Dbfetch

ID   Y15404; SV 1; linear; genomic DNA; STD; HUM; 247 BP.
XX
AC   Y15404;
XX
DT   06-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-DRB1 gene, allele HLA-DRB1*15LJM, partial exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*15LJM; major histocompatability complex class II.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-247
RA   Guttridge M.G.;
RT   ;
RL   Submitted (03-NOV-1997) to the INSDC.
RL   M.G. Guttridge, Welsh Blood Service, Ely Valley Road, Talbot Green,
RL   Pontyclun CF2 9NB, UK
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.2000.560514.x.
RX   PUBMED; 11144299.
RA   Darke C., Guttridge M.G., Street J., Thompson J., Thomas M.;
RT   "Molecular, serological and genetic studies on two new HLA-DRB1
RT   alleles--HLA-DRB1*0704 and HLA-DRB1*1507";
RL   Tissue Antigens 56(5):467-469(2000).
XX
DR   MD5; e39a063129c8279b1ffa12e8b0ff53ad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..247
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="UBM12218693"
FT                   /cell_type="leukokcytes"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>247
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="HLA class II beta chain"
FT                   /note="allele variant HLA-DRB1*15LJM"
FT                   /db_xref="GOA:O19786"
FT                   /db_xref="IMGT/HLA:DRB1*15:07:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19786"
FT                   /protein_id="CAA75604.1"
FT                   /translation="FLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAVT
FT                   ELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVES"
FT   exon            <1..>247
FT                   /gene="HLA-DRB1"
FT                   /product="HLA class II beta chain"
FT                   /number=2
FT   variation       123
FT                   /note="polymorphism differs from DRB1*1501"
XX
SQ   Sequence 247 BP; 51 A; 59 C; 93 G; 44 T; 0 other;
     tttcctgtgg cagcctaaga gggagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaggagga gtccgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tggggcggcc tgacgctgag tactggaaca gccagaagga       180
     catcctggag caggcgcggg ccgcggtgga cacctactgc agacacaact acggggttgt       240
     ggagagc                                                                 247
//