spacer

EBI Dbfetch

ID   Y16636; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   Y16636;
XX
DT   11-OCT-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I HLA B exon 2, individual 18543
XX
KW   HLA class I antigen; HLA-B gene; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-270
RA   van den Berg-Loonen E.;
RT   ;
RL   Submitted (20-FEB-1998) to the INSDC.
RL   E. van den Berg-Loonen, Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.2000.560408.x.
RX   PUBMED; 11098936.
RA   Voorter C., van der Vlies S., van den Berg-Loonen E.;
RT   "Sequence-based typing of HLA-B: the B7 cross-reacting group";
RL   Tissue Antigens 56(4):356-362(0).
XX
DR   MD5; 1974d3b9fe4e0ec12559555af5e16003.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="18543"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="HLA class I"
FT                   /db_xref="GOA:Q9GJ14"
FT                   /db_xref="IMGT/HLA:B*40:10:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJ14"
FT                   /protein_id="CAC12861.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 85 C; 89 G; 35 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer