spacer

EBI Dbfetch

ID   Y16801; SV 1; linear; genomic DNA; STD; HUM; 822 BP.
XX
AC   Y16801;
XX
DT   11-MAR-1998 (Rel. 54, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MICA gene, allele MUC-18
XX
KW   MICA gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RC   revised by [3]
RA   Yao Z.;
RT   ;
RL   Submitted (05-MAR-1998) to the INSDC.
RL   Z. Yao, Labor fuer Immungenetik, Kinderpoliklinik der LMU Muenchen,
RL   Pettenkoferstr. 8a, 80807 Muenchen, FRG
XX
RN   [3]
RP   1-822
RA   Yao Z.;
RT   ;
RL   Submitted (23-MAR-1998) to the INSDC.
RL   Z. Yao, Labor fuer Immungenetik, Kinderpoliklinik der LMU Muenchen,
RL   Pettenkoferstr. 8a, 80807 Muenchen, FRG
XX
RN   [4]
RA   Yao Z., Volgger A., Helmberg W., Keller E., Fan L.A., Chandanayingyong D.,
RA   Albert E.D.;
RT   "Definition of new alleles of MICA using sequencing based typing.";
RL   Unpublished.
XX
DR   MD5; c36cc2d17cc93dc4b9cd70478cac4494.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; Y16801.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p"
FT                   /mol_type="genomic DNA"
FT                   /note="allele MUC-18"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>822
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*010:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="CAA76393.1"
FT                   /translation="PHSLPYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPS"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /number=2
FT   exon            256..543
FT                   /gene="MICA"
FT                   /number=3
FT   exon            544..822
FT                   /gene="MICA"
FT                   /number=4
XX
SQ   Sequence 822 BP; 214 A; 221 C; 232 G; 155 T; 0 other;
     agccccacag tcttccttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggcttg cattccctcc aggagattag ggtctgtgag atccatgaag       300
     acaacagcac caggagctcc cagcatttct actacgatgg ggagctcttc ctctcccaaa       360
     acctggagac tgaggaatgg acagtgcccc agtcctccag agctcagacc ttggccatga       420
     acgtcaggaa tttcttgaag gaagatgcca tgaagaccaa gacacactat cacgctatgc       480
     atgcagactg cctgcaggaa ctacggcgat atctagaatc cagcgtagtc ctgaggagaa       540
     cagtgccccc catggtgaat gtcacccgca gcgaggcctc agagggcaac atcaccgtga       600
     catgcagggc ttccagcttc tatccccgga atatcatact gacctggcgt caggatgggg       660
     tatctttgag ccacgacacc cagcagtggg gggatgtcct gcctgatggg aatggaacct       720
     accagacctg ggtggccacc aggatttgcc gaggagagga gcagaggttc acctgctaca       780
     tggaacacag cgggaatcac agcactcacc ctgtgccctc tg                          822
//


spacer
spacer