spacer

EBI Dbfetch

ID   Y17224; SV 1; linear; mRNA; STD; HUM; 1116 BP.
XX
AC   Y17224;
XX
DT   02-MAR-1999 (Rel. 59, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens mRNA for MHC class I antigen, allele A*1103
XX
KW   HLA-A gene; HLA-A*1103 allele; human leucocyte antigen;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1034/j.1399-0039.2000.550113.x.
RX   PUBMED; 10703613.
RA   Tijssen H.J., Sistermans E.A., van den Beucken M., Krausa P., Joosten I.;
RT   "Complete sequence analysis of the A*1103 allele";
RL   Tissue Antigens 55(1):68-70(2000).
XX
RN   [2]
RP   1-1116
RA   Tijssen H.J.;
RT   ;
RL   Submitted (05-MAY-1998) to the INSDC.
RL   H.J. Tijssen, University Hospital Nijmegen St. Raboud, Blood Transfusion
RL   service, Transplant Serology Lab. P.O.Box 9101, 6500 HB Nijmegen,
RL   NETHERLANDS
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.2000.550504.x.
RX   PUBMED; 10885562.
RA   Tijssen H.J., Sistermans E.A., Joosten I.;
RT   "A unique second donor splice site in the intron 5 sequence of the HLA-A*11
RT   alleles results in a class I transcript encoding a molecule with an
RT   elongated cytoplasmic domain";
RL   Tissue Antigens 55(5):422-428(2000).
XX
DR   MD5; 901bea46986c75a29f5d3249d904ed7d.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1116
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="MAD"
FT                   /mol_type="mRNA"
FT                   /clone="M1"
FT                   /clone="M3"
FT                   /clone="M12"
FT                   /clone="M13"
FT                   /cell_type="PBL"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,74..343,344..619,620..895,896..1012,1031..1063,
FT                   1064..1111,1112..1116)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /note="A*1103 allele"
FT                   /note="short variant"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="H-InvDB:HIT000325995.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:4BEO"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13746"
FT                   /protein_id="CAB38056.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAREAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   CDS             join(1..73,74..343,344..619,620..895,896..1030,1031..1063,
FT                   1064..1111,1112..1116)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /note="A*1103 allele"
FT                   /note="alternative, long variant"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*11:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:4BEO"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13746"
FT                   /protein_id="CAB38057.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAREAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSGGE
FT                   GVKDRKGGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /number=1
FT   exon            74..343
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            344..619
FT                   /gene="HLA-A"
FT                   /number=3
FT   exon            620..895
FT                   /gene="HLA-A"
FT                   /number=4
FT   exon            896..1012
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="short variant"
FT   exon            896..1030
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="alternative, long variant"
FT   exon            1031..1063
FT                   /gene="HLA-A"
FT                   /number=6
FT   exon            1064..1111
FT                   /gene="HLA-A"
FT                   /number=7
FT   exon            1112..1116
FT                   /gene="HLA-A"
FT                   /number=8
XX
SQ   Sequence 1116 BP; 225 A; 331 C; 382 G; 178 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccggcaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagatcac caagcgcaag tgggaggcgg cccgtgaggc ggagcagcag       540
     agagcctacc tggagggccg gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc aggtggagaa      1020
     ggggtgaaag atagaaaagg agggagttac actcaggctg caagcagtga cagtgcccag      1080
     ggctctgatg tgtctctcac agcttgtaaa gtgtga                                1116
//


spacer
spacer