Dbfetch

ID   Y16418; SV 1; linear; genomic DNA; STD; HUM; 120 BP.
XX
AC   Y16418;
XX
DT   05-JAN-1999 (Rel. 58, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-C gene, exon 5
XX
KW   antigen; HLA-C; MHC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1998.tb03087.x.
RX   PUBMED; 9894855.
RA   van der Vlies S., Voorter C., van den Berg-Loonen E.;
RT   "A reliable and efficient high resolution typing method for HLA-C using
RT   sequence-based typing";
RL   Tissue Antigens 52(6):558-568(1998).
XX
RN   [2]
RP   1-120
RA   van den Berg-Loonen E.;
RT   ;
RL   Submitted (05-FEB-1998) to the INSDC.
RL   E. Van Den Berg-Loonen, Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS
XX
DR   MD5; 710908a856232c041ec3d835b6ce5ee5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..120
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="lymphocytes"
FT                   /db_xref="taxon:9606"
FT   exon            1..120
FT                   /number=5
FT   CDS             <1..>120
FT                   /codon_start=3
FT                   /product="MHC class I HLA C antigen"
FT                   /db_xref="GOA:Q9TNT2"
FT                   /db_xref="IMGT/HLA:C*07:01:01:01"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TNT2"
FT                   /protein_id="CAA76206.1"
FT                   /translation="PSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSS"
XX
SQ   Sequence 120 BP; 19 A; 36 C; 34 G; 31 T; 0 other;
     agccatcttc ccagcccacc atccccatca tgggcatcgt tgctggcctg gctgtcctgg        60
     ttgtcctagc tgtccttgga gctgtggtca ccgctatgat gtgtaggagg aagagctcag       120
//