttcgacagcg acgtggggga       120
     gttccgggcg gtgacggagc tggggcggcc tgatgccgag tactggaaca gccagaagga       180
     cctcctggaa gacgagcggg ccgcggtgga cacctactgc agacacaact acggggttgt       240
     ggagagc                                                                 247
//


spacer
spacer