spacer

EBI Dbfetch

ID   Y16802; SV 1; linear; genomic DNA; STD; HUM; 778 BP.
XX
AC   Y16802;
XX
DT   11-MAR-1998 (Rel. 54, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MICA gene, allele MUC-19
XX
KW   MICA gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-778
RA   Yao Z.;
RT   ;
RL   Submitted (05-MAR-1998) to the INSDC.
RL   Z. Yao, Labor fuer Immungenetik, Kinderpoliklinik der LMU Muenchen,
RL   Pettenkoferstr. 8a, 80807 Muenchen, FRG
XX
RN   [3]
RA   Yao Z., Volgger A., Helmberg W., Keller E., Fan L.A., Chandanayingyong D.,
RA   Albert E.D.;
RT   "Definition of new alleles of MICA using sequencing based typing.";
RL   Unpublished.
XX
DR   MD5; 3f211f121598b635fa938798d6075ab4.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; Y16802.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..778
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p"
FT                   /mol_type="genomic DNA"
FT                   /note="allele MUC-19"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>778
FT                   /codon_start=1
FT                   /gene="MICA"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*016"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="CAA76394.1"
FT                   /translation="GSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWD
FT                   RETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLS
FT                   QNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESSVVL
FT                   RRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGLSLSHDTQQWGDVLPDG
FT                   NGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPS"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /number=2
FT   exon            256..543
FT                   /gene="MICA"
FT                   /number=3
FT   exon            544..778
FT                   /gene="MICA"
FT                   /number=4
XX
SQ   Sequence 778 BP; 206 A; 207 C; 222 G; 143 T; 0 other;
     ggatctgtgc agtcagggtt tcttgctgag gtacatctgg atggtcagcc cttcctgcgc        60
     tatgacaggc agaaatgcag ggcaaagccc cagggacagt gggcagaaga tgtcctggga       120
     aataagacat gggacagaga gaccagggac ttgacaggga acggaaagga cctcaggatg       180
     accctggctc atatcaagga ccagaaagaa ggcttgcatt ccctccagga gattagggtc       240
     tgtgagatcc atgaagacaa cagcaccagg agctcccagc atttctacta cgatggggag       300
     ctcttcctct cccaaaacct ggagactgag gaatggacag tgccccagtc ctccagagct       360
     cagaccttgg ccatgaacgt caggaatttc ttgaaggaag atgccatgaa gaccaagaca       420
     cactatcacg ctatgcatgc agactgcctg caggaactac ggcgatatct agaatccagc       480
     gtagtcctga ggagaacagt gccccccatg gtgaatgtca cccgcagcga ggcctcagag       540
     ggcaacatca ccgtgacatg cagggcttcc agcttctatc cccggaatat catactgacc       600
     tggcgtcagg atgggctatc tttgagccac gacacccagc agtgggggga tgtcctgcct       660
     gatgggaatg gaacctacca gacctgggtg gccaccagga tttgccgagg agaggagcag       720
     aggttcacct gctacatgga acacagcggg aatcacagca ctcaccctgt gccctctg         778
//


spacer
spacer