Dbfetch

ID   Y16224; SV 1; linear; genomic DNA; STD; HUM; 247 BP.
XX
AC   Y16224;
XX
DT   15-JAN-1998 (Rel. 54, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-DRB1 gene, allele HLA-DRB1*07ROS, partial exon 2
XX
KW   beta chain; class II; exon 2; HLA-DRB1*07ROS gene;
KW   major histocompatability complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1034/j.1399-0039.2000.560514.x.
RX   PUBMED; 11144299.
RA   Darke C., Guttridge M.G., Street J., Thompson J., Thomas M.;
RT   "Molecular, serological and genetic studies on two new HLA-DRB1
RT   alleles--HLA-DRB1*0704 and HLA-DRB1*1507";
RL   Tissue Antigens 56(5):467-469(2000).
XX
RN   [2]
RP   1-247
RA   Guttridge M.;
RT   ;
RL   Submitted (13-JAN-1998) to the INSDC.
RL   M. Guttridge, Welsh Blood Service, Ely Valley Road, Talbot Green,
RL   Pontyclun, CF72 9WB, UK
XX
DR   MD5; 8a1680249b3c168a2806c20150cdfe1c.
DR   Ensembl-Gn; ENSG00000229074; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236884; homo_sapiens.
DR   Ensembl-Tr; ENST00000437784; homo_sapiens.
DR   Ensembl-Tr; ENST00000444645; homo_sapiens.
DR   Ensembl-Tr; ENST00000617823; homo_sapiens.
DR   Ensembl-Tr; ENST00000620951; homo_sapiens.
DR   EuropePMC; PMC149978; 12589040.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..247
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="UBM 12827878"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="UBM 12827878"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>247
FT                   /codon_start=2
FT                   /gene="HLA-DRB1*07ROS"
FT                   /product="major histocompatibility complex class II
FT                   HLA-DRB1 protein beta chain"
FT                   /db_xref="GOA:P13761"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*07:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13761"
FT                   /protein_id="CAA76123.1"
FT                   /translation="FLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVT
FT                   ELGRPVAESWNSQKDILEDRRGQVDNYCRHNYGVGES"
FT   exon            <1..>247
FT                   /gene="HLA-DRB1*07ROS"
FT                   /number=2
FT   variation       213..217
FT                   /note="polymorphism differs from DRB1*0701"
XX
SQ   Sequence 247 BP; 55 A; 55 C; 90 G; 47 T; 0 other;
     tttcctgtgg cagggtaagt ataagtgtca tttcttcaac gggacggagc gggtgcagtt        60
     cctggaaaga ctcttctata accaggagga gttcgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tagggcggcc tgtcgccgag tcctggaaca gccagaagga       180
     catcctggag gacaggcggg gccaggtgga caattactgc agacacaact acggggttgg       240
     tgagagc                                                                 247
//