spacer

EBI Dbfetch

ID   Y15840; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   Y15840;
XX
DT   10-JUN-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene B40 allele, exons 2 and 3
XX
KW   HLA-B gene; HLA-B40 variant; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   van Dam M., Bunce M., Dunn P.P.J.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Dunn P.P.J.;
RT   ;
RL   Submitted (09-DEC-1997) to the INSDC.
RL   P.P.J. Dunn, UK Transplant Support Service Authority, Fox Den Road, Stoke
RL   Gifford, Bristol, BS12 6RR, UK
XX
DR   MD5; fdf71348459ac6d1c67d90ee63eba1e1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /isolate="DNA 10PNG"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /note="B40 allele"
FT                   /db_xref="GOA:Q9UIP4"
FT                   /db_xref="IMGT/HLA:B*40:10:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UIP4"
FT                   /protein_id="CAB44775.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B40 allele"
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            516..>791
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B40 allele"
XX
SQ   Sequence 791 BP; 145 A; 261 C; 281 G; 104 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccga       360
     ccccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggact gggctgaccg cggggccggg gccagggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc tcccagcgca agttggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggacaagct       780
     ggagcgcgct g                                                            791
//


spacer
spacer